Literature DB >> 32545167

Characterization of Synthetic Tf2 as a NaV1.3 Selective Pharmacological Probe.

Mathilde R Israel1, Thomas S Dash1, Stefanie N Bothe2,3, Samuel D Robinson1, Jennifer R Deuis1, David J Craik1, Angelika Lampert2,3,4, Irina Vetter1,5, Thomas Durek1.   

Abstract

NaV1.3 is a subtype of the voltage-gated sodium channel family. It has been implicated in the pathogenesis of neuropathic pain, although the contribution of this channel to neuronal excitability is not well understood. Tf2, a β-scorpion toxin previously identified from the venom of Tityus fasciolatus, has been reported to selectively activate NaV1.3. Here, we describe the activity of synthetic Tf2 and assess its suitability as a pharmacological probe for NaV1.3. As described for the native toxin, synthetic Tf2 (1 µM) caused early channel opening, decreased the peak current, and shifted the voltage dependence of NaV1.3 activation in the hyperpolarizing direction by -11.3 mV, with no activity at NaV1.1, NaV1.2, and NaV1.4-NaV1.8. Additional activity was found at NaV1.9, tested using the hNav1.9_C4 chimera, where Tf2 (1 µM) shifted the voltage dependence of activation by -6.3 mV. In an attempt to convert Tf2 into an NaV1.3 inhibitor, we synthetized the analogue Tf2[S14R], a mutation previously described to remove the excitatory activity of related β-scorpion toxins. Indeed, Tf2[S14R](10 µM) had reduced excitatory activity at NaV1.3, although it still caused a small -5.8 mV shift in the voltage dependence of activation. Intraplantar injection of Tf2 (1 µM) in mice caused spontaneous flinching and swelling, which was not reduced by the NaV1.1/1.3 inhibitor ICA-121431 nor in NaV1.9-/- mice, suggesting off-target activity. In addition, despite a loss of excitatory activity, intraplantar injection of Tf2[S14R](10 µM) still caused swelling, providing strong evidence that Tf2 has additional off-target activity at one or more non-neuronal targets. Therefore, due to activity at NaV1.9 and other yet to be identified target(s), the use of Tf2 as a selective pharmacological probe may be limited.

Entities:  

Keywords:  NaV1.3; NaV1.9; Tf2; scorpion; sodium channel; toxin

Year:  2020        PMID: 32545167      PMCID: PMC7345637          DOI: 10.3390/biomedicines8060155

Source DB:  PubMed          Journal:  Biomedicines        ISSN: 2227-9059


1. Introduction

Voltage-gated sodium channels (VGSCs) are large pore-forming transmembrane-spanning proteins with four homologous domains (I-IV) that regulate the influx of Na+ ions across neuronal membranes in response to local changes in voltage [1]. This Na+ influx is essential for action potential initiation and propagation in electrically excitable cells and crucial for the physiological function of neurons. In humans, nine different isoforms with relatively high sequence homology have been identified (NaV1.1NaV1.9), each with discrete expression profiles and distinctive biophysical properties [2]. While several VGSC isoforms expressed in peripheral sensory neurons, such as NaV1.7, NaV1.8, and NaV1.9, have a well-established role in somatosensation and nociception, the contribution of NaV1.3 to peripheral neuronal excitability is less well understood. NaV1.3 is a tetrodotoxin (TTX)-sensitive channel with fast-activating and fast-inactivating currents capable of rapid repriming and sustaining repetitive firing [3]. Interestingly, NaV1.3 is expressed at very low levels in adult rodent dorsal root ganglion (DRG) neurons but is upregulated in DRGs following nerve injury or streptozotocin-induced diabetes, suggesting the channel may contribute to the development and maintenance of neuropathic pain [4,5,6]. Indeed, shRNA-mediated knockdown of NaV1.3 in DRG neurons attenuates the development of mechanical allodynia in rodent models of spared nerve injury (SNI) and diabetic neuropathy [7,8], while global NaV1.3 knockout has confounding results, with minimal effect on the development of mechanical allodynia following chronic constriction injury (CCI), spinal nerve transection (SNT), and spinal nerve ligation (SNL) [9,10]. Therefore, selective pharmacological modulators of NaV1.3 are required to further elucidate the contribution of the channel to neuronal excitability in physiological and pathological pain states. Venoms from scorpions, spiders, and cone snails are a rich source of novel bioactive peptides with activity at ion channels. Many venom-derived peptides have high potency and selectivity for VGSCs and have provided us with unique insights into VGSC gating, structure, and function [11]. Scorpion peptides that act on VGSCs can be functionally distinguished as α- or β-scorpion toxins, depending on how they modulate channel opening or closing. α-Scorpion toxins cause a marked delay in fast inactivation, resulting in prolonged Na+ influx; whereas, β-scorpion toxins shift the voltage dependence of activation to more hyperpolarized potentials, resulting in toxin-bound channels that open closer to the resting membrane potential [12,13]. Tf2 is a β-scorpion toxin originally identified from the venom of Tityus fasciolatus that, at a concentration of 1 µM, selectively activates NaV1.3, with no effect at the other NaV subtypes (NaV1.1, NaV1.2, and NaV1.4NaV1.8 tested) expressed in Xenopus oocytes [14]. We therefore hypothesized that Tf2 could be used as a pharmacological tool to assess the contribution of NaV1.3 to the excitability of peripheral sensory neurons. The remaining sodium channel subtype Nav1.9 is historically hard to express, but recent progress showed that the chimera of the human Nav1.9 with the C-terminus of Nav1.4 (hNav1.9_C4) reveals reasonable currents in HEK293 cells [8]. As Tf2 is not thought to interact with the C-terminus, this chimera is a valuable tool for testing its influences on Nav1.9 gating. Here, we report the chemical synthesis of Tf2 and the mutant Tf2[S14R], along with previously undescribed β-scorpion activity of Tf2 at hNaV1.9_C4 in vitro. We show for the first time that Tf2 causes Ca2+ influx in small, medium, and large diameter mammalian sensory neurons and explore the activity of Tf2 on the peripheral somatosensory system in vivo.

2. Experimental Section

2.1. Peptide Synthesis

Tf2 was synthesized in two segments consisting of Tf2(1–26)-α-thioester and Tf2(27–62), which were linked by native chemical ligation. Tf2(1–26)-α-thioester was synthesized via Boc chemistry on trityl-associated mercaptopropionic acid lysine resin to yield the C-terminal α-thioester upon hydrogen fluoride (HF, BOC Australia, Sydney, NSW, Australia) cleavage. Tf2(27–62) was synthesized using Fmoc chemistry on Rink amide resin to yield the C-terminally amidated peptide segment after trifluoroacetic acid (TFA, Auspep, Melbourne, VIC, Australia) cleavage. The cleaved crude peptides were precipitated and washed twice with cold diethyl ether. The peptides were then dissolved in 50% acetonitrile, 0.1% TFA (v/v) in water and lyophilized. Peptides were purified by preparative reverse-phase (RP) HPLC on a Shimadzu Prominence system (Sydney, NSW, Australia). HPLC fractions containing the desired peptide (judged by HPLC/MS) of similar purity were pooled, lyophilized, and stored at −20 °C. Tf2(1–26)-α-thioester: KEGYAMDHEGCKFSCFIRPSGFCDGY-[COS-CH2-CH2-CO]-Lys, expected MW (assuming average isotope composition): 3164.5 Da, observed MW: 3164.4 ± 0.5 Da. Tf2(27–62): CKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2, expected MW (assuming average isotope composition): 4031.7 Da, observed MW: 4031.2 ± 0.5 Da. Native chemical ligation was done as previously described [11]. Briefly, 8.7 μmol (35.3 mg) of peptide Tf2(27–62) and 8.7 μmol (27.6 mg) of Tf2(1–26)-α-thioester were dissolved in 8.7 mL of ligation buffer consisting of 6 M guanidine hydrochloride, 0.2 M Na2HPO4, 40 mM Tris(2-carboxyethyl)phosphine hydrochloride (TCEP), and 50 mM 4-mercaptophenylacetic acid (MPAA), pH 7.25. The solution was stirred under nitrogen for 16 h and the reaction progress was monitored by HPLC-UV. The reduced full-length Tf2 (1–62) ligation product was isolated via RP-HPLC on an Agilent Zorbax 300SB, C3 column (9.4 × 250 mm, 5 μm Phenomenex Australia, Sydney, NSW, Australia). Yield: 42.5 mg; expected MW (assuming average isotope composition): 6963.0 Da, observed MW: 6962.8 ± 1.0 Da. For oxidative folding of Tf2, 1.7 μmol (15 mg) of reduced Tf2 were dissolved in 3.75 mL of 6 M guanidine hydrochloride. Folding was initiated by diluting the peptide solution with 150 mL of folding buffer (0.1 M Tris, 0.5 M arginine, 1 M urea, 10 mM reduced glutathione, 1 mM oxidized glutathione, pH 8.0) and stirring for 72 h at 4 °C. Oxidized Tf2 was then purified by RP-HPLC on a Agilent Zorbax 300SB, C3 column (9.4 × 250 mm, 5 μm, Phenomenex Australia, Sydney, NSW, Australia). Yield: 2.2 mg. Calculated MW (assuming most abundant isotope composition): 6949.03 Da, observed MW: 6949.12 ± 0.20 Da. All reagents were obtained from Sigma-Aldrich (St Louis, MI, USA) unless otherwise stated.

2.2. Cell Culture

Human embryonic kidney (HEK) 293 cells that constitutively express the human VGSC channel α subunits NaV1.1–1.7/β1 (SB Drug Discovery, Glasgow, UK) were maintained in minimum essential media (MEM) supplemented with 10% fetal bovine serum (FBS) and 2 mM l-glutamine, along with the selection antibiotics blasticidin, geneticin, and zeocin as recommended by the manufacturer. Chinese hamster ovary (CHO) cells expressing hNaV1.8/β3 via a tetracycline inducible system (ChanTest, Cleveland, OH, USA) were maintained in MEM, 10% FBS, and 2 mM l-glutamine. Tetracycline (1 µg mL−1) was added to culture media 48–72 h prior to assay to induce hNaV1.8 expression. Cells were passaged every 3–4 days after reaching 70–80% confluence with TrypLE Express (Thermo Fisher Scientific, Scoresby, VIC, Australia) and grown in an incubator at 37 °C with 5% CO2. ND7/23 cells (Sigma-Aldrich, St. Louis, MO, USA) were maintained in high glucose Dulbecco’s Modified Eagle Medium (DMEM; Gibco, Thermo Fisher Scientific, Waltham, MA, USA) with a glucose level of 4.5 g/L and supplemented with 10% FBS (Biochrom AG, Berlin, Germany). ND7/23 cells were transiently transfected with 2.75 µg hNaV1.9_C4 plasmid (chimera of human NaV1.9 and the C-terminus of rat NaV1.4; pCDNA3 vector [8]), 0.25 μg of green fluorescent protein (GFP) DNA (Lonza, Basel, Switzerland), and 6 μL of JetPEI reagent (Polyplus Transfection, Illkirch, France). GFP was co-transfected to detect transfected cells via green fluorescence. Then, 24 h after transfection, cells were split either onto glass coverslips coated with poly-D-lysine (PDL) hydrobromide (Sigma-Aldrich) for treatment with 1 µM Tf2, or split into plastic petri dishes for control conditions. After recovering for 2–3 h, the cells were recorded with whole-cell patch clamp. Cells were passaged every 3–4 days after reaching 70–80% confluence with TrypLE Express (Thermo Fisher Scientific, Scoresby, VIC, Australia) in the case of HEK and CHO cells, and with accutase (Sigma-Aldrich) in the case of the ND7/23 cells. All cells were grown in an incubator at 37 °C with 5% CO2.

2.3. Fluorescent Membrane Potential Assay

To rapidly assess the activity of Tf2 and Tf2[S14R] at hNaV1.1–1.7, we utilized the FLIPRTetra fluorescent imaging plate reader (Molecular Devices, Sunnyvale, CA, USA). Cells were plated in 384-well black-walled plates at a density of 10,000–15,000 per well in normal growth media 24–48 h before membrane potential experiments. Cells were loaded with red membrane potential dye (Molecular Devices) diluted in physiological salt solution (PSS; 140 mM NaCl, 11.5 mM glucose, 5.9 mM KCl, 1.4 mM MgCl2, 1.2 mM NaH2PO4, 5 mM NaHCO3, 1.8 mM CaCl2, 10 mM HEPES) and incubated for 30 min at 37 °C as per the manufacturer’s instructions. All synthetic toxins were diluted in PSS and 0.1% bovine serum albumin (BSA) to avoid adsorption to plastic surfaces. Changes in membrane potential (excitation/emission 510–545 nm/565–625 nm) were recorded each second for 5 min after the addition of toxin and the area under the curve (AUC) was computed using ScreenWorks (Molecular Devices, Version 3.2.0.14).

2.4. Whole Cell Patch-Clamp Electrophysiology

Whole cell patch-clamp experiments on hNaV1.3, hNaV1.7, and hNaV1.8 cell lines were performed using the QPatch-16 automated electrophysiology platform (Sophion, Ballerup, Denmark). This set-up utilizes 16-well planar chips plates (QPlates, Sophion) with a standard resistance of 2 ± 0.02 mΩ. Cells were expanded in T-175 flasks and maintained in 37 °C and 5% CO2 48–72 h prior to assay. On the day of experiment, cells were harvested with TrypLE Express and resuspended in DMEM with 25 mM HEPES, 100 U/mL penicillin-streptomycin, and 0.04 mg/mL trypsin inhibitor from Glycine max (soybean) and stirred for 30–60 min prior to use. The external solution (ECS) for all automated VGSC recordings contained (in mM): NaCl (140), KCl (4), CaCl2 (2), MgCl2 (1), HEPES (10), TEA-Cl (20), and glucose (10) containing 0.1% BSA. The pH was adjusted to 7.4 with NaOH and osmolarity adjusted to 305 mOsm with sucrose. The intracellular solution (ICS) consisted of (in mM): CsF (140), EGTA/CsOH (1/5), HEPES (10), and NaCl (10) adjusted to pH 7.4 with CsOH and 320 mOsm with sucrose. The cell positioning pressure was set to −60 mbar, minimum seal resistance 0.1 GΩ, holding pressure −20 mbar, and currents were filtered at 25 kHz (8th order Bessel, cut off 5 kHz). A standard P/4 leak subtraction protocol was included, and as such, leak subtracted and non-leak subtracted currents were acquired in parallel. After obtaining the stable whole-cell configuration, voltage clamp experiments proceeded as follows from a holding potential of −90 mV. All protocols included a brief (15 ms) pre-conditioning pulse to 0 mV followed by a 120 ms recovery to allow voltage-sensor trapping by β-scorpion toxins [15]. Current–voltage (IV) relationships were determined using a series of 500 ms pulses ranging from −90 to +55 mV (in 5 mV steps), followed by a 20 ms pulse to −20 mV for hNaV1.3 and hNaV1.7 or +10 mV for hNaV1.8 to assess the voltage dependence of fast inactivation. Peak current values were normalized to a buffer control. Toxins were diluted in ECS with 0.1% BSA and incubated for 5 min prior to recording. Whole-cell patch-clamp experiments on ND7/23 cells transfected with hNav1.9_C4 were performed at room temperature, using an EPC-10 USB amplifier and PatchMaster software (HEKA Elektronik, Lambrecht, Germany) and analysis was done using Igor Pro 6.3 (WaveMetrics, Lake Oswego, OR, USA). Glass pipettes were prepared with a DMZ puller (Zeitz Instruments, Martinsried, Germany) to a resistance of 0.9 to 2.5 MΩ and filled with ICS. The ICS for hNav1.9_C4 recordings consisted of (in mM): CsF (140), EGTA (1), HEPES (10) and NaCl (10), sucrose (18) adjusted to pH 7.33 with CsOH, and 310 mOsm with additional sucrose. The ECS for hNav1.9_C4 recordings contained (in mM): NaCl (140), KCl (3), CaCl2 (1), MgCl2 (1), HEPES (10), glucose (20), and 0.1 % BSA. The pH was adjusted to 7.4 with NaOH and osmolarity adjusted to 305 mOsm with glucose. TTX (500 nM) was added to the ECS to block endogenous Na+ currents in ND7/23 cells. Tf2 (1 µM) was diluted in ECS with 0.1% BSA and incubated for 5 min prior to recording. Capacitive transients were cancelled and series resistance (≤6 MΩ) was compensated by at least 70%. Leak current was subtracted online using a P/4 procedure following each test pulse. Signals were sampled with 100 kHz and filtered at 10 kHz for activation and fast inactivation protocols and at 30 kHz for the deactivation protocol. Recording protocols were started 5 min after establishing the whole-cell configuration to allow for current stabilization. The holding potential for all recordings was −120 mV. The voltage dependence of activation was measured using a series of 40 ms pulses ranging from −120 mV to 30 mV in 10 mV steps at an interval of 5 s. The voltage dependence of steady-state fast inactivation was measured using a series of 500 ms pre-pulses ranging from −160 to −20 mV, in steps of 10 mV, followed by a 40 ms depolarizing test pulse at −40 mV. The voltage dependence of deactivation was measured using a series of 1.5 ms depolarizing pre-pulses to −20 mV. This was followed by a repolarization test pulse ranging from −130 to −20 mV, in 10 mV steps, at an interval of 5 s.

2.5. Ca2+ Imaging of Isolated Dorsal Root Ganglion Neurons

Primary cultures of mouse DRG neurons were prepared as previously described [16,17]. Briefly, DRG ganglia, removed from all spinal levels of 4-week-old male C57BL/6 mice, were incubated in DMEM (Gibco, Waltham, MD, USA) with 1 mg mL−1 Collagenase IV (Gibco, Life Technologies, NY, USA) for 90 min at 37 °C, then triturated with fire-polished Pasteur pipettes and plated in 96-well plates coated with PDL (Corning, ME, USA). After 1 h, wells were flooded with DMEM supplemented with 10% FBS and pencillin/streptomycin (Gibco, Waltham, MD, USA) and maintained for 16–24 h before assay. Cells were loaded with Fluo-4 AM calcium indicator, according to the manufacturer’s instructions (ThermoFisher Scientific, MA, USA). After loading (1 h), the dye-containing solution was replaced with assay solution (1 x Hanks’ balanced salt solution, 20 mM HEPES). Fluorescence corresponding to [Ca2+] of 100–200 DRG cells per experiment was monitored in parallel using a Nikon Ti-E Deconvolution inverted microscope (Nikon, Tokyo, Japan), equipped with a Lumencor Spectra LED Lightsource (Lumencor, Beavertown, OR, USA). Images were acquired at 10x objective at 1 frame/s (excitation 485 nm, emission 521 nm). For each experiment, baseline fluorescence was monitored for 30 s. At 30 s, 60 s, and 180 s, assay solution was replaced with fresh assay solution (as a negative control), Tf2 (1 µM in assay solution), and KCl (30 mM in assay solution), respectively. Experiments with TTX and Tf2[S14R] were performed in the same way. Cells responding to KCl and/or Tf2 were considered neuronal and grouped according to size: Large (>600 µm2), medium (300–600 µm2), and small diameter (<300 µm2). Experiments involving the use of mouse tissue were approved by The University of Queensland Animal Ethics Committee. Data were derived from 2–3 independent experiments, and plotted using GraphPad Prism 8. Where differences were tested, unpaired t-tests were used.

2.6. Animals

For behavioral assessment, we used adult male wildtype or homozygous NaV1.9-deficient (NaV1.9-/-) mice aged 6–8 weeks (~25g) on a C57BL/6J background. Homozygous Nav1.9 knockout mice on a C57BL/6J background were generated using CRISPR/Cas9 technology by the Queensland Facility for Advanced Genome Editing (The University of Queensland, Australia). In brief, two sgRNAs were designed to target exon 2 of the Scn11a gene. The deletion of exon 2 generated a frame shift mutation resulting in the introduction of stop codons in exon 3. The guide sgRNAs were microinjected together with Cas9 mRNA into fertilized eggs collected from C57BL/6J mice and transferred into pseudopregnant surrogate CD1 female mice. Offspring born to the foster mothers were genotyped by PCR (see below) and DNA sequencing. One F0 male mouse was bred to C57BL/6J female mice to generate F1 heterozygous mice, and F1 heterozygous mice were inbred to obtain homozygous mice. Genomic DNA was extracted from ear clippings and mice were genotyped by PCR using the following primers (forward: 5′-GCTGCTCAGACACTCACAGT-3′) and (reverse: 5′ATTCTGCCACCAGAGACTGC-3′) by the AEGRC genotyping and sequencing facility (The University of Queensland). Animals were housed in groups of 3 or 4 per cage, under 12-h light-dark cycles, and had standard rodent chow and water ad libitum. Age-matched controls were used for studies involving knockout animals. All behavioral assessment was performed by a blinded observer unaware of the genotype and/or treatments received. Ethical approval for in vivo experiments was obtained from The University of Queensland Animal Ethics Committee prior to experimentation. All animals experiments were conducted in accordance with local and national regulations, including the International Association for the Study of Pain Guidelines for the Use of Animals in Research in agreement with the Animal Care and Protection Regulation Qld (2012), and the Australian Code of Practice for the Care and Use of Animals for Scientific Purposes, 8th edition (2013) (TRI/IMB/093/17, 31 March 2017; IMB/PACE/421/18, 18 October 2018).

2.7. Behavioral Assessment

First, Tf2 (1 µM), Tf2[S14R] (10 µM), or ICA-121431 (500 nM) were diluted in saline with 0.1% w/v BSA and administered either alone or in combination by intraplantar (i.pl) injection into the left hind paw in a volume of 40 µL under light isoflurane (3 %) anesthesia. Mice were then placed individually into polyvinyl boxes (10 × 10 × 10 cm) and recorded by video for 20 min post-injection. The number of spontaneous pain behaviors, including licks, shakes, and flinches, were counted later by a blinded observer. Once spontaneous pain behavior had ceased, mechanical thresholds were assessed using an electronic von Frey apparatus (MouseMet Electronic von Frey, TopCat Metrology, Ely, UK), heat thresholds were assessed using the thermal probe test (MouseMet Thermal), and weight bearing was assessed using the Catwalk XT (Noldus Information Technology, Wageningen, The Netherlands) as previously described [18,19]. To quantify weight bearing, the parameter ‘mean intensity of the 15 most intense pixels’ was used as a surrogate measure.

2.8. Paw Thickness

In a separate cohort of animals, paw thickness was measured along the distal–proximal axis at the metatarsal level using a digital vernier caliper (Kincrome, Vic, Australia) 10 min after i.pl. injection of Tf2 (1 µM) or Tf2[S14R] (10 µM).

2.9. Data Analysis

Data were plotted and analyzed by GraphPad Prism, versions 8.2.0 and 8.4.2. Statistical significance was defined as p < 0.05 and was determined by t-test or one-way ANOVA with Dunnett’s post-test, as indicated. In case of deactivation, multiple t-tests (one per row) were used without assuming equal standard deviation and with the Holm–Sidak method for correcting p-values for multiple comparisons. Concentration–response curves were fitted with a four-parameter Hill equation with a variable Hill coefficient. Conductance–voltage relationships for activation were calculated for each voltage step using where Vrev is the reversal potential. Resulting data were fitted using a Boltzmann equation: GNa =; GNa is the voltage-dependent sodium conductance, GNa,max is the maximal sodium conductance, Vm is the membrane potential, V1/2 is the membrane potential at half-maximal activation, and k is the slope factor. Current–voltage relationships for inactivation were fitted using a Boltzmann equation: INa = INa is the voltage-dependent sodium current, INa,max is the maximal sodium current, Vm is the membrane potential, V1/2 is the half-maximal inactivation, and k is the slope factor. The time course of current decay at deactivating voltages over 10 ms was fitted by the double-exponential equation,, where y0 is the current amplitude at steady state, amp1 and amp2 are the amplitude coefficient for the fast and slow time constants, and τ1 and τ2 are the fast and slow time constants. Data are expressed as the mean ± standard error of the mean (SEM).

3. Results

3.1. Chemical Synthesis of Tf2

We used chemical synthesis to prepare multi-milligram quantities of Tf2. This toxin is a relatively large (62 amino acid residues) and post-translationally modified protein, whose 3-D structure is stabilized by four disulfide crosslinks. The target polypeptide chain was split into two segments of manageable size (26 and 36 residues), which were assembled individually by solid-phase peptide synthesis and purified. The full-length polypeptide chain was obtained in good yield by native chemical ligation of the two segments. Folding of the 62 amino acid peptide chain and oxidation of the eight cysteines required extensive optimization and allowed the isolation of synthetic Tf2 in acceptable yields and excellent purity for further functional studies. Functional equivalence with venom-derived Tf2 was established through activity testing (see below) as well as partial assignment of NMR data, which are in agreement with the expected cysteine-stabilized αβ fold that is characteristic for this class of scorpion toxins (Figure S1).

3.2. Synthetic β-Scorpion Tf2 Causes Early Channel Opening at NaV1.3 and NaV1.9

To examine the potency and selectivity of synthetic Tf2, we used a high-throughput fluorescence-based assay to measure changes in the membrane potential at hNaV1.1–1.7 expressed heterologously in HEK293 cells. Synthetic Tf2 potently activated hNaV1.3, with an EC50 of 213 ± 57 nM (Figure 1A). Consistent with the activity previously reported for venom-derived Tf2 [14], synthetic Tf2 retained selectivity for hNaV1.3, with no effect on hNaV1.1, hNaV1.2, or hNaV1.4–1.7 up to 10 µM (Figure 1A), making it more than 50-fold selective over these isoforms. To assess the mechanism of action of synthetic Tf2, we used whole-cell patch-clamp electrophysiology in HEK293 cells expressing hNaV1.3. Consistent with the β-scorpion activity previously reported for the native toxin, synthetic Tf2 (hereafter Tf2) at 1 µM caused a decrease in the peak current and a hyperpolarizing shift (Δ −11.3 mV) in the voltage dependence of activation (V50 control: −29.5 ± 0.7 mV; V50 Tf2: −40.8 ± 1.3 mV; p < 0.05; Figure 1B,C). The slope factor of the conductance–voltage curve also significantly increased in the presence of Tf2 at 1 µM, indicating a higher conductance at more hyperpolarizing membrane potentials (control: 3.6 ± 0.6 mV; Tf2: 8.0 ± 1.1 mV; p < 0.05; Figure 1C).
Figure 1

Synthetic Tf2 shifts the voltage dependence of activation at hNaV1.3 and hNaV1.9_C4. (A) Synthetic Tf2 retains selectivity for hNaV1.3, with no effect on hNaV1.1, hNaV1.2, or hNaV1.4–1.7 up to 10 µM in the FLIPRTetra membrane potential assay (n = 4–6 wells) (B) hNaV1.3 current–voltage relationship before (white circles) and after the addition of 1 μM Tf2 (blue circles). Tf2 causes early channel opening and an overall decrease in the peak current (n = 5 cells). (C) hNaV1.3 conductance–voltage relationship before (white circles) and after the addition of 1 μM Tf2 (blue circles). Tf2 causes a significant (∆ −11.3 mV) hyperpolarizing shift in the voltage dependence of activation and increases the slope factor (n = 4 cells). (D) hNaV1.7 conductance–voltage relationship before (white circles) and after the addition of 1 μM Tf2 (blue circles) (n = 4 cells). (E) hNaV1.8 conductance–voltage relationship before (white circles) and after addition of 1 μM Tf2 (blue circles) (n = 12 cells). (F) hNav1.9_C4 conductance–voltage relationship incubated with vehicle (0.1% BSA, white circles) or with 1 μM Tf2 (blue circles). Tf2 causes a significant hyperpolarizing (∆ −6.3 mV) shift in the voltage dependence of activation and decreased the slope factor (∆ −1.3) (n = 11–14 cells). Data presented as mean ± SEM.

It has previously been shown that Tf2 does not alter the voltage dependence of activation of hNaV1.7 or hNaV1.8 expressed in Xenopus oocytes [14]. We thus sought to confirm this in mammalian cells and extend these studies to include the human NaV1.9 isoform. For this, we utilized the previously described hNav1.9_C4 construct in which the C-terminus from rNaV1.4 replaces the C-terminus of hNaV1.9, enabling trafficking of the channel to the cell surface [8,20]. Consistent with previous reports, 1 µM Tf2 does not shift the voltage dependence of activation at hNaV1.7 (V50 control: −23.1 ± 0.6 mV; V50 Tf2: −24.3 ± 0.7 mV; p > 0.05; Figure 1D) or hNaV1.8 (V50 control: −1.1 ± 0.3 mV; V50 Tf2: −1.2 ± 0.4 mV; p > 0.05; Figure 1E). Interestingly, 1 µM Tf2 was active at hNav1.9_C4, causing a hyperpolarizing shift (Δ −6.3 mV) in the voltage dependence of activation (V50 control: −55.1 ± 1.9 mV; V50 Tf2 −61.4 ± 1.2 mV; p < 0.05, Figure 1F) and a change (Δ −1.3) in the slope factor (control: 8.8 ± 0.4; Tf2: 7.6 ± 0.2; p < 0.05, Figure 1F). Given the novel activity at hNav1.9_C4, we also assessed whether Tf2 affects any other parameters of hNav1.9_C4 channel kinetics. Tf2 did not change the current density (control: 61.8 ± 12.6 pA/pF; Tf2: 68.1 ± 10.3 pA/pF; p > 0.05), or the voltage dependence of fast inactivation (V50 control: −98.16 ± 1.9 mV; V50 Tf2 −98.16 ± 1.5 mV; p > 0.05) or deactivation (see Figure S2A–C).

3.3. Tf2[S14R] has Reduced Excitatory Activity at NaV1.3

It has been demonstrated for several β-scorpion toxins that a single amino acid residue replacement of S14 (in Ts1) or E15 (in Cn2 and Css4) with an arginine can uncouple the ‘excitatory’ activity from the ‘inhibitory’ activity, producing β-scorpion toxin mutants that inhibit the peak current without causing early channel opening [11,20,21]. We therefore synthesized a Tf2[S14R] mutant and assessed activity at hNaV1.3. Unlike Tf2, the S14R mutant, at concentrations up to 10 µM, did not activate hNaV1.3 in a fluorescence-based membrane potential assay (Figure 2A). In patch-clamp electrophysiology, 10 µM Tf2[S14R] caused a reduction in peak current, although a small hyperpolarizing shift (Δ −5.8 mV) in the voltage dependence of activation remained (control: −24.3 ± 0.4 mV; Tf2[S14R]: −30.1 ± 0.7 mV; p < 0.05; Figure 2B,C). However, unlike wildtype Tf2, the slope factor of the conductance–voltage curve was not significantly different in the presence of Tf2[S14R] at 10 µM, indicating the S14R mutant had lost significant excitatory activity (control: 3.9 ± 0.4; Tf2[S14R]: 4.0 ± 0.6; p > 0.05; Figure 2C).
Figure 2

Tf2[S14R] loses excitatory activity at hNaV1.3. (A) Comparative activity of Tf2 and Tf2[S14R] on hNaV1.3 assessed using the FLIPRTetra membrane potential assay. Tf2 (blue circles) concentration-dependently increased the membrane potential (EC50 213 ± 57 nM) while Tf2[S14R] (pink circles) had no effect up to 10 µM (n = 3–4 wells). (B) hNaV1.3 current–voltage relationship before (white circles) and after the addition of 10 μM Tf2[S14R] (pink circles). Tf2[S14R] decreased the peak current with a smaller effect on early channel opening compared to Tf2 (n = 5 cells). (C) hNaV1.3 conductance–voltage relationship before (white circles) and after the addition of 10 μM Tf2[S14R] (pink circles). Tf2[S14R] causes a smaller but significant (∆ −5.8 mV) hyperpolarizing shift in the voltage dependence of activation without affecting the slope factor (n = 5 cells). Data presented as mean ± SEM.

3.4. Tf2 Induces Calcium Influx in DRG Neurons

It has been reported that NaV1.3 is expressed at low levels in the adult rodent peripheral nervous system [4]. Application of 1 µM Tf2 to isolated mouse DRG neurons caused an immediate, rapid, and sustained increase in the intracellular Ca2+ concentration ([Ca2+]) in a subset of neurons (Figure 3A,B). Small, medium, and large diameter neurons were activated (Figure 3C). Activation was completely blocked (p < 0.05) in the presence of 1 µM TTX (Figure 3D), indicating that the effects of Tf2 on Ca2+ influx in mouse DRG neurons is dependent on the expression of TTX-sensitive VGSCs. At the same concentration (1 µM), Tf2[S14R] was not significantly different to cells treated with the negative control (p = 0.71), indicating that this analogue lacks the capacity to activate DRG neurons, consistent with its reduced excitatory activity of NaV1.3.
Figure 3

Tf2 activates mouse dorsal root ganglion neurons. (A) DRG cells before (background) and after the addition of 1 µM Tf2 and 30 mM KCl. (B) Traces from all neurons (defined as cells responding to 30 mM KCl and/or 1 µM Tf2) of one representative experiment. (C) Percentage of large (>600 µm2), medium (300–600 µm2), and small diameter (<300 µm2) neurons activated in the presence of 1 µM Tf2. (D) Percentage of neurons (total) activated in the presence of 1 µM Tf2, 1 µM Tf2 + 1 µM TTX, 1 µM Tf2[S14R], or buffer (negative control). Data are presented as SEM with the total number of neurons from 2–3 independent experiments; l.d., large diameter, m.d., medium diameter; s.d., small diameter; K+, 30 mM KCl; *, p < 0.05 using unpaired t-test; n.s., not significant.

3.5. Tf2 Causes Spontaneous Pain and Swelling In Vivo

Intraplantar injection of 1 µM (40 µL) Tf2 in mice caused a rapid induction of spontaneous pain behaviors, including flinching, licking, and shaking of the injected hind paw, that slowly subsided over 20 min (Figure 4A,B). In contrast, 10 µM Tf2[S14R] caused no spontaneous pain behaviors, consistent with the loss of excitatory activity at NaV1.3 and in DRG neurons seen in vitro (flinches/10 min: control, 5 ± 3; Tf2, 102 ± 12; Tf2[S14R], 5 ± 1; p < 0.05, Figure 4B). To assess if 10 µM (40 µL) Tf2[S14R] could compete with wild-type toxin for NaV1.3 binding in vivo, we co-administered it with 1 µM (40 µL) Tf2; however, it had no effect on Tf2-induced spontaneous flinching (flinches/10 min: Tf2 + Tf2[S14R] 101 ± 11; Figure 4B). In addition, the NaV1.1/1.3 inhibitor ICA-121431 (500 nM) had no effect on Tf2-induced spontaneous flinching (flinches/10 min: Tf2 + ICA-121431 88 ± 6; p > 0.05; Figure 4B), suggesting the flinching is not mediated via NaV1.3. Spontaneous pain was accompanied by erythema (redness) and swelling (Figure 4C), which occurred immediately after injection of Tf2 and also unexpectedly after Tf2[S14R], suggesting that this inflammatory response is not mediated via activation of NaV1.3 but instead through an additional target (paw thickness: control, 2.5 ± 0.2 mm; Tf2, 3.2 ± 0.1 mm; Tf2[S14R], 3.5 ± 0.1 mm; p < 0.05; Figure 4D). As Tf2 also activated hNaV1.9_C4, we assessed whether activation of NaV1.9 contributed to Tf2-induced spontaneous pain and swelling in vivo using NaV1.9-/- mice. Compared to wildtype (WT) controls, NaV1.9-/- mice did not exhibit a significant reduction in spontaneous pain behaviors (flinches/10 min: WT, 197 ± 25; NaV1.9-/-, 218 ± 32; p > 0.05) or paw swelling (paw thickness: WT, 3.3 ± 0.1 mm; NaV1.9-/-, 3.3 ± 0.1 mm; p > 0.05) after injection of Tf2 (Figure 4E,F). Once spontaneous pain subsided (~40 min post injection), we also assessed the effect of intraplantar Tf2 on mechanical thresholds, thermal thresholds, and weight bearing behavior in WT mice. Tf2 had no significant effect on mechanical thresholds (paw withdrawal threshold (PWT): control, 2.7 ± 0.4 g; Tf2, 1.9 ± 0.4 g; p > 0.05; Figure 4G) or paw thermal thresholds (PWT: control, 49.0 ± 0.5 °C; Tf2, 48.2 ± 0.3 °C; p > 0.05; Figure 4H) but did cause a significant reduction in weight bearing (arbitrary fluorescent unit (AFU): control, 108.9 ± 1.7; Tf2, 97.5 ± 1.9; p < 0.05; Figure 4I).
Figure 4

Intraplantar injection of Tf2 causes spontaneous pain behaviors and local swelling in mice (A) Time course of spontaneous pain behaviors induced by Tf2 (1 µM i.pl.). (B) Intraplantar injection of Tf2 (1 µM) causes spontaneous pain behaviors while intraplantar injection of Tf2[S14R] (10 µM) does not. Co-injection of Tf2[S14R] (10 µM) with Tf2 (1 µM) or ICA-121431 (500 nM) causes no reduction in spontaneous pain behaviors. (C) Intraplantar injection of Tf2 (left hind paw) causes local erythema (redness) and swelling. (D) Intraplantar injection of both Tf2 (1 µM) and Tf2[S14R] (10 µM) causes a significant increase in paw swelling. (E) Tf2-induced spontaneous pain behaviors are not attenuated in NaV1.9-/- mice. (F) Tf2-induced swelling is not attenuated in NaV1.9-/- mice. (G) Intraplantar injection of Tf2 (1 µM) has no effect on mechanical thresholds. (H) Intraplantar injection of Tf2 (1 µM) has no effect on heat thresholds. (I) Intraplantar injection of Tf2 (1 µM) causes a reduction in weight bearing (as measured by arbitrary fluorescence units; AFU). Data are presented as mean ± SEM with individual values plotted (n = 3–7 mice). Statistical significance was determined using t-test or one-way ANOVA with Dunnett’s post-test as appropriate, * p < 0.05 compared to control or WT.

4. Discussion

Here, we describe for the first time the activity of synthetic β-scorpion toxin Tf2 on the full panel of human VGSCs (NaV1.1–1.9) constitutively expressed in mammalian cells, on the calcium influx in primary sensory DRG neurons, and on nociceptive behaviors in mice in vivo, with the overall aim to investigate its suitability as a selective NaV1.3 pharmacological probe. Modern chemical peptide synthesis strategies applied to α- and β-long chain scorpion toxins have allowed the production of these molecules on the multi-milligram scale and have allowed structural and functional studies that are difficult to perform with the small quantities usually isolated from scorpion venom [22,23,24,25]. Synthetic Tf2 faithfully reproduced the activity and mode-of-action of venom-derived Tf2 reported previously, strongly suggesting that both samples are also structurally identical. Whilst previously described as a selective NaV1.3 activator [14], we found that Tf2 had additional activity at hNaV1.9_C4, which is a TTX-resistant isoform preferentially expressed on small diameter DRG neurons that is associated with both ‘painless’ and ‘painful’ channelopathies [26,27]. The pharmacology of scorpion toxins at NaV1.9 remains largely unexplored, partly due to difficulties in the functional expression of NaV1.9 in heterologous systems. However, the β-scorpion toxin Ts1 (also known as TsVII), which has 73.4% sequence identity to Tf2, is also active on NaV1.9 [28]. This suggests that activity at NaV1.9 may be broadly conserved amongst other related β-scorpion toxins, but this remains to be assessed. Despite shifting the voltage dependence of activation at NaV1.9 (Δ −6.3 mV), Tf2-induced spontaneous pain and swelling developed normally in NaV1.9-/- mice, indicating that this isoform had a minimal contribution to in vivo activity. This result was somewhat surprising, given the mutation L1158P in human NaV1.9 causes a similar hyperpolarizing shift in activation (Δ −6.7 mV), and has been linked to increased excitability of DRG neurons and painful peripheral neuropathy [29]. However, this mutation also slows deactivation, which was a channel parameter unaffected by Tf2, suggesting that changes in NaV1.9 deactivation may be important for neuronal excitability. Selective VGSC modulators remain useful tool compounds for delineating the contribution of particular isoforms to the excitability of neurons in both physiological and pathological states [17,30]. Despite being implicated in neuropathic pain and epilepsy, there is a lack of highly potent and selective inhibitors of NaV1.3 available. The small molecule ICA-121431 is the most potent NaV1.3 inhibitor described to the date, but off-target activity at NaV1.1, which is also expressed on peripheral and central neurons, limits its use as a research tool in vivo [31]. In an attempt to rationally design a selective NaV1.3 inhibitor, we synthesized Tf2[S14R], where we mutated the serine at position 14 to a positively charged arginine. In the homologous β-scorpion toxin Ts1, mutation of S14 to an arginine resulted in a toxin that could still bind to NaV1.4 but no longer shifted the voltage dependence of activation [32]. In line with this observation, Tf2[S14R] inhibited the peak current of NaV1.3 without causing the same early channel opening as the native Tf2; however, it was unable to reverse Tf2-induced spontaneous pain behaviors in vivo. This is possibly due to the mutation causing a loss in potency, as the related toxin Cn2[E15R] required application at a concentration 200 times higher than the native to inhibit NaV1.6 in vivo [11]. Unfortunately, because the potency of Tf2 is already relatively weak, and Tf2[S14R] caused paw swelling at 10 µM, higher concentrations could not be assessed. Tf2 caused Ca2+ influx in both small and large mouse adult DRG neurons, which was surprising given NaV1.3 is only expressed at significant levels in embryonic sensory neurons or in adult neurons after axotomy [4]. Interestingly, colonic neurons isolated from mouse thoracolumbar (T10-L1) and lumbosacral (L5-S2) DRGs express NaV1.3 mRNA transcripts at similar levels to NaV1.1 and NaV1.2 [33]. As DRG neurons in this study were isolated from all spinal levels, we cannot rule out the presence of these NaV1.3-expressing neurons in culture. However, given the definitive lack of proteomic evidence for NaV1.3 expression in adult uninjured DRG neurons, and that Tf2 activated a large proportion of all DRG neurons, it is more likely that the observed effect on Ca2+ influx is due to activity at other neuronal targets. This is consistent with Tf2-induced spontaneous flinching not being reversed by the NaV1.1/1.3 inhibitor ICA-121431 in vivo. Indeed, it is not uncommon for scorpion toxins to have promiscuous activity on both VGSCs and voltage-gated potassium (KV) channels, and blockade of a KV channel could also result in Ca2+ influx [34,35]. Furthermore, there are scorpion toxins that modulate members of the family of voltage-gated calcium channels (CaV), such as kurtoxin from Parabuthus transvaalicus [36]; however, the activity of Tf2 at voltage-gated potassium and calcium channels in heterologous expression systems remains to be tested. Inhibition of Tf2-induced Ca2+ influx by TTX could also be explained by a global depression of neuronal excitability rather than direct opposition of Tf2-induced NaV1.3 activation. The observation that Tf2[S14R], which lost activity at NaV1.3, also lost excitatory activity in DRG neurons suggests that the pharmacophore of Tf2 at this other neuronal target(s) overlaps at least partially with that of NaV1.3. In addition, the observation that Tf2[S14R], which lost excitatory activity in DRG neurons, still caused swelling in vivo suggests that Tf2-induced inflammation is mediated by an additional non-neuronal target. Scorpion venom- or toxin-induced inflammatory responses have been described previously and have been linked to the activation of innate immune cells via interaction with pattern recognition receptors [37]. The use of global and sensory neuron-specific NaV1.3 knockout mice would be required to tease out what contribution, if any, NaV1.3 has to Tf2-induced pain and inflammation. In summary, Tf2 does not appear to be a suitable tool to study the effects of Nav1.3 channel activation in sensory neurons. This is due to additional activity at NaV1.9 and the probability of other neuronal and non-neuronal targets. Results from in vivo experiments that use Tf2 should be interpreted accordingly. There is, however, scope to use Tf2 in studying the activity of NaV1.9 in vitro, particularly in heterologous expression systems. Indeed, very few toxins to date are known to modulate the NaV1.9 isoform. Finally, the somewhat surprising finding that Tf2 and Tf2[S14R] cause inflammation in vivo could be explored further to understand how scorpion toxin envenomation affects inflammatory processes in humans.
  37 in total

1.  Structure of a eukaryotic voltage-gated sodium channel at near-atomic resolution.

Authors:  Huaizong Shen; Qiang Zhou; Xiaojing Pan; Zhangqiang Li; Jianping Wu; Nieng Yan
Journal:  Science       Date:  2017-02-09       Impact factor: 47.728

Review 2.  Toxins as tools: Fingerprinting neuronal pharmacology.

Authors:  Mathilde R Israel; Michael Morgan; Bryan Tay; Jennifer R Deuis
Journal:  Neurosci Lett       Date:  2018-02-06       Impact factor: 3.046

3.  Visceral and somatic pain modalities reveal NaV 1.7-independent visceral nociceptive pathways.

Authors:  James R F Hockley; Rafael González-Cano; Sheridan McMurray; Miguel A Tejada-Giraldez; Cian McGuire; Antonio Torres; Anna L Wilbrey; Vincent Cibert-Goton; Francisco R Nieto; Thomas Pitcher; Charles H Knowles; José Manuel Baeyens; John N Wood; Wendy J Winchester; David C Bulmer; Cruz Miguel Cendán; Gordon McMurray
Journal:  J Physiol       Date:  2017-03-01       Impact factor: 5.182

4.  Nav1.3 sodium channels: rapid repriming and slow closed-state inactivation display quantitative differences after expression in a mammalian cell line and in spinal sensory neurons.

Authors:  T R Cummins; F Aglieco; M Renganathan; R I Herzog; S D Dib-Hajj; S G Waxman
Journal:  J Neurosci       Date:  2001-08-15       Impact factor: 6.167

5.  Upregulation of a silent sodium channel after peripheral, but not central, nerve injury in DRG neurons.

Authors:  J A Black; T R Cummins; C Plumpton; Y H Chen; W Hormuzdiar; J J Clare; S G Waxman
Journal:  J Neurophysiol       Date:  1999-11       Impact factor: 2.714

6.  The E15R Point Mutation in Scorpion Toxin Cn2 Uncouples Its Depressant and Excitatory Activities on Human NaV1.6.

Authors:  Mathilde R Israel; Panumart Thongyoo; Jennifer R Deuis; David J Craik; Irina Vetter; Thomas Durek
Journal:  J Med Chem       Date:  2018-02-03       Impact factor: 7.446

7.  Virus-mediated shRNA knockdown of Na(v)1.3 in rat dorsal root ganglion attenuates nerve injury-induced neuropathic pain.

Authors:  Omar A Samad; Andrew M Tan; Xiaoyang Cheng; Edmund Foster; Sulayman D Dib-Hajj; Stephen G Waxman
Journal:  Mol Ther       Date:  2012-08-21       Impact factor: 11.454

8.  Nav channel binder containing a specific conjugation-site based on a low toxicity β-scorpion toxin.

Authors:  Tomoya Kubota; Bobo Dang; Joao L Carvalho-de-Souza; Ana M Correa; Francisco Bezanilla
Journal:  Sci Rep       Date:  2017-11-27       Impact factor: 4.379

9.  Pain without nociceptors? Nav1.7-independent pain mechanisms.

Authors:  Michael S Minett; Sarah Falk; Sonia Santana-Varela; Yury D Bogdanov; Mohammed A Nassar; Anne-Marie Heegaard; John N Wood
Journal:  Cell Rep       Date:  2014-01-16       Impact factor: 9.423

10.  Transcriptomic and behavioural characterisation of a mouse model of burn pain identify the cholecystokinin 2 receptor as an analgesic target.

Authors:  Kathleen Yin; Jennifer R Deuis; Richard J Lewis; Irina Vetter
Journal:  Mol Pain       Date:  2016-08-28       Impact factor: 3.395

View more
  3 in total

1.  Animal Venoms-Curse or Cure?

Authors:  Volker Herzig
Journal:  Biomedicines       Date:  2021-04-12

Review 2.  Pain-related toxins in scorpion and spider venoms: a face to face with ion channels.

Authors:  Sylvie Diochot
Journal:  J Venom Anim Toxins Incl Trop Dis       Date:  2021-12-06

3.  Pharmacological Dissection of the Crosstalk between NaV and CaV Channels in GH3b6 Cells.

Authors:  Léa Réthoré; Joohee Park; Jérôme Montnach; Sébastien Nicolas; Joseph Khoury; Elodie Le Seac'h; Kamel Mabrouk; Harold De Pomyers; Hélène Tricoire-Leignel; César Mattei; Daniel Henrion; Ziad Fajloun; Michel De Waard; Claire Legendre; Christian Legros
Journal:  Int J Mol Sci       Date:  2022-01-13       Impact factor: 5.923

  3 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.