Literature DB >> 32554616

Combined DLL3-targeted bispecific antibody with PD-1 inhibition is efficient to suppress small cell lung cancer growth.

Xin Chen1, Norhan Amar1, Yuankui Zhu1, Chunguang Wang2, Chunjiao Xia1, Xiaoqing Yang3, Dongde Wu4, Mingqian Feng5.   

Abstract

BACKGROUND: Small cell lung cancer (SCLC) accounts for 15% of lung cancers, and the primary treatment of this malignancy is chemotherapy and radiotherapy. Delta-like 3 (DLL3) is an attractive target for SCLC immunotherapy since its expression is highly restricted to SCLC with a neglectable appearance on normal adult tissues. In the current study, we aimed to explore the efficacy of DLL3-targeted SCLC immunotherapy via the engagement of T cell.
METHODS: As a proof of concept, we constructed DLL3-targeted bispecific antibody and chimeric antigen receptor (CAR)-modified T cells. In vitro and in vivo tumor-suppression activity of these treatments alone or in combination with a Program Death-1 (PD-1) inhibitory antibody was evaluated.
RESULTS: In vitro studies showed that both DLL3 bispecific antibody and CAR-T efficiently killed DLL3-positive cancer cells, including the native SCLC cell lines H446, H196, H82, and the artificial A431 cells that were forcefully overexpressing DLL3. In vivo studies in xenograft mouse models demonstrated that both bispecific antibody and CAR-T suppressed the tumor growth, and combination therapy with PD-1 inhibitory antibody dramatically improved the efficacy of the DLL3 bispecific antibody, but not the CAR-T cells.
CONCLUSIONS: Our results demonstrated that DLL3-targeted bispecific antibody plus PD-1 inhibition was effective in controlling SCLC growth. © Author(s) (or their employer(s)) 2020. Re-use permitted under CC BY-NC. No commercial re-use. See rights and permissions. Published by BMJ.

Entities:  

Keywords:  antibodies; biomarkers; immunotherapy; lung neoplasms; neoplasm; tumor

Mesh:

Substances:

Year:  2020        PMID: 32554616      PMCID: PMC7304844          DOI: 10.1136/jitc-2020-000785

Source DB:  PubMed          Journal:  J Immunother Cancer        ISSN: 2051-1426            Impact factor:   13.751


Background

Small cell lung cancer (SCLC) is a subtype of lung cancer, which accounts for about 15% of all lung cancer cases.1–3 SCLC is notorious for its high degree of malignant attributes, including fast growth, early tendency to widespread metastasis, and poor prognosis.1–3 According to the staging system of the Veterans Administration Lung Study Group, SCLC can be classified as the limited disease (early stage) and extensive disease (late or advanced stage).4 Approximately 70% of patients are diagnosed at extensive stage, which is frequently accompanied with distant metastasis.1 2 By far, systemic chemotherapy and localized radiotherapy still represent the main treatment modalities for SCLC. According to the international standard of care, patients with SCLC with extensive stage and widespread metastasis are typically treated with chemotherapy cisplatin or carboplatin together with etoposide.5 For early stage of SCLC, local radiotherapy combined with chemotherapy is recommended. Although SCLC is sensitive to the initial chemotherapy and radiotherapy, it has a very high rate of relapse and drug tolerance.2 In recent years, immunotherapy has achieved great clinical success in non-SCLC and other cancer types. However, the progress on SCLC immunotherapy is far from satisfaction, and the mainstay of clinical trials in SCLC immunotherapy is restricted to immune checkpoint inhibitors (ICIs).6 CheckMate032 was a phase I/II clinical trial to evaluate the efficacy and safety of nivolumab (anti-PD-1) plus ipilimumab (anti-CTLA4) on extensive-stage SCLC.7 In this trial, a total of 216 patients were enrolled and treated. An objective response rate was 10%–33% depending on the drug combinations and dosage. However, high rate of grade 3 or 4 treatment-related adverse events (13%–30%, depending on the dosage) was not satisfactory. Other clinical trials of ICIs include KeyNote-158 (ClinicalTrials.gov identifier: NCT02628067, a phase II trial investigating pembrolizumab in relapsed or refractory SCLC)1 and IMpower133 that combined atezolizumab (anti-PD-L1) with carboplatin and etoposide.8 Overall, the clinical data on the efficacy of ICIs monotherapy in SCLC are not very promising.2 Therefore, seeking other forms of immunotherapy with more potency is desperately needed, for example, bispecific antibody and chimeric antigen receptor (CAR)-modified T cells. Delta-like 3 (DLL3) is a single-pass type I transmembrane protein. The extracellular domain of DLL3 interacts with Notch receptor.9 A host of studies repeatedly and consistently indicated that DLL3 is an attractive target for cancer immunotherapy, particularly in SCLC and to a less extent in other cancer types.10–14 DLL3 is selectively expressing on the vast majority of SCLC (~70% in prevalence) with minimal or absent expression in normal adult tissues, even though the expression level might be magnitude lower than a typical immunotherapy target.10 11 15 DLL3-targeted antibody–drug conjugate (ADC) rovalpituzumab tesirine (Rova-T, SC16LD6.5) has shown durable tumor regression in vivo across multiple Patient-Derived Xenograft (PDX) models.16 Phase I clinical trial of Rova-T on SCLC presented some promising results in terms of efficacy, with 18% (11 out of 60) of treated patients having shown objective response, and 68% (41 out of 60) disease stabilization.17 However, the outcomes of the other following clinical trials were questionable or somewhat dampening.9 Nevertheless, the specificity of this target in SCLC encouraged us to seek the efficacy of DLL3-targeted T cell-based immunotherapy. As a proof of concept, we made a T cell-engaging bispecific antibody and CAR based on the mAb SC16.15. The cytotoxicity of DLL3-targeted bispecific antibody and CAR-T was tested in vitro and in xenograft mice.

Methods

Cell lines

Three SCLC cell lines (H446, H196, H82) and DLL3-negative A431 cell line were maintained as adherent monolayer cultures in Dulbecco's Modified Eagle Medium (DMEM) medium (Invitrogen, Carlsbad, California) supplemented with 10% fetal bovine serum (HyClone, Logan, Utah), 1% L-glutamine, and 1% penicillin–streptomycin (Invitrogen) and incubated in 5% CO2 with a balance of air at 37°C. Cells were harvested and the media were refreshed two times a week. DLL3-negative A431 cells (human epithelial carcinoma cell line) were engineered to overexpress DLL3 by transfection with a plasmid encoding the full-length DLL3 (GeneBank accession number NP_058637.1). Both A431 and the stably transfected A431 (DLL3) cells were maintained in DMEM medium.

Antibodies and western blot

Antibody used in western blot for DLL3 was from Proteintech Group (Wuhan, China). Cells were cultured in T-25 or T-75 flasks for 3–5 days at a final confluence of 70%. Cells were collected and lysed with lysis buffer (50 mM Tris–HCl, pH 7.5, 50 mM NaCl, 5 mM EDTA, 1% Triton X-100, mixed with cocktail proteinase inhibitors from Roche Applied Science (Indianapolis, Indiana)). Protein concentration of the cell lysate was measured by Coomassie Plus (Bradford) Protein Assay from Thermo Scientific (Rockford, Illinois). Fifty micrograms of total protein were run on reducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) for western blot analysis.

Construction of DLL3 bispecific antibody

The DLL3-targeted SC16.15 scFv (sequence from patent US9173959B1) was fused with hFc knob mutant (N297A/S354C/T366W). By using an EcoRV/BspEI double digestion cloning method, the scFv coding sequence was cloned into the knob expression plasmid, placed downstream of a mouse IgG secretion signal peptide. The amino acid sequence of the knob cassette reads as: MEWSWVFLFFLSVTTGVHSDI QVQLQQSGAELAKPGASVKMSCKASGYTFTRYWIHWIKQRPGQGLEWIGYINPTTVYTEFNQNFKDKATLTADKSSTTASMQLSSLTSEDSAVYYCARGGSNFFDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIQMTQSPASLAASVGETVAITCRASENIYYNLAWYQQKQGKSPQLLIYTANSLEDGVPSRFSGSGSGTQYSLKINSMQPEDSATYFCKQAYDVPPTFGGGTKLEIK SGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (EcoRV/BspEI sites underlined, scFv in italic, and N297A/S354C/T366W mutations highlighted). The CD3-targeted OKT3 scFv was fused with hFc hole mutant (N297A/Y349C/T366S/L368A/Y407V). The OKT3 scFv coding sequence was cloned into the hole expression plasmid in a similar way. The amino acid sequence of the hole cassette reads as: MEWSWVFLFFLSVTTGVHSDI DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK SGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (EcoRV/BspEI sites underlined, scFv in italic, and N297A/Y349C/T366S/L368A/Y407V mutations highlighted). The knob and hole plasmids were mixed at 1:1 ratio and introduced into 293 F cells by polyethylenimine (PEI) transfection. The heterodimerized bispecific antibody was secreted into the medium and purified via protein A chromatography.

Production of CAR-T cells

The CAR expression cassette adopted the third generation format and was constructed by de novo gene synthesis, which consisted of the CD8a leader sequence (NP_001139345, a.a. 1–21), followed by anti-DLL3 scFv (SC16.15, sequence from patent US9173959B1) or isotype control HN3 (a human antibody that targets glypican-3, sequence from patent US20140044714), the CD8α hinge (NP_001139345, a.a. 138–182), CD8α transmembrane region (NP_001139345, a.a. 183–210), CD28 intracellular domain (NP_006130.1, a.a. 180–220), 4-1BB intracellular domain (NP_001552.2, a.a. 214–255), CD3ζ intracellular domain (NP_932170, a.a. 52–164), internal ribosome entry site (from encephalomyocarditis virus), and a red fluorescent protein mScarlet-I. The amino acid sequence of the CAR-HN3 cassette reads as: MALPVTALLLPLALLLHAARP DI QVQLVQSGGGLVQPGGSLRLSCAASYFDFDSYEMSWVRQAPGKGLEWIGSIYHSGSTYYNPSLKSRVTISRDNSKNTLYLQMNTLRAEDTATYYCARVNMDRFDYWGQGTLVTVSS SGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (restriction enzyme sites underlined, HN3 in italic). CAR-SC16.15 had the same sequence except that HN3 part was replaced by SC16.15 coding sequence. Human peripheral blood mononuclear cells (PBMC) were isolated from the whole blood of healthy donors (Wuhan Blood Center) by a Ficoll separation method (Stem Cell Technologies, Vancouver, British Columbia, Canada). PBMC were cultured in RPMI 1640 medium supplemented with 200 IU/mL human recombinant interleukin (IL)-2 and activated by Dynabeads CD3/CD28 human T-activator (Cat. 11 131D, ThermoFisher, Waltham, Massachusetts) for 3 days according to the manufacturer’s instruction. The activated PBMC were transduced with lentivirus carrying the CAR cassette for 24 hours. After transduction, refreshed medium containing 200 IU/mL of IL-2 was used to culture the CAR-T cells for additional 3 days before the functional studies. The expression of CAR genes was indicated by the expression of mScarlet-I protein as detected by flow cytometry.

Flow cytometry method

Cells were harvested by detaching with trypsin–EDTA (ThermoFisher, Waltham, Massachusetts), washed by centrifugation, and resuspended in ice-cold phosphate buffer saline (PBS) containing 5% bovine serum albumin (BSA). One million of cells per mL were incubated with 10 µg/mL of DLL3 bispecific antibody. The antibody binding was detected by phycoerythrin-conjugated goat antihuman IgG (Jackson ImmunoResearch, West Grove, Pennsylvania). The fluorescence associated with the live cells was measured using an FACS Calibur (BD Biosciences, Franklin Lakes, New Jersey). For PD-L1 expression analysis, a rabbit monoclonal antibody (Sinobiological, Beijing, China) was incubated with the SCLC cells and the antibody binding was detected by allophycocyanin (APC)-conjugated goat-anti-rabbit IgG (Jackson ImmunoResearch, West Grove, Pennsylvania). For PD-1 expression analysis, a PD-1 inhibitory antibody (in-house made as scFv-hFc format, using nivolumab VH and VL sequences) was incubated with CAR-T cells and the antibody binding was detected by APC-conjugated goat-anti-human IgG (Jackson ImmunoResearch, West Grove, Pennsylvania).

In vitro cytotoxicity assay

In vitro cell killing activity of the bispecific antibody and CAR-T cells was assessed by firefly luciferase reporter assay. Cancer cells were stably transduced with a lentiviral vector that carries a luciferase reporter gene (ffLuc2). Two hundred microliters of stably transduced cells were seeded on a 96-well plate (104 cells/well), with the addition of PBMC and bispecific antibody at the indicated concentrations, or addition of CAR-T cells at the indicated amount. Untreated cells were used as control. The cell mixtures were incubated at 37°C for 48 hours and then collected by spinning down. Collected cells were then lysed by two rounds of freezing–thawing. The released luciferase activity was measured to represent the cell viability. The in vitro cytotoxicity assay was repeated three times and PBMC from a total of three donors was tested. Reported was the representative result.

In vivo efficacy study

Five million H446 and A431 (DLL3) cells were subcutaneously injected into NOD/SCID/IL2Rg(null) (NSG) mice. After the tumor formed and reached the size of 100–200 mm3, the treatment was started by splenocyte depletion with 200 mg/kg cyclophosphamide (Sigma-Aldrich, St. Louis, Missouri). One day later, mice were intraperitoneally injected with 10 millions of PBMC cells or 5 millions of CAR-T cells, and intravenously injected with bispecific antibody and PD-1 antibody. The bispecific antibody was given two times at the indicated time point, and PD-1 antibody was given once every week. Tumor dimensions were determined every 2 or 3 days with a caliper. Tumor volume (mm3) was calculated by the formula: (a) × (b) ×0.5, where a is tumor length and b is tumor width in millimeters. Five mice per group were assigned. The in vivo study was repeated two times with two different donors as the source of PBMC.

Statistical analysis

All statistical analyses were conducted using GraphPad Prism5 (GraphPad Software, La Jolla, California) and expressed as the mean±SEM. Comparison of two groups was performed using paired Student’s t-test (two tailed). Comparisons among three or more groups were performed using one-way analysis of variance. P<0.05 was considered statistically significant.

Results

Preparation of DLL3-targeted bispecific antibody

We used the classical knob-into-hole structure to make the bispecific antibody.18 The anti-DLL3 scFv SC16.15 was fused with a human Fc knob and the anti-CD3 scFv OKT3 was fused with Fc hole (figure 1A). Both the knob and hole plasmid were coexpressed in 293F cells. The heterodimerized bispecific antibody was purified via protein A affinity chromatography and the purity was accessed by SDS-PAGE (figure 1B). As expected, the non-reduced heterodimer migrated mainly as 120 kD and the reduced monomers of both knob and hole migrated as about 60 kD.
Figure 1

Preparation of delta-like 3 (DLL3) bispecific antibody. (A) Schematic diagram of the primary structure of the DLL3 bispecific antibody. The anti-DLL3 scFv (SC16.15) was fused with hFc knob, and the anti-CD3 scFv (OKT3) was fused with hFc hole. (B) SDS-PAGE analysis of the purified bispecific antibody. Two micrograms of protein were loaded for each lane. Non-R., non-reduced condition, showing the dimerized bispecific antibody; Red., 2-mercaptoethanol reduced condition, showing the reduced monomer of the bispecific antibody.

Preparation of delta-like 3 (DLL3) bispecific antibody. (A) Schematic diagram of the primary structure of the DLL3 bispecific antibody. The anti-DLL3 scFv (SC16.15) was fused with hFc knob, and the anti-CD3 scFv (OKT3) was fused with hFc hole. (B) SDS-PAGE analysis of the purified bispecific antibody. Two micrograms of protein were loaded for each lane. Non-R., non-reduced condition, showing the dimerized bispecific antibody; Red., 2-mercaptoethanol reduced condition, showing the reduced monomer of the bispecific antibody.

Cell binding specificity of the bispecific antibody

Cell binding was checked on both DLL3-negative and DLL3-positive cancer cell lines, T lymphoma cell line Jurkat, and primary human T cells (PBMC; figure 2). Since DLL3 are generally expressed at a very low level on SCLC,10 as expected, the bispecific antibody marginally bound to SCLC cell line H446, H196, and H82 (figure 2A). To confirm the cell binding activity, we made an artificial A431 (DLL3) cell line by overexpressing DLL3 on A431 cells via lentiviral transduction and cell sorting. A little surprised, it was difficult to get DLL3 super high expressers (figure 2A, A431 (DLL3)), which probably explained why DLL3 is generally low expressing in SCLC cell lines and tissues. The binding of the bispecific antibody to T cells was apparent (figure 2B), as shown in both the Jurkat cell line and PBMC. To further confirm the DLL3 expression in the tested cell lines, we also ran western blot (figure 2C), which was consistent with the cell binding data.
Figure 2

Binding properties of the delta-like 3 (DLL3) bispecific antibody. (A) Flow cytometry analysis of the bispecific antibody binding to different cancer cell lines. Ten micrograms of the bispecific antibody were coincubated with one million of cells. Antibody binding was detected by phycoerythrin-conjugated goat antihuman IgG. Shaded area, secondary antibody staining; dashed lines, isotype control (pooled human IgG) staining; red solid line, bispecific antibody staining. (B) T cell binding analysis of the bispecific antibody. Same experimental settings were used as above mentioned, except that the T cell line Jurkat and peripheral blood mononuclear cells were tested. (C) Western blot analysis of the DLL3 expression in different cancer cell lines. Fifty micrograms of total protein from each cell lysate were run on reduced SDS-PAGE, followed by anti-DLL3 antibody staining. The β-actin was used loading control. A431 (DLL3) was an artificial cell line that was forcefully overexpressing DLL3. The band intensity from each lane was quantified by using ImageJ software, and presented as mean±SEM.

Binding properties of the delta-like 3 (DLL3) bispecific antibody. (A) Flow cytometry analysis of the bispecific antibody binding to different cancer cell lines. Ten micrograms of the bispecific antibody were coincubated with one million of cells. Antibody binding was detected by phycoerythrin-conjugated goat antihuman IgG. Shaded area, secondary antibody staining; dashed lines, isotype control (pooled human IgG) staining; red solid line, bispecific antibody staining. (B) T cell binding analysis of the bispecific antibody. Same experimental settings were used as above mentioned, except that the T cell line Jurkat and peripheral blood mononuclear cells were tested. (C) Western blot analysis of the DLL3 expression in different cancer cell lines. Fifty micrograms of total protein from each cell lysate were run on reduced SDS-PAGE, followed by anti-DLL3 antibody staining. The β-actin was used loading control. A431 (DLL3) was an artificial cell line that was forcefully overexpressing DLL3. The band intensity from each lane was quantified by using ImageJ software, and presented as mean±SEM.

Cytotoxicity of DLL3 bispecific antibody

Cytotoxicity of the DLL3 bispecific antibody was tested in DLL3-negative A431 cells and DLL3-positive SCLC cell lines. All the tested cell lines were stably transduced with a lentiviral vector to express the firefly luciferase gene that was utilized to measure the cytotoxicity of the bispecific antibody. As shown in figure 3, the bispecific antibody efficiently killed the DLL3-positive H446 and H196 cells in a dose-dependent manner in the presence of unstimulated PBMC, while had little influence on the A431 cells. The artificial A431 (DLL3) and H82 cells were relatively resistant to the bispecific antibody-mediated T cell killing.
Figure 3

In vitro cell killing assay of the delta-like 3 (DLL3) bispecific antibody. All the tested cell lines were stably transduced to constitutively express a fire fly luciferase reporter gene (ffLuc2). Ten thousand cancer cells were coincubated with two hundred thousand unstimulated peripheral blood mononuclear cells (PBMC) cells for 48 hours in the presence of variable concentrations of the bispecific antibody as indicated. The cell viability was quantified by measuring the intracellular luciferase activity. DLL3-negative A431 was served as a control of the non-specific killing by the bispecific antibody. Statistical comparisons between the A431 control and other cell lines at each bispecific antibody concentration was calculated and labeled on the top of the bar. Data represent mean±SEM.

In vitro cell killing assay of the delta-like 3 (DLL3) bispecific antibody. All the tested cell lines were stably transduced to constitutively express a fire fly luciferase reporter gene (ffLuc2). Ten thousand cancer cells were coincubated with two hundred thousand unstimulated peripheral blood mononuclear cells (PBMC) cells for 48 hours in the presence of variable concentrations of the bispecific antibody as indicated. The cell viability was quantified by measuring the intracellular luciferase activity. DLL3-negative A431 was served as a control of the non-specific killing by the bispecific antibody. Statistical comparisons between the A431 control and other cell lines at each bispecific antibody concentration was calculated and labeled on the top of the bar. Data represent mean±SEM.

Tumor-suppression activity of DLL3 bispecific antibody in xenograft mice

The efficient in vitro killing result of the bispecific antibody encouraged us to investigate its in vivo efficacy. Because the classical PD-L1/PD-1 immune checkpoint plays significant roles in limiting the efficacy of T cell immunotherapy in many cancer types, and SCLC cells have generally low-level expression of PD-L1,19 we decided to include PD-1 blockade as a combination therapy with the DLL3 bispecific antibody for the in vivo study. First, we confirmed the PD-L1 expression on H446 and A431 (DLL3) cells by flow cytometry (figure 4A), and the PD-1 expression on the DLL3 bispecific antibody activated PBMC (figure 4B). Then, NSG mice were subcutaneously inoculated with H446 and A431 (DLL3) cells. When the tumor reached the size of 100–200 mm3, treatment was started by intraperitoneal injection of 10 million PBMC and tail vein injection of 1.0 or 0.5 mg/kg bispecific antibody. As shown in figure 4, the bispecific antibody significantly suppressed tumor growth in both H446 and A431 (DLL3) cells (figure 4C), with better efficacy in A431 (DLL3) than H446, which was in contrast with the in vitro killing data that the bispecific antibody had better killing on H446 than A431 (DLL3). Addition of the PD-1 inhibitory antibody (in-house made as scFv-hFc format, using nivolumab VH and VL sequences) dramatically enhanced the antitumor activity of the bispecific antibody and prolonged the survival of both H446 and A431 (DLL3; figure 4E), indicating that combination therapy of DLL3 bispecific antibody with PD-1 inhibition may potentially maximize the benefit of immunotherapy in SCLC. The loss of the body weight in the treated mice was apparent and associated with the dosage of the bispecific antibody (figure 4G).
Figure 4

In vivo efficacy testing of the delta-like 3 (DLL3) bispecific antibody. (A) PD-L1 expression on H446 and A431 (DLL3) cells. One million of cells was stained with PD-L1 rabbit monoclonal antibody, followed by detection with APC-conjugated goat-anti-rabbit IgG. Shaded area, secondary antibody staining; blue curve, isotype control (pooled rabbit IgG) staining; red curve, PD-L1 antibody staining. (B) PD-1 expression on the DLL3 bispecific antibody-stimulated peripheral blood mononuclear cells (PBMC) cells. H446 (red curve) and A431(DLL3) cells (blue curve) were incubated with PBMC for 48 hours in the presence of 100 ng/mL DLL3 bispecific antibody, followed by flow cytometry to analyze PD-1 expression. Shaded area, unstimulated PBMC cell staining; green curve, isotype control (pooled human IgG) staining of H446-stimulated PBMC. (C) Tumor growth curve of native small cell lung cancer cell line NCI-H446. Five million cells were subcutaneously inoculated in each NSG mouse. After the tumor formed and reached a size of 100–200 mm3, treatment was started. Bispecific antibody alone (0.5 mg/kg or 1.0 mg/kg body weight), or in combination of anti-PD-1 antibody (in-house made scFv-hFc format, 5.0 mg/kg) were tested. Ten million unstimulated human PBMC were intraperitoneally given immediately before the first intravenous delivery of the antibody. Arrows indicated the injection time point of the bispecific antibody. The PD-1 antibody was intravenously given once every week since the start of the treatment. Both tumor volume and body weight were measured every two or 3 days. **p<0.01, calculated using a Student’s paired t-test (two-tailed), ***p<0.001. (D) Tumor growth curve of A431 (DLL3), an artificial A431 cell line that was forcefully overexpressing DLL3. ***p<0.001, calculated using a Student’s paired t-test (two tailed). (E) The survival curves of the H446 mouse model treated with the bispecific antibody. (F) The survival curves of the A431 (DLL3) mouse model. (G) Body weight of the H446 mouse model treated with the bispecific antibody. (H) Body weight of the A431 (DLL3) mouse model.

In vivo efficacy testing of the delta-like 3 (DLL3) bispecific antibody. (A) PD-L1 expression on H446 and A431 (DLL3) cells. One million of cells was stained with PD-L1 rabbit monoclonal antibody, followed by detection with APC-conjugated goat-anti-rabbit IgG. Shaded area, secondary antibody staining; blue curve, isotype control (pooled rabbit IgG) staining; red curve, PD-L1 antibody staining. (B) PD-1 expression on the DLL3 bispecific antibody-stimulated peripheral blood mononuclear cells (PBMC) cells. H446 (red curve) and A431(DLL3) cells (blue curve) were incubated with PBMC for 48 hours in the presence of 100 ng/mL DLL3 bispecific antibody, followed by flow cytometry to analyze PD-1 expression. Shaded area, unstimulated PBMC cell staining; green curve, isotype control (pooled human IgG) staining of H446-stimulated PBMC. (C) Tumor growth curve of native small cell lung cancer cell line NCI-H446. Five million cells were subcutaneously inoculated in each NSG mouse. After the tumor formed and reached a size of 100–200 mm3, treatment was started. Bispecific antibody alone (0.5 mg/kg or 1.0 mg/kg body weight), or in combination of anti-PD-1 antibody (in-house made scFv-hFc format, 5.0 mg/kg) were tested. Ten million unstimulated human PBMC were intraperitoneally given immediately before the first intravenous delivery of the antibody. Arrows indicated the injection time point of the bispecific antibody. The PD-1 antibody was intravenously given once every week since the start of the treatment. Both tumor volume and body weight were measured every two or 3 days. **p<0.01, calculated using a Student’s paired t-test (two-tailed), ***p<0.001. (D) Tumor growth curve of A431 (DLL3), an artificial A431 cell line that was forcefully overexpressing DLL3. ***p<0.001, calculated using a Student’s paired t-test (two tailed). (E) The survival curves of the H446 mouse model treated with the bispecific antibody. (F) The survival curves of the A431 (DLL3) mouse model. (G) Body weight of the H446 mouse model treated with the bispecific antibody. (H) Body weight of the A431 (DLL3) mouse model.

Cytotoxicity of DLL3-targeted CAR-T cells

As we have already seen the cytotoxicity and in vivo efficacy of the bispecific antibody, it would be interesting to see the potency of the DLL3-targeted CAR-T cells. As shown in figure 5, the CAR was constructed by de novo gene synthesis (figure 5A), packed into a lentiviral vector, and transduced into PBMC. The transduction efficiency was indicated by the parentage of the mScarlet-I positive population (figure 5B), which was about 50% in both DLL3 and HN3 control CAR-T group. HN3 was a VH-domain antibody that targets glypican-3, a cell surface biomarker that is mainly expressing on hepatocellular carcinoma.20 The in vitro killing of DLL3 CAR-T cells was apparent, especially on native SCLC cells H446 and H196 (figure 5C). The maximal killing was seen at 10:1 ratio (CAR-T: tumor cells) for A431 (DLL3) and H446, and 5:1 for H196. No maximal killing was achieved for H82 at up to 15:1 ratio.
Figure 5

In vitro cell killing assay of the delta-like 3 (DLL3)-targeted chimeric antigen receptor (CAR)-T. (A) Schematic diagram of the CAR structure. Anti-DLL3 scFv (SC16.15) or isotype control (HN3, a human antibody that targets glypican-3, sequence from patent US20140044714) was fused with the following domains, the CD8α hinge, CD8α transmembrane region, CD28 intracellular domain, 4-1BB intracellular domain, CD3ζ intracellular domain, internal ribosome entry site (IRES, from encephalomyocarditis virus), and a red fluorescent protein mScarlet-I. (B) Transduction efficiency analysis of the CAR-T cells, as indicated by the expression of mScarlet-I. Untransduced PBMC was used as negative control. (C) Cell killing measurement of the CAR-T cells. All the cancer cell lines were stably transduced to constitutively express a fire fly luciferase reporter gene (ffLuc2). Ten thousand cancer cells were coincubated with different amount of CAR-T cells for 48 hours. The cell viability was quantified by measuring the intracellular luciferase activity. HN3 was a negative control CAR that targets glypican-3. Data represent mean±SEM. Statistical comparisons between the DLL3 CAR-T (SC16.15) and the control (HN3) at each CAR-T: tumor cell ratio was calculated and labeled on the top of the bar. Comparisons between different DLL3 CAR-T ratios were also calculated. ns, not significant, *p<0.05, ** p<0.01, ***p<0.001.

In vitro cell killing assay of the delta-like 3 (DLL3)-targeted chimeric antigen receptor (CAR)-T. (A) Schematic diagram of the CAR structure. Anti-DLL3 scFv (SC16.15) or isotype control (HN3, a human antibody that targets glypican-3, sequence from patent US20140044714) was fused with the following domains, the CD8α hinge, CD8α transmembrane region, CD28 intracellular domain, 4-1BB intracellular domain, CD3ζ intracellular domain, internal ribosome entry site (IRES, from encephalomyocarditis virus), and a red fluorescent protein mScarlet-I. (B) Transduction efficiency analysis of the CAR-T cells, as indicated by the expression of mScarlet-I. Untransduced PBMC was used as negative control. (C) Cell killing measurement of the CAR-T cells. All the cancer cell lines were stably transduced to constitutively express a fire fly luciferase reporter gene (ffLuc2). Ten thousand cancer cells were coincubated with different amount of CAR-T cells for 48 hours. The cell viability was quantified by measuring the intracellular luciferase activity. HN3 was a negative control CAR that targets glypican-3. Data represent mean±SEM. Statistical comparisons between the DLL3 CAR-T (SC16.15) and the control (HN3) at each CAR-T: tumor cell ratio was calculated and labeled on the top of the bar. Comparisons between different DLL3 CAR-T ratios were also calculated. ns, not significant, *p<0.05, ** p<0.01, ***p<0.001.

In vivo efficacy of DLL3 CAR-T cells

The in vivo efficacy was tested on H446 model. Based on the same rationale as in the bispecific antibody combination treatment, we also included PD-1 blockade as a combination in the CAR-T treatment. As shown in figure 6A, both the DLL3 CAR-T and the HN3 control CAR-T cells expressed PD-1 as examined by flow cytometry. The in vivo study showed that the DLL3 CAR-T significantly slowed down the tumor growth, but surprisingly, addition of PD-1 inhibitory antibody did not enhance the tumor growth suppression (figure 6B) or prolong the survival of the mice (figure 6C), which was not the case for the bispecific antibody combination treatment (figure 4C). The loss of body weight in the CAR-T treatment group was also apparent (figure 6D). Taken together, these data suggested that combination of DLL3-targeted bispecific antibody and PD-1 blockade was superior to CAR-T combination.
Figure 6

In vivo efficacy testing of the delta-like 3 (DLL3)-targeted chimeric antigen receptor (CAR)-T cells. (A) PD-1 expression on CAR-T cells. DLL3 CAR-T cells (red curve) and HN3 control CAR-T cells (blue curve) were stained with the PD-1 inhibitory antibody (in-house made scFv-hFc format), followed by APC-conjugated goat-anti-human IgG. Shaded area, peripheral blood mononuclear cells cell staining; green curve, isotype control (pooled human IgG) staining of the DLL3 CAR-T cells. (B) Tumor growth curve of NCI-H446. Five million cells were subcutaneously inoculated in NSG mice. After the tumor formed and reached a size of 100–200 mm3, treatment was started by intraperitoneal delivery of five million CAR-T cells. Arrow indicated the time point of the CAR-T treatment. The anti-PD-1 antibody (in-house made scFv-hFc format, 5.0 mg/kg) was intravenously given once every week since the start of the treatment. Both tumor volume and body weight were measured every 2 or 3 days. **p<0.01, calculated by using a paired Student’s t-test. (C) The survival curves of the treated mice. (D) The body weight of the treated mice.

In vivo efficacy testing of the delta-like 3 (DLL3)-targeted chimeric antigen receptor (CAR)-T cells. (A) PD-1 expression on CAR-T cells. DLL3 CAR-T cells (red curve) and HN3 control CAR-T cells (blue curve) were stained with the PD-1 inhibitory antibody (in-house made scFv-hFc format), followed by APC-conjugated goat-anti-human IgG. Shaded area, peripheral blood mononuclear cells cell staining; green curve, isotype control (pooled human IgG) staining of the DLL3 CAR-T cells. (B) Tumor growth curve of NCI-H446. Five million cells were subcutaneously inoculated in NSG mice. After the tumor formed and reached a size of 100–200 mm3, treatment was started by intraperitoneal delivery of five million CAR-T cells. Arrow indicated the time point of the CAR-T treatment. The anti-PD-1 antibody (in-house made scFv-hFc format, 5.0 mg/kg) was intravenously given once every week since the start of the treatment. Both tumor volume and body weight were measured every 2 or 3 days. **p<0.01, calculated by using a paired Student’s t-test. (C) The survival curves of the treated mice. (D) The body weight of the treated mice.

Discussion

SCLC is a highly aggressive disease that novel curative therapies are imperative, given that the overall prognosis remains poor. Conventional chemotherapy plus radiotherapy are not very effective due to the rapid onset of relapse and drug resistance, and the survival rate of patient with SCLC has not been improved over the past three decades.2 21 In this disappointing scenario, there is a strong rationale to test immunotherapy that has changed the paradigm of treatment of some cancer types, especially circulating tumors. So far, ICI antibodies and DLL3-targeted ADC are the two front-running forms of SCLC immunotherapy.6 15 22 In the current study, we aimed to explore the therapeutic potential of the third form of immunotherapy, bispecific antibody and CAR-T, both of which are based on the mobilization/reactivation of T cells. We used the classical knob-into-hole structure to make the bispecific antibody in the heterodimerized scFv-hFc format. DLL3-specific and CD3-specific scFv was utilized as the targeting moieties. Cell binding and cytotoxicity assays showed that the bispecific antibody was able to kill DLL3-positive cancer cells efficiently in the working concentration of 1–1000 ng/mL (figure 3), even though the cell binding of the bispecific antibody was very weak (figure 2A). Previous studies demonstrated that DLL3 is remarkably low-abundance protein on the surface of tumor cells, in the order of only 10 000 molecules per cell, and H82 (the same cell line used in the current study) is representative of median DLL3 expression, with 14 000 molecules per cell.10 The low expression level of DLL3 explains the weak binding of the bispecific antibody in the current study. We would optimistically postulate that a bispecific antibody with higher affinity for DLL3 might compensate for the drawback of low-level expression of the target and achieve better efficacy. Another study demonstrated that DLL3-targeted ADC rovalpituzumab tesirine was potent in the SCLC and large cell neuroendocrine carcinoma PDX models, and durable regression of tumor growth was achieved.16 It would be interesting to compare the ADC and bispecific antibody under the same experimental settings, for example, the same tested cell lines and mouse models. CAR-T has a similar mode of action as bispecific antibody, both of which is able to activate T cells to kill cancer cells. However, the way of the T cell activation in CAR-T and bispecific antibody is different. The intracellular costimulation domains in the CAR can directly activate T cell without the need of tumor antigen association, while bispecific antibody stimulates T cells in a way more like how the T cells are naturally activated, for example, tumor antigen binding-triggered clustering of the CD3 complex in the T cells, which delivers the cross-membrane activation signals in T cells. In the current study, it was found that the potency of the DLL3-targeted CAR-T cells was similar as the bispecific antibody. However, the CAR-T cells could not be potentiated by the inclusion of PD-1 inhibition, which was in contrast with that of the bispecific antibody combination, suggesting that the fate of T cells activated by bispecific antibody differs substantially from that by CAR. A similar observation was also found that the GD2-targeted bispecific antibody had superior activity than CAR-T in a melanoma xenograft mouse model, because the bispecific antibody did not induce T-cell death mediated by CAR.23 In the same study, the authors found that majority of high CAR density T cells were depleted on exposure to target cells while the bispecific antibody redirected T cells survived, and blockade of PD-1 did not prevent CAR-T cell depletion. Another interesting study showed that long-lasting PD-1 blockade in CAR-T cells by shRNA actually impaired T cell antitumor function, mainly because long-lasting PD-1 blockade inhibited T cell proliferation and prevented effector T cells from differentiating into effect memory T cells.24 Clinical experience employing the combination of CAR-T and immune checkpoint blockade is in its early stages, and there are both encouraging preliminary results and some unsatisfactory outcomes.25 A small phase I clinical trial in a GD2-CAR for relapsed or refractory neuroblastoma did not find significant benefit of combining PD-1 blockade.26 It should be noted that the epitopes of the bispecific antibody may have pivotal impacts on the activity.18 27 Bispecific antibodies that target epitopes closer to the cell membrane are generally advantageous as this may facilitate to form a stronger immune synapse between T cells and cancer cells.27 It is unclear whether the epitope of SC16.15 is the best fit for DLL3-targeted bispecific antibody. Therefore, following-up studies are needed to test more bispecifics that target different epitopes of DLL3 to achieve the optimal therapeutic benefit of DLL3-targeted immunotherapy.

Conclusion

The current study demonstrated that both DLL3-targeted bispecific antibody and CAR-T cells were able to selectively kill DLL3-positive cancer cells in vitro and suppress tumor growth in vivo. Combination of PD-1 blockade was capable of enhancing the activity of bispecific antibody but not the CAR-T cells, suggesting its superiority over CAR-T in terms of efficacy. Further studies to optimize the DLL3 bispecifics are worthwhile to fully take the advantage of DLL3-targeted immunotherapy.
  27 in total

1.  A DLL3-targeted antibody-drug conjugate eradicates high-grade pulmonary neuroendocrine tumor-initiating cells in vivo.

Authors:  Laura R Saunders; Alexander J Bankovich; Wade C Anderson; Monette A Aujay; Sheila Bheddah; KristenAnn Black; Radhika Desai; Paul A Escarpe; Johannes Hampl; Amy Laysang; David Liu; Javier Lopez-Molina; Milly Milton; Albert Park; Marybeth A Pysz; Hui Shao; Brian Slingerland; Michael Torgov; Samuel A Williams; Orit Foord; Philip Howard; Jacek Jassem; Andrzej Badzio; Piotr Czapiewski; David H Harpole; Afshin Dowlati; Pierre P Massion; William D Travis; M Catherine Pietanza; J T Poirier; Charles M Rudin; Robert A Stull; Scott J Dylla
Journal:  Sci Transl Med       Date:  2015-08-26       Impact factor: 17.956

Review 2.  Current Diagnosis and Management of Small-Cell Lung Cancer.

Authors:  Shuhang Wang; Stefan Zimmermann; Kaushal Parikh; Aaron S Mansfield; Alex A Adjei
Journal:  Mayo Clin Proc       Date:  2019-08       Impact factor: 7.616

3.  Noninvasive Interrogation of DLL3 Expression in Metastatic Small Cell Lung Cancer.

Authors:  Sai Kiran Sharma; Jacob Pourat; Dalya Abdel-Atti; Sean D Carlin; Alessandra Piersigilli; Alexander J Bankovich; Eric E Gardner; Omar Hamdy; Kumiko Isse; Sheila Bheddah; Joseph Sandoval; Kristen M Cunanan; Eric B Johansen; Viola Allaj; Vikram Sisodiya; David Liu; Brian M Zeglis; Charles M Rudin; Scott J Dylla; John T Poirier; Jason S Lewis
Journal:  Cancer Res       Date:  2017-05-09       Impact factor: 12.701

4.  Identification of candidate responders for anti-PD-L1/PD-1 immunotherapy, Rova-T therapy, or EZH2 inhibitory therapy in small-cell lung cancer.

Authors:  Motonobu Saito; Katsuharu Saito; Kouya Shiraishi; Daichi Maeda; Hiroyuki Suzuki; Yoshihiro Minamiya; Koji Kono; Takashi Kohno; Akiteru Goto
Journal:  Mol Clin Oncol       Date:  2017-12-12

5.  Novel targeted strategies to overcome resistance in small-cell lung cancer: focus on PARP inhibitors and rovalpituzumab tesirine.

Authors:  Robin Van Den Borg; Alessandro Leonetti; Marcello Tiseo; Elisa Giovannetti; Godefridus J Peters
Journal:  Expert Rev Anticancer Ther       Date:  2019-05-31       Impact factor: 4.512

6.  Staging small cell lung cancer: Veterans Administration Lung Study Group versus International Association for the Study of Lung Cancer--what limits limited disease?

Authors:  Patrick Micke; Andreas Faldum; Tsegay Metz; Kai-Michael Beeh; Fernando Bittinger; Jan-Georg Hengstler; Roland Buhl
Journal:  Lung Cancer       Date:  2002-09       Impact factor: 5.705

7.  IL-27 mediates HLA class I up-regulation, which can be inhibited by the IL-6 pathway, in HLA-deficient Small Cell Lung Cancer cells.

Authors:  Grazia Carbotti; Amin Reza Nikpoor; Paola Vacca; Rosaria Gangemi; Chiara Giordano; Francesco Campelli; Silvano Ferrini; Marina Fabbi
Journal:  J Exp Clin Cancer Res       Date:  2017-10-11

Review 8.  Rovalpituzumab Tesirine: A Novel DLL3-Targeting Antibody-Drug Conjugate.

Authors:  Bilal H Lashari; Yazhini Vallatharasu; Lakshmi Kolandra; Mohsin Hamid; Dipesh Uprety
Journal:  Drugs R D       Date:  2018-12

9.  Immune checkpoint inhibitors for small cell lung cancer: opportunities and challenges.

Authors:  Orgilmaa Regzedmaa; Hongbing Zhang; Hongyu Liu; Jun Chen
Journal:  Onco Targets Ther       Date:  2019-06-13       Impact factor: 4.147

10.  Real-world effectiveness and tolerability of small-cell lung cancer (SCLC) treatments: A systematic literature review (SLR).

Authors:  Manca Povsic; Ashley Enstone; Robin Wyn; Klaudia Kornalska; John R Penrod; Yong Yuan
Journal:  PLoS One       Date:  2019-07-18       Impact factor: 3.240

View more
  12 in total

Review 1.  Infiltrating T lymphocytes in the tumor microenvironment of small cell lung cancer: a state of knowledge review.

Authors:  Yamei Chen; Ying Jin; Xiao Hu; Ming Chen
Journal:  J Cancer Res Clin Oncol       Date:  2022-01-08       Impact factor: 4.553

Review 2.  Expanding Therapeutic Opportunities for Extrapulmonary Neuroendocrine Carcinoma.

Authors:  Melissa Frizziero; Elaine Kilgour; Kathryn L Simpson; Dominic G Rothwell; David A Moore; Kristopher K Frese; Melanie Galvin; Angela Lamarca; Richard A Hubner; Juan W Valle; Mairéad G McNamara; Caroline Dive
Journal:  Clin Cancer Res       Date:  2022-05-13       Impact factor: 13.801

Review 3.  Drug Development in Neuroendocrine Tumors: What Is on the Horizon?

Authors:  Alejandro Garcia-Alvarez; Jorge Hernando Cubero; Jaume Capdevila
Journal:  Curr Treat Options Oncol       Date:  2021-03-30

Review 4.  CAR-T Cells for the Treatment of Lung Cancer.

Authors:  Luisa Chocarro; Hugo Arasanz; Leticia Fernández-Rubio; Ester Blanco; Miriam Echaide; Ana Bocanegra; Lucía Teijeira; Maider Garnica; Idoia Morilla; Maite Martínez-Aguillo; Sergio Piñeiro-Hermida; Pablo Ramos; Juan José Lasarte; Ruth Vera; Grazyna Kochan; David Escors
Journal:  Life (Basel)       Date:  2022-04-08

5.  Combination Therapy of Hepatocellular Carcinoma by GPC3-Targeted Bispecific Antibody and Irinotecan is Potent in Suppressing Tumor Growth in Mice.

Authors:  Xin Chen; Yanmin Chen; Rong Liang; Lanxin Xiang; Jingwen Li; Yuankui Zhu; Huixia He; Le Huang; Dianbao Zuo; Weihang Li; Xinjun Liang; Shuang Dong; Sheng Hu; Mitchell Ho; Mingqian Feng
Journal:  Mol Cancer Ther       Date:  2021-11-01       Impact factor: 6.009

Review 6.  CAR T cells in solid tumors: challenges and opportunities.

Authors:  Faroogh Marofi; Roza Motavalli; Vladimir A Safonov; Lakshmi Thangavelu; Alexei Valerievich Yumashev; Markov Alexander; Navid Shomali; Max Stanley Chartrand; Yashwant Pathak; Mostafa Jarahian; Sepideh Izadi; Ali Hassanzadeh; Naghmeh Shirafkan; Safa Tahmasebi; Farhad Motavalli Khiavi
Journal:  Stem Cell Res Ther       Date:  2021-01-25       Impact factor: 6.832

Review 7.  Potential of Stem Cells and CART as a Potential Polytherapy for Small Cell Lung Cancer.

Authors:  Evgenii Skurikhin; Olga Pershina; Mariia Zhukova; Darius Widera; Natalia Ermakova; Edgar Pan; Angelina Pakhomova; Sergey Morozov; Aslan Kubatiev; Alexander Dygai
Journal:  Front Cell Dev Biol       Date:  2021-12-03

8.  ASCL1 and DLL3 expressions and their clinicopathological implications in surgically resected pure small cell lung cancer: A study of 247 cases from the National Cancer Center of China.

Authors:  Chunfang Hu; Jiyan Dong; Li Liu; Jingbo Liu; Xujie Sun; Fei Teng; Xin Wang; Jianming Ying; Junling Li; Puyuan Xing; Lin Yang
Journal:  Thorac Cancer       Date:  2021-12-20       Impact factor: 3.500

Review 9.  Immunotherapy in Lung Cancer: Current Landscape and Future Directions.

Authors:  Hirva Mamdani; Sandro Matosevic; Ahmed Bilal Khalid; Gregory Durm; Shadia I Jalal
Journal:  Front Immunol       Date:  2022-02-09       Impact factor: 7.561

Review 10.  Advances in Treatment of Recurrent Small Cell Lung Cancer (SCLC): Insights for Optimizing Patient Outcomes from an Expert Roundtable Discussion.

Authors:  Millie Das; Sukhmani K Padda; Jared Weiss; Taofeek K Owonikoko
Journal:  Adv Ther       Date:  2021-09-26       Impact factor: 3.845

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.