Literature DB >> 32424289

Lymphocyte predominant cells detect Moraxella catarrhalis-derived antigens in nodular lymphocyte-predominant Hodgkin lymphoma.

Lorenz Thurner1, Sylvia Hartmann2, Natalie Fadle3, Evi Regitz3, Maria Kemele3, Yoo-Jin Kim4, Rainer Maria Bohle4, Anna Nimmesgern5, Lutz von Müller6, Volkhard A J Kempf7, Marc A Weniger8,9, Frank Neumann3, Nadine Schneider10, Martine Vornanen11, Christer Sundström12, Laurence de Leval13, Andreas Engert14,15, Dennis A Eichenauer14,15, Ralf Küppers8,9, Klaus-Dieter Preuss3, Martin-Leo Hansmann2,16, Michael Pfreundschuh3.   

Abstract

Nodular lymphocyte-predominant Hodgkin lymphoma (NLPHL) is a rare lymphoma of B-cell origin with frequent expression of functional B-cell receptors (BCRs). Here we report that expression cloning followed by antigen screening identifies DNA-directed RNA polymerase beta' (RpoC) from Moraxella catarrhalis as frequent antigen of BCRs of IgD+ LP cells. Patients show predominance of HLA-DRB1*04/07 and the IgVH genes encode extraordinarily long CDR3s. High-titer, light-chain-restricted anti-RpoC IgG1/κ-type serum-antibodies are additionally found in these patients. RpoC and MID/hag, a superantigen co-expressed by Moraxella catarrhalis that is known to activate IgD+ B cells by binding to the Fc domain of IgD, have additive activation effects on the BCR, the NF-κB pathway and the proliferation of IgD+ DEV cells expressing RpoC-specific BCRs. This suggests an additive antigenic and superantigenic stimulation of B cells with RpoC-specific IgD+ BCRs under conditions of a permissive MHC-II haplotype as a model of NLPHL lymphomagenesis, implying future treatment strategies.

Entities:  

Mesh:

Substances:

Year:  2020        PMID: 32424289      PMCID: PMC7235000          DOI: 10.1038/s41467-020-16375-6

Source DB:  PubMed          Journal:  Nat Commun        ISSN: 2041-1723            Impact factor:   14.919


Introduction

Nodular lymphocyte-predominant Hodgkin lymphoma (NLPHL) accounts for 5–16% of all Hodgkin lymphoma (HL) cases[1], and IgD+ NLPHL represents a distinct clinical subtype, with a strong (>20:1) male predominance[2]. The disease-defining lymphocyte predominant (LP) tumor cells represent only a small proportion of the total tumor infiltrate and are widely outnumbered by reactive cells. LP cells have a late germinal-center B-cell phenotype and are closely related to the tumor cells of T-cell/histiocyte-rich large B-cell lymphoma (THRLBCL)[3,4]. LP cells harbor recurrent mutations in SGK1, DUSP2, JUNB, and SOCS1, frequent translocations affecting the B-cell lymphoma 6 (BCL6) gene, usually have a preserved B-cell phenotype, and often express a functional B-cell receptor (BCR)[3,5-10]. Intraclonal immunoglobulin variable (IgV) region gene diversification[7], the strong expression of BCL6[11], and activation-induced cytidine deaminase (AID)[12,13], and a histological picture that resembles germinal centers indicate an ongoing immune response. Activation of the nuclear factor (NF)-κB pathway is observed in LP cells[3], but NF-κB activity in LP cells is neither caused by mutations in NFKBIA or TNFAIP3[14] nor by Epstein-Barr virus (EBV)[15] infection and, thus, could represent a consequence of chronic BCR stimulation. Because IgD+ NLPHL has a predilection for cervical lymph nodes, we addressed the question of whether bacteria in the upper respiratory tract play a role in the pathogenesis of this lymphoma. To identify the antigenic targets of BCRs expressed on LP cells, recombinant antigen-binding fragments (Fabs) were constructed and screened for their ability to bind with pathogens and auto-antigens. Here we report that IgD+ LP cell-derived Fabs bind the Moraxella catarrhalis antigen DNA-directed RNA polymerase beta’ (RpoC) and thus reveal together with a permissive HLA class II haplotype of the patients and presence of light-chain-restricted serum antibodies a bacterial infection as trigger for the lymphomagenesis of IgD+ NLPHL.

Results

Patients and Ig V gene characteristics

Functional Ig heavy and light chain genes were successfully amplified from microdissected LP cells from 12 of 22 NLPHL cases of a screening cohort from Germany and Finland, including two composite lymphomas consisting of an NLPHL part (case #7a and #8a) and a diffuse large B cell lymphoma (DLBCL) part (case #7b and #8b) in the same lymph node. In a validation cohort, composed of only IgD+ NLPHL cases from Switzerland and Sweden, the success rate was 3/5 (#13-#15). The median age of patients with successfully amplified IgV genes was 30 years. Eight patients had IgD+ LP cells (Supplementary Fig. 1), and five of these patients were adolescents (Table 1). Two IgD+ NLPHL samples were obtained from inguinal lymph nodes, but these were relapses. A male predominance was observed among the NLPHL cases (13 of 15). All cases had mutated IgV genes, with mutation frequencies for heavy and light chain IgV genes (VH and VL, respectively) ranging between 0% and 18.0% (average: 8.3% for VH and 4.8% for VL gene segments; Table 2). The complementarity determining region (CDR) 3 of VH region genes isolated from IgD+ LP cells were significantly longer (median: 30 amino acids; mean: 29.95 ± 1.048 [SEM] amino acids; n = 8), compared with the CDR3 of VH region genes isolated from IgD− LP cells (median: 17 amino acids; mean: 17.71 ± 1.017 amino acids; n = 7; p < 0.0001, unpaired two-tailed Student’s t-test). Seven of the eight IgD+ NLPHL cases expressed a member of the VH3 family, compared with one of the seven IgD− NLPHL cases. Furthermore, cases with extraordinarily long CDR3 had characteristic VDJ-recombinations (frequently D3-3*01-JH6 rearrangements, see Table 2).
Table 1

Characteristics of the NLPHL patients included in this study.

CaseGenderAge (year)Disease statusLocalizationLP cells IgD+Reactivity against M. cat. RpoCReactivity against M. osl. Succinate-CoA ligase sub αHLA-DRB1*04 or HLA-DRB1*07
1m52RelapseAxillaryNoNoNoNo
2m15RelapseSupraclavicularNoNoNoNo
3m142nd relapseCervicalYesyesNoYes
4m65First manifestationCervicalNoNoNoYes
5f37First manifestationRetroperitonealNoNoNoNo
6m15RelapseCervicalYesYesNoYes
7am512nd relapseAxillaryNoNoNoNo
7bm512nd relapseAxillaryNoNoNoNo
8am40Primary progressiveAbdominalNoNoNoNo
8bm40Primary progressiveAbdominalNoNoNoNo
9m42RelapseInguinalYesYesNoYes
10m122nd relapseInguinalYesYesNoYes
11m15First manifestationCervicalYesNoYesYes
12m31First manifestationCervicalNoNoNoYes
13m18First manifestationCervicalYesYesNoYes
14m30First manifestationParotidYesYesNoYes
15f16First manifestationAxillaryYesNoNoNo

Bold: IgD+ NLPHL; cases 7 and 8: (a) NLPHL, (b) histological transformation into DLBCL in the same lymph node.

Table 2

Ig variable region gene analysis of LP cells.

CaseLP cells IgD+VH/VL geneHomology (%)Somatic mutationJH/JL geneDH genelength CDR3 (AA)Junction
1NegVH1-3-0191.3YesJH4*02D3-10*0120CAREVRPPRIIMIWGVGLLDFW
1NegVK1-27*0197.5YesJK4*019CQKYNSAPLTF
2NegVH1-46*0187.5aYesJH2*01D3-16*0215YYCARDEGDIRRYFDLW
2NegVK3-15*0192.8YesJH5*01

D3-3*01

10CQQYNYWPPVTF
3PosVH3-11*0195.1YesJH6*03D3-3*0126CARVAGAAGRNYNYWSGYWEDYYFMDVW
3PosVK2D30*0199.3YesJH4*019CMQGTHWPR
4NegVH4-31*0199.2YesJH3*02D3-2219CARGPPPYDSSGYYSHGLDIW
4NegVK1-3799.3YesJK3*018GQRTYNAPRF
5NegVH4-39*01100NoJH6*04D6-19*0115CASMGAVAGMMFGMDVW
5NegVK1-5*0396YesJK1*018CQEYNSYWTF
6PosVH3-07*0195.5YesJH6*04D3-3*0126CAREVLRWGGSYDFWSNYYEDYFALDVW
6PosVK-1D43*0198.5YesJK3*0110CQQYYSTPPFTF
7aNegVH1-6986.4YesJH5*02D6-19*0117CARDYSRGVCGPRYGMDVW
7aNegVK3-11*0193.8YesJK4*019CQQRSNWPPAF
7bNegVH1-6984.7YesJH5*02D6-19*0117CAREYSRGVCGPRYGMDVW
7bNegVK3-11*0190.3YesJK4*019CQQRSNWPPAF
8aNegVH3-3089.9YesJH6*02D2-15*0122CARKGGDPVLALFVPNFAMDVW
8aNegVK1-33*0191.6YesJK4*019CQQYNSLPITF
8bNegVH3-3089.0YesJH6*02D2-15*0122CARKGGDPVLAVFVPNFALNVW
8bNegVK1-33*0191.1YesJK4*019CQQYNSLPITF
9PosVH3-48*0382.0YesJH6*02D3-3*0130CAKSVLTAKSGKSYKFWNNYHEDYHYYLMDVW
9PosVK1-27*0187.1YesJK3*0110CQNYNTVPLTF
10PosVH4-59*0186.4bYesJH6*03D3-3*0133CATVDPTVVEGRVKYYDFWSGYYGTDQRYYYMDVW
10PosVL3-21*0192.8YesJL2*01-11CQVWDSSSDHPVF
11PosVH3-11*0195.5YesJH6*02D3-3*0130CARLLTSEGSRKYYDFWSNYWEGYQYYTMDVW
11PosVK2-2899.2YesJK3*039CMQGLQTVFTF
12NegVH4-34100NoJH5*02D3-10*0116CARGPYLWFGERGWFDPW
12NegVK1-5*0194YesJK2*039CQQYNSYPYCF
13PosVH3-11*0183.0YesJH6*03D3-3*0126CARLCAAGGRSYDFWSGYYENYFYMEVW
13PosVK1-5*0186.7YesJK4*0110CQQYSGSSRVTF
14PosVH3-11*0187.6YesJH6*02D3-3*0130CARLIEAGGVGKHYDFWSGYYTVDYYYGMDVW
14PosVK1-43*0194.3YesJK4*0110CQQYYSTPPLTF
15PosVH3-30*0489.8YesJH6*02D3-3*0133CARTTWVGVVGRIKYYDFWSGYHGTGMEYYTMDVW
15PosVL9-49*0198.1YesJL3*0212CGADHGSGSNFWVF
15PosVK1-17*0194.33YesJK4*0110CLQHNSYPRLTF

Bold: IgD+ NLPHL; all cases had functional IgV genes. For case 15 two functional light chains were amplified. For somatic mutation a threshold of 0.5% was used.

a Insertion in FR3 (AGAAAT).

bWith deletion of 3 nt in CDR2.

Characteristics of the NLPHL patients included in this study. Bold: IgD+ NLPHL; cases 7 and 8: (a) NLPHL, (b) histological transformation into DLBCL in the same lymph node. Ig variable region gene analysis of LP cells. D3-3*01 Bold: IgD+ NLPHL; all cases had functional IgV genes. For case 15 two functional light chains were amplified. For somatic mutation a threshold of 0.5% was used. a Insertion in FR3 (AGAAAT). bWith deletion of 3 nt in CDR2.

BCRs derived from IgD+ LP cells react with Moraxella spp

Overall, 6/8 IgD+ NLPHL-derived BCRs (four [#3, #6, #9, and #10] from the screening cohort and two [#13 and #14] from the validation cohort) reacted against M. catarrhalis lysates (Fig. 1a) and the M. catarrhalis strain ATCC 43617 RO 108 (data not shown), whereas one IgD+ NLPHL (#11) reacted with a M. osloensis lysate (Fig. 1a, Supplementary Information and Supplementary Fig. 2). No BCRs derived from IgD− NLPHL cases reacted with either M. catarrhalis or M. osloensis. In Western blots of M. catarrhalis lysates, the BCRs derived from IgD+ NLPHL cases detected a target antigen of 150–160 kDa (Fig. 1b, Supplementary Figs. 3 and 4). M. catarrhalis outer membrane vesicles contain two potential candidate antigens that have molecular weights >150 kDa: Moraxella IgD-binding protein (MID/hag) and DNA-directed RNA polymerase subunit beta’ of M. catarrhalis (RpoC)[16]. The MID/hag monomer has a molecular weight of 200 kDa, whereas the multimer has a molecular weight of ~800 kDa under non-reducing conditions (Supplementary Fig. 3)[17,18]. In contrast, the Moraxella-reactive BCRs (#3, #6, #9, and #10) recognized a protein of 150–160 kDa (Supplementary Fig. 4), which excludes MID/hag as their target. Moreover, the Moraxella-reactive BCRs did not bind to recombinant fragments of MID/hag in Western blots (data not shown). The specific binding of the BCRs with recombinant RpoC was demonstrated, both by ELISA and Western blots (Fig. 1b, c), confirming that RpoC was the 150–160 kDa band detected in the M. catarrhalis lysate. The dominant epitope of RpoC-reactive BCRs was spanning from amino acid 600–1130 of RpoC, which could be further narrowed down to amino acids 851–865 (Fig. 1d and Supplementary Fig. 5).
Fig. 1

Reactivity of recombinant IgD+ LP cell-derived Fabs with bacterial lysates.

a Representative Immuno-dot blots of bacterial lysates. NLPHL-derived recombinant Fabs of six cases bound to lysates of M. catarrhalis, and of one case to lysate of M. osloensis. Eight cases showed no reactivity against bacterial lysates. All six M. catarrhalis-reactive recombinant Fabs (#3, #6, #9, #10, #13, and #14) and the one M. osloensis-reactive Fab (#11) were derived from IgD+ NLPHL cases. b Representative Western blot of recombinant C-terminally FLAG tagged M. catarrhalis RpoC expressed in HEK293 cells confirmed reactivity of lymphoma Fabs #3, #6, #9, #10, #13, and #14 with the recombinant bacterial antigen. A recombinant C-terminally FLAG-tagged SMCHD1 fragment was used as negative control. c ELISA with recombinant C-terminally FLAG-tagged M. catarrhalis RpoC as a coat demonstrated specific reactivity of Fabs derived from LP cells of six patients (#3, #6, #9, #10, #13, and #14) against recombinant RpoC. Values are mean ± SD. d Determination of the epitope of RpoC recognized by IgD+ NLPHL Fabs. Recombinant Fabs #3, #6, #9, and #10 bind AA 600–1130 of M. catarrhalis RpoC. Values are mean ± SEM. e Serum reactivity against RpoC in patients from whom recombinant NLPHL Fabs were derived. The two IgD+ NLPHL patients with RpoC-reactive recombinant lymphoma Fabs (#3 and #6) had higher anti-RpoC-antibody serum titers (1:1600) than a healthy control with anti-RpoC-antibodies (1:200). The IgD+ NLPHL patient with the M. osloensis-specific Fab (#11) had no serum anti-RpoC-antibodies. Values are mean ± SD. Experiments were independently repeated three times. f: Immunoglobulin classes and subclasses and light chains of serum RpoC antibodies from the two patients with RpoC-reactive BCR of the LP cells (#3 and #6) and a seropositive healthy control. Patients #3 and #6 both show a predominance of IgG1/κ. The healthy control had additionally anti-RpoC-antibodies of IgM class and in contrast to patients #3 and #6 no clear light chain restriction. Values are mean ± SD. g Representative Western blot of FLAG-tagged M. osloensis SUCLG1 expressed in HEK293 cells confirms reactivity of lymphoma Fab #11 with the recombinant bacterial antigen. h ELSIA with recombinant M. osloensis SUCLG1 as a coat demonstrated specific reactivity of Fabs derived from LP cells of patient #11 against recombinant SUCLG1. Values are mean ± SD. Data in a–c, e, and f are representative of three independent experiments each; data in d, g, and h are representative of two independent experiments.

Reactivity of recombinant IgD+ LP cell-derived Fabs with bacterial lysates.

a Representative Immuno-dot blots of bacterial lysates. NLPHL-derived recombinant Fabs of six cases bound to lysates of M. catarrhalis, and of one case to lysate of M. osloensis. Eight cases showed no reactivity against bacterial lysates. All six M. catarrhalis-reactive recombinant Fabs (#3, #6, #9, #10, #13, and #14) and the one M. osloensis-reactive Fab (#11) were derived from IgD+ NLPHL cases. b Representative Western blot of recombinant C-terminally FLAG tagged M. catarrhalis RpoC expressed in HEK293 cells confirmed reactivity of lymphoma Fabs #3, #6, #9, #10, #13, and #14 with the recombinant bacterial antigen. A recombinant C-terminally FLAG-tagged SMCHD1 fragment was used as negative control. c ELISA with recombinant C-terminally FLAG-tagged M. catarrhalis RpoC as a coat demonstrated specific reactivity of Fabs derived from LP cells of six patients (#3, #6, #9, #10, #13, and #14) against recombinant RpoC. Values are mean ± SD. d Determination of the epitope of RpoC recognized by IgD+ NLPHL Fabs. Recombinant Fabs #3, #6, #9, and #10 bind AA 600–1130 of M. catarrhalis RpoC. Values are mean ± SEM. e Serum reactivity against RpoC in patients from whom recombinant NLPHL Fabs were derived. The two IgD+ NLPHL patients with RpoC-reactive recombinant lymphoma Fabs (#3 and #6) had higher anti-RpoC-antibody serum titers (1:1600) than a healthy control with anti-RpoC-antibodies (1:200). The IgD+ NLPHL patient with the M. osloensis-specific Fab (#11) had no serum anti-RpoC-antibodies. Values are mean ± SD. Experiments were independently repeated three times. f: Immunoglobulin classes and subclasses and light chains of serum RpoC antibodies from the two patients with RpoC-reactive BCR of the LP cells (#3 and #6) and a seropositive healthy control. Patients #3 and #6 both show a predominance of IgG1/κ. The healthy control had additionally anti-RpoC-antibodies of IgM class and in contrast to patients #3 and #6 no clear light chain restriction. Values are mean ± SD. g Representative Western blot of FLAG-tagged M. osloensis SUCLG1 expressed in HEK293 cells confirms reactivity of lymphoma Fab #11 with the recombinant bacterial antigen. h ELSIA with recombinant M. osloensis SUCLG1 as a coat demonstrated specific reactivity of Fabs derived from LP cells of patient #11 against recombinant SUCLG1. Values are mean ± SD. Data in a–c, e, and f are representative of three independent experiments each; data in d, g, and h are representative of two independent experiments. IgD+ status of NLPHL was significantly associated with reactivity of recombinant Fabs against M. species (p = 0.007; Fisher’s exact test) and M. catarrhalis RpoC (p = 0.0014; Fisher’s exact test). In contrast to NLPHL, none of the recombinant BCRs derived from 12 DLBCL, 11 primary central nervous system lymphomas, 10 mantle cell lymphomas, and 12 chronic lymphocytic leukemia cases reacted with M. catarrhalis RpoC (Supplementary Fig. 6). Additionally, for IgD− NLPHL two autoantigens were identified as targets of BCRs of LP-cells (Supplementary Fig. 7). Several representative dot and western blots are shown in supplementary (Supplementary Figs. 16–22).

Restriction to certain MHC II classes in IgD+ NLPHL

Seven of the eight IgD+ NLPHL patients, including all six cases with an RpoC-specific BCR, had HLA-DRB1*04 or HLA-DRB1*07 haplotypes (Table 3). The presence of HLA-DRB1*04 or HLA-DRB1*07 was significantly associated with reactivity against Moraxella species (p = 0.0256; two-tailed Fisher’s exact test), and with reactivity against M. catarrhalis RpoC (p = 0.044; two-tailed Fisher’s exact test). For M. catarrhalis RpoC five T-cell epitopes, with high SYFPEITHI scores, were predicted for HLA-DRB1*04, and six epitopes were predicted for HLA-DRB1*07 (Supplementary Table 2), suggesting that these haplotypes can provide cognate follicular T-cell help for RpoC-specific B cells.
Table 3

MHC alleles of NLPHL.

CaseHLA-AHLA-BHLA-DRB1HLA-DQB1HLA-DQA1
1A*11/A*24B*44/B*51DRB1*01:01:01/DRB1*11:01:01DQB1*03:01:01/DQB1*05:01:01DQA1*01:05:01/DQA1*05:05:01
2A*01/A*02B*40/B*49DRB1*01:01:01/DRB1*11:02:01DQB1*03:19/DQB1*05:01:01DQA1*01:05:01/DQA1*05:05:01
3A*03/A*32B*44/B*51DRB1*04:01:01/DRB1*11:01:01DQB1*03:01:01/DQB1*03:02:01DQA1*03:01:01/DQA1*05:05:01
4A*02/A*31B*18/B*56DRB1*04:01:01/DRB1*15:01:01DQB1*06:02:01/DQB1*03:02:01DQA1*01:02:01/DQA1*03:01:01
5A*03/A*32B*15/B*47DRB1*11:01:01/DRB1*11:01:01DQB1*03:01:01/DQB1*03:02:01DQA1*03:01:01/DQA1*05:05:01
6A*30/A*32B*13/B*35DRB1*04:07:01/DRB1*07:01:01DQB1*02:02:01/DQB1*03:01:01DQA1*02:01/DQA1*03:03:01
7A*01/A*02B*08/B*08DRB1*11:01:01/DRB1*15:01:01DQB1*06:02:01/DQB1*03:01:01DQA1*01:02:01/DQA1*05:05:01
8A*02/A*33B*14/B*35DRB1*01:02:01/DRB1*12:01:01DQB1*03:01:01/DQB1*05:01:01DQA1*01:01:02/DQA1*05:05:01
9A*02/A*11B*35/B*44DRB1*04:01:01/DRB1*08:01:02DQB1*04:02:01/DQB1*03:01:01DQA1*03:01:01/DQA1*04:01:01
10A*02/A*25B*44/B*18DRB1*04:01:01/DRB1*14DQB1*03:01:01/DQB1*05DQA1*01:04:01/DQA1*03:03:01
11A*02/A*03B*07/B*50DRB1*07/DRB1*07DQB1*02/DQB1*02
12A*02/A*03B*35/B*58DRB1*01:01:01/DRB1*04:01:01DQB1*03:02:01/DQB1*05:01:01DQA1*01:05:01/DQA1*03:01:01
13A*01/A*02B*08/B*44DRB1*03:01:01/DRB1*07:01:01DQB1*02:01:01/DQB1*05:02:01DQA1*02:01:01/DQA1*05:01:01
14A*02/A*11B*07/B*35DRB1*07:01:01/DRB1*13:02:01DQB1*03:03:02/DQB1*06:04:01DQA1*01:02:01/DQA1*02:01:01
15A*02/A*31B*40/B*57DRB1*04:01:01/DRB1*07:01:01DQB1*03:01:01/DQB1*03:03:02DQA1*02:01:01/DQA1*03:01:01

Bold: IgD+ NLPHL.

MHC alleles of NLPHL. Bold: IgD+ NLPHL.

NLPHL patients show high-titer anti-RpoC-serum antibodies

Serum antibodies against M. catarrhalis RpoC were detected in 2/2 patients with IgD+ RpoC-specific BCRs within the screening cohort, at a titer of 1:3200, which belonged to the IgG1/κ subclass (Fig. 1e). High-titer, anti-M. catarrhalis-RpoC antibodies were found in 20/98 NLPHL patients enrolled in clinical trials conducted by the German Hodgkin Study Group (GHSG) (Fig. 2a), which is representative of the general population of NLPHL patients. All anti-M. catarrhalis-RpoC antibodies were of IgG class and predominantly of the IgG1 subclass (Fig. 2b), thus probably not related to the IgD+ LP cell clone. However, in each patient with serum antibodies against RpoC, these were light chain restricted (Fig. 2b), indicating a clonal origin and presumably a relation to the initiating event of NLPHL. The titers ranged from 1:800 to 1:3,200 (Fig. 2c). When applying a titer higher than 1:400 as cut off for positivity, no healthy control or patient with cHL or THRLBCL was positive. High titer (>1:400) serum antibodies against M. catarrhalis RpoC were associated with NLPHL (p < 0.0001; Fisher’s exact test). Low-titer RpoC-antibodies were detected in the serum of 9/188 healthy controls (Supplementary Fig. 8) and in 10/100 patients with classical HL (Fig. 2d), with maximum titers of 1:200 (Fig. 2e, Supplementary Figs. 9 and 10). RpoC-antibody-seropositive NLPHL patients (n = 20) did not differ in their clinical characteristics (age, gender, stage, site of manifestation, progression-free, and overall survival) from RpoC-antibody-seronegative NLPHL patients (Fig. 2f and data not shown). Unfortunately, the IgD-status was not available for this cohort. In the sera from 50 patients with THRLBCL, which represents a closely related entity to NLPHL, no RpoC-antibodies were found (Fig. 2g). Summarizing, anti-RpoC-antibodies were frequently found in NLPHL patients, but not in patients with related lymphomas or healthy controls (Fig. 2h).
Fig. 2

Serological responses against RpoC of M. catarrhalis in NLPHL, cHL, and THRBCL.

a Sera of patients with NLPHL (diluted 1:100) were tested for antibodies against RpoC of M. catarrhalis. b Analysis of Ig classes (left), IgG subclasses (middle), and light chains (right) of serum-antibodies against RpoC of M. catarrhalis in patients with NLPHL. The anti-RpoC antibodies were exclusively of the IgG class, mostly IgG1, and showed light chain restriction. c Titers of anti-RpoC antibodies in seropositive patients with NLPHL. The curves represent OD at 490 nm of different serum dilutions. Patients with NLPHL had titers between 1:800 and 1:3200. d Sera of patients with cHL (diluted 1:100) were tested for antibodies against RpoC of M. catarrhalis. e Seropositive patients with cHL had RpoC-antibody titers of up to 1:200. f PFS and OS of patients with NLPHL with and without RpoC-antibodies. No significant difference was observed for PFS (p = 0.13, Log-Rank-test) and OS (p = 0.26, Log-Rank-test). g Sera of patients with THRBCL (diluted 1:100) were tested for antibodies against RpoC, but all patients with THRBCL were seronegative for RpoC-antibodies. Serum of a seropositive NLPHL patient served as positive control. h Scatter blot for comparison of RpoC-antibodies in sera of patients with NLPHL, cHL, or THRBCL, and healthy controls. Data in a and d are representative of three independent experiments, data in b, c, e, g, and h are representative of two independent experiments.

Serological responses against RpoC of M. catarrhalis in NLPHL, cHL, and THRBCL.

a Sera of patients with NLPHL (diluted 1:100) were tested for antibodies against RpoC of M. catarrhalis. b Analysis of Ig classes (left), IgG subclasses (middle), and light chains (right) of serum-antibodies against RpoC of M. catarrhalis in patients with NLPHL. The anti-RpoC antibodies were exclusively of the IgG class, mostly IgG1, and showed light chain restriction. c Titers of anti-RpoC antibodies in seropositive patients with NLPHL. The curves represent OD at 490 nm of different serum dilutions. Patients with NLPHL had titers between 1:800 and 1:3200. d Sera of patients with cHL (diluted 1:100) were tested for antibodies against RpoC of M. catarrhalis. e Seropositive patients with cHL had RpoC-antibody titers of up to 1:200. f PFS and OS of patients with NLPHL with and without RpoC-antibodies. No significant difference was observed for PFS (p = 0.13, Log-Rank-test) and OS (p = 0.26, Log-Rank-test). g Sera of patients with THRBCL (diluted 1:100) were tested for antibodies against RpoC, but all patients with THRBCL were seronegative for RpoC-antibodies. Serum of a seropositive NLPHL patient served as positive control. h Scatter blot for comparison of RpoC-antibodies in sera of patients with NLPHL, cHL, or THRBCL, and healthy controls. Data in a and d are representative of three independent experiments, data in b, c, e, g, and h are representative of two independent experiments.

RpoC and MID/hag induce additive stimulation

Since we hypothesized that specific stimulation of the LP cell BCR by RpoC contributes to the lymphomagenesis of IgD+ NLPHL, patient-derived RpoC-specific BCRs were functionally investigated. At baseline, neither recombinant M. catarrhalis RpoC nor MID/hag resulted in increased proliferation of the IgD− DEV cell line, which is the only available NLPHL cell line (not shown). Similar results were observed for DEV cells stably expressing transfected BCRs without reactivity against RpoC. In contrast, RpoC stimulation resulted in the significantly increased proliferation of DEV cells that stably expressed RpoC-reactive IgD+-BCRs (Fig. 3a, b). Likewise, when MID/hag fragments 2/3 or 3 were applied by itself, already a significantly increased proliferation rate was observed (Supplementary Fig. 11). However, proliferation was further increased by the costimulation with RpoC and the MID/hag fragments 2 and 3, which contain the IgD-binding region (amino acids 920–1200) (Fig. 3a–c and Supplementary Fig. 11). This additive effect of MID/hag stimulation was not observed when DEV cells were transfected with an RpoC-reactive BCR of the IgG or IgM subtype (Fig. 3a, b). Accordingly, RpoC and MID/hag stimulation resulted in the strong activation of the BCR-signaling pathway, as determined by phosphorylation of key BCR-signaling factors (pTyr525/526 spleen tyrosine kinase [SYK], pTyr96 B-cell linker [BLNK], pTyr759 phosphoinositide-specific phospholipase C [PLC]γ2, and pTyr223 Bruton’s tyrosine kinase [BTK]) in DEV cells that stably expressed RpoC-reactive IgD+ BCRs (Fig. 3c). The activation of the BCR pathway was associated with a significant increase in MYC expression (Fig. 3c). Additionally, the NF-κB pathway was activated after stimulation with RpoC and MID/hag (Supplementary Fig. 12). Activation was also shown by flow cytometric analysis of cytoplasmic calcium levels in DEV cells that stably expressed RpoC-reactive IgD+ BCRs by an increase in the intracellular calcium levels after incubation with M. catarrhalis RpoC, which could be further increased by coincubation with RpoC and MID/hag, but was not induced by a control antigen (MAZ, Supplementary Fig. 13).
Fig. 3

Costimulation of different types of LP cells by RpoC and MID/hag.

a Tetrazolium proliferation assay with the transfected DEV cells expressing recombinant BCRs with different RpoC-reactive Fab fragments and Fc fragments of either IgD or IgG class. Stimulation with RpoC resulted in significant proliferation, and costimulation with MID/hag fragments 2 and 3 resulted in strong further increase of proliferation in cell lines expressing BCR of IgD class, e.g. transfected DEV expressing IgD+ BCR #3 stimulated by rec. human SLP2 vs. rec. M. catarrhalis RpoC: p < 0.00001 (DF = 32, q = 17.99); DEV expressing IgD+ BCR #3 stimulated by rec. human SLP2 vs. rec. M. catarrhalis RpoC and MID/hag 2&3: p < 0.00001 (DF = 32, q = 46.22). b In a Tetrazolium assay stimulation with RpoC resulted in increase of proliferation in DEV cells expressing RpoC-reactive BCRs, but not in DEV cells expressing non-RpoC-reactive BCRs. In IgD+ DEV cells with RpoC-reactive BCR incubation with MID/hag 2 and 3 resulted in a significant increase of proliferation, whereas costimulation with MID/Hag fragments 2 and 3 and the control antigen SLP2 had no additive effect. DEV expressing IgD+ BCR #6 stimulated by rec. human SLP2 vs. rec. M. catarrhalis RpoC: adjusted p < 0.0001 (DF = 56, q = 7.321) and DEV expressing IgD+ BCR #6 stimulated by rec. M. catarrhalis RpoC and MID/hag 2&3 vs. DEV expressing IgM+ BCR #6: p < 0.00001 (DF = 56, q = 29.44). Values in a and b are mean ± SEM. Two-way ANOVA with Tukey’s multiple comparisons were performed, **p ≤ 0.01, ***p ≤ 0.001, ****p ≤ 0.0001. Experiments were independently repeated three times. c Activation of the BCR-signaling pathway. Representative Western blot analysis of the BCR signaling pathway shows a strong activation by RpoC and even stronger by coincubation with RpoC and MID/hag in DEV cells transfected to express an RpoC-reactive IgD+ BCR. The incubation with RpoC, RpoC&Mid/Hag, or anti-IgM/IgD antibody results in the upregulation of the activated isoforms pTyr525/526 SYK, pTyr96 BLNK, pTyr759 PLCγ2, and pTyr223 BTK and induced overexpression of MYC. d Binding and internalization of RpoC/FITC into LP cells. RpoC/FITC bound to DEV cells transfected to express recombinant BCR of case #6 with RpoC-reactivity, but not to DEV cells transfected to express recombinant BCR of case #5. After 60 min internalization of RpoC/FITC into DEV cells with the RpoC-specific BCR #6 was observed. Control CD30/FITC neither bound to DEV cells nor was internalized. e Dose-dependant cytotoxic effects by ETA’ toxin-conjugated RpoC dependent on expression of RpoC-reactive BCRs on LP cells. Specific cytotoxicity evoked by RpoC/ETA’ was observed in the DEV cell line expressing the RpoC-reactive BCR of patient #3 (left), but not in the one expressing the autoreactive BCR of patient #5 (right). f Apoptosis induced by ETA’ toxin-conjugated RpoC dependent on expression of RpoC-reactive BCRs on LP cells. Characterization of DEV cells stably transfected to express IgD+ recombinant BCRs with (above, from case #3) or without (below, from case #8a) reactivity to M. catarrhalis RpoC by Annexin-V/FITC and propidium iodide staining after 24 h cultivation in the presence of RpoC/ETA, MAZ/ETA, or RpoC/ETA together with MID/hag. RpoC/ETA induced specifically apoptosis in the DEV cell line with RpoC-reactive BCR. Data in a–c and f are representative of three independent experiments, data of d and e are representative of two independent experiments.

Costimulation of different types of LP cells by RpoC and MID/hag.

a Tetrazolium proliferation assay with the transfected DEV cells expressing recombinant BCRs with different RpoC-reactive Fab fragments and Fc fragments of either IgD or IgG class. Stimulation with RpoC resulted in significant proliferation, and costimulation with MID/hag fragments 2 and 3 resulted in strong further increase of proliferation in cell lines expressing BCR of IgD class, e.g. transfected DEV expressing IgD+ BCR #3 stimulated by rec. human SLP2 vs. rec. M. catarrhalis RpoC: p < 0.00001 (DF = 32, q = 17.99); DEV expressing IgD+ BCR #3 stimulated by rec. human SLP2 vs. rec. M. catarrhalis RpoC and MID/hag 2&3: p < 0.00001 (DF = 32, q = 46.22). b In a Tetrazolium assay stimulation with RpoC resulted in increase of proliferation in DEV cells expressing RpoC-reactive BCRs, but not in DEV cells expressing non-RpoC-reactive BCRs. In IgD+ DEV cells with RpoC-reactive BCR incubation with MID/hag 2 and 3 resulted in a significant increase of proliferation, whereas costimulation with MID/Hag fragments 2 and 3 and the control antigen SLP2 had no additive effect. DEV expressing IgD+ BCR #6 stimulated by rec. human SLP2 vs. rec. M. catarrhalis RpoC: adjusted p < 0.0001 (DF = 56, q = 7.321) and DEV expressing IgD+ BCR #6 stimulated by rec. M. catarrhalis RpoC and MID/hag 2&3 vs. DEV expressing IgM+ BCR #6: p < 0.00001 (DF = 56, q = 29.44). Values in a and b are mean ± SEM. Two-way ANOVA with Tukey’s multiple comparisons were performed, **p ≤ 0.01, ***p ≤ 0.001, ****p ≤ 0.0001. Experiments were independently repeated three times. c Activation of the BCR-signaling pathway. Representative Western blot analysis of the BCR signaling pathway shows a strong activation by RpoC and even stronger by coincubation with RpoC and MID/hag in DEV cells transfected to express an RpoC-reactive IgD+ BCR. The incubation with RpoC, RpoC&Mid/Hag, or anti-IgM/IgD antibody results in the upregulation of the activated isoforms pTyr525/526 SYK, pTyr96 BLNK, pTyr759 PLCγ2, and pTyr223 BTK and induced overexpression of MYC. d Binding and internalization of RpoC/FITC into LP cells. RpoC/FITC bound to DEV cells transfected to express recombinant BCR of case #6 with RpoC-reactivity, but not to DEV cells transfected to express recombinant BCR of case #5. After 60 min internalization of RpoC/FITC into DEV cells with the RpoC-specific BCR #6 was observed. Control CD30/FITC neither bound to DEV cells nor was internalized. e Dose-dependant cytotoxic effects by ETA’ toxin-conjugated RpoC dependent on expression of RpoC-reactive BCRs on LP cells. Specific cytotoxicity evoked by RpoC/ETA’ was observed in the DEV cell line expressing the RpoC-reactive BCR of patient #3 (left), but not in the one expressing the autoreactive BCR of patient #5 (right). f Apoptosis induced by ETA’ toxin-conjugated RpoC dependent on expression of RpoC-reactive BCRs on LP cells. Characterization of DEV cells stably transfected to express IgD+ recombinant BCRs with (above, from case #3) or without (below, from case #8a) reactivity to M. catarrhalis RpoC by Annexin-V/FITC and propidium iodide staining after 24 h cultivation in the presence of RpoC/ETA, MAZ/ETA, or RpoC/ETA together with MID/hag. RpoC/ETA induced specifically apoptosis in the DEV cell line with RpoC-reactive BCR. Data in a–c and f are representative of three independent experiments, data of d and e are representative of two independent experiments.

Antigen/drug conjugates target RpoC-reactive LP cells

By using a synthetic FITC-conjugated RpoC peptide, which contained the binding epitope, the binding and internalization of RpoC into DEV cells that stably expressed RpoC-reactive BCRs could be measured using flow cytometry (Fig. 3d). In a LDH release assay, RpoC conjugated to a truncated form of Pseudomonas aeruginosa exotoxin A (RpoC/ETA’), was found to be cytotoxic against the DEV cell line that stably expressed RpoC-specific BCRs but had no effects on non-transfected DEV cells or on DEV cells that expressed BCRs specific for antigens other than RpoC (Fig. 3e). As shown by a trypan blue exclusion assay, 50% of the NLPHL cells expressing an RpoC-specific BCR died within 48 h after incubation with RpoC/ETA’ (Supplementary Fig. 14). In support of these results, an increase in the number of apoptotic cells was detected by an AnnexinV/propidium iodide assay (Fig. 3f).

Autoantigenic targets of BCRs derived from IgD− LP cells

Two autoantigens, human ribosomal protein S27a (RPS27a, for NLPHL #1, AA1-AA95) and human pyruvate carboxylase (for NLPHL #5, AA1030-AA1178), were identified as antigenic targets of the BCRs of two individual IgD− NLPHL cases. Reactivity of the respective Fabs was confirmed by ELISA using recombinantly expressed RPS27 and pyruvate carboxylase with C-terminal FLAG-tag expressed in HEK293 cells (Supplementary Fig. 7A, B). ELISAs with different fragments of pyruvate carboxylase revealed AA1111–AA1177 as the binding region of the recombinant Fab of patient #5 (Supplementary Fig. 7C). When comparing the identified antigens from the patients with autoreactive NLPHL-BCRs with those of healthy controls by Western-blot no obvious difference was detectable (Supplementary Fig. 7D). However, when comparing them by isoelectric focusing (IEF) a different electric charge of pyruvate carboxylase exclusively in patient #5 was observed (Supplementary Fig. 7E). This different electric charge was not altered after treatment with alkaline phosphatase (Supplementary Fig. 7F), but recombinant biotinidase pretreatment ahead of IEF resulted in the disappearance of the different electric charge, confirming a differential biotinylation of pyruvate carboxylase of patient #5 (Supplementary Fig. 7G). The hypobiotinylated pyruvate carboxylase might contribute to its immunogenicity in patient #5. Autoreactive BCRs contributing to lymphomagenesis by chronic stimulation due to alternative secondary modifications have previously been described in MGUS, Waldenström macroglobulinemia, multiple myeloma, and primary central nervous system lymphoma[19-22]. Pyruvate carboxylase is a highly conserved gene, and has been identified as an antigen recognized by BCRs of CLL[23].

Discussion

Here, we describe a distinct subtype of NLPHL, with IgD+ LP cells, characteristically long IgVH CDR3s (median 30 amino acids), a high frequency of IgV gene mutations, and characteristic VDJ-recombination. IgD+ NLPHL previously defined a unique clinical NLPHL subset, which primarily affected the cervical lymph nodes of male adolescents[2,24]. Our results provide evidence that chronic antigenic simulation by a common bacterium contributes to lymphomagenesis in NLPHL[25]. Antigens produced by M. catarrhalis or M. osloensis were specifically recognized by recombinant BCRs derived from 7/8 NLPHL cases with IgD+ LP cells. Further analysis identified M. catarrhalis RpoC as the specific antigen for six M. catarrhalis-reactive BCRs and SUCLG1 as specific antigen for the single M. osloensis-reactive BCR. M. catarrhalis-derived RpoC bound specifically to the antigen-binding sites of IgD+ NLPHL-derived BCRs, which were specific for Moraxella, with no cross-reactivity against >200 pathogens, including various bacterial, fungal, parasitic, and viral pathogens. Likewise, BCRs from 45 B-NHLs, including DLBCL, primary central nervous system lymphoma, mantle cell lymphoma, and chronic lymphocytic leukemia, did neither bind to the M. catarrhalis lysate nor to RpoC. The presence of high-titer M. catarrhalis-RpoC antibodies in NLPHL serum samples suggests generally an adaptive humoral immune response against M. catarrhalis. The fact that these antibodies were predominantly of the IgG1 subclass and in addition light chain restricted, suggests a clonal B-cell expansion apart from the LP cell clone, that underwent class switch recombination and plasmocytic differentiation. These findings suggest that naïve IgD+ B cells become activated in an adaptive humoral immune response against M. catarrhalis and represent the precursors of LP cells. M. catarrhalis is a widespread, Gram-negative bacterium that causes recurrent airway infections and otitis media[26]. M. catarrhalis additionally expresses the IgD-binding protein MID/hag, a bacterial autotransporter that binds specifically to the IgD Fc region and activates IgD+ B cells in a superantigenic manner[27-29]. Of interest, the outer membrane vesicles of M. catarrhalis contain both MID/hag and RpoC[17] and activate B cells[28], suggesting that M. catarrhalis can stimulate IgD+ LP cells in an additive manner, through RpoC binding to the antigen-binding region and through MID/hag binding to the Fc region of the BCR (Fig. 4). This result implies the combined antigenic and superantigenic stimulation of RpoC-reactive BCRs, which is supported by our in vitro model using the DEV cell line to express IgD+ patient-derived RpoC-specific BCRs. The RpoC-induced increase in proliferation was only observed in DEV cells transfected with RpoC-reactive BCRs. The combination of RpoC and MID/hag fragments that contained the IgD-binding domain resulted in the strong and additive BCR pathway activation and proliferative effects in DEV cells that expressed RpoC-reactive IgD+ BCRs.
Fig. 4

Presumable role of M. catarrhalis in the pathogenesis of IgD+ NLPHL.

Costimulation of B cells characterized by IgD+ BCR and extraordinary long CDR3s by M. catarrhalis RpoC via the Fab fragment and MID/hag via the Fc fragment of their BCR. Naïve, mature IgD+ B cells with a BCR specific for RpoC encounter M. catarrhalis outer membrane vesicles. Binding of RpoC to the Fab and of MID/hag to the Fc region of membranous IgD induces activation of RpoC-specific IgD+ B cells, which is supported by CD4+ T cells particularly in patients with an HLA-DRB1*04 or DRB1*07 haplotype. The persistent or recurrent presence of M. catarrhalis presumably induces a germinal center reaction resulting in differentiation to memory B cells and plasmablasts and production of class-switched anti-RpoC serum antibodies and apoptosis of some germinal center cells due to disadvantageous mutations. The co-stimulatory effect of MID/hag through binding to the Fc part of IgD selects for retention of IgD on a fraction of the stimulated germinal center B cells. Meanwhile a clone acquires mutations in proto-oncogenes, tumor suppressor genes as well as chromosomal translocations and may transform into LP cells. However, the transformed IgD+ LP cells still gain growth advantage by the interaction of their BCRs with M. catarrhalis RpoC and MID/hag.

Presumable role of M. catarrhalis in the pathogenesis of IgD+ NLPHL.

Costimulation of B cells characterized by IgD+ BCR and extraordinary long CDR3s by M. catarrhalis RpoC via the Fab fragment and MID/hag via the Fc fragment of their BCR. Naïve, mature IgD+ B cells with a BCR specific for RpoC encounter M. catarrhalis outer membrane vesicles. Binding of RpoC to the Fab and of MID/hag to the Fc region of membranous IgD induces activation of RpoC-specific IgD+ B cells, which is supported by CD4+ T cells particularly in patients with an HLA-DRB1*04 or DRB1*07 haplotype. The persistent or recurrent presence of M. catarrhalis presumably induces a germinal center reaction resulting in differentiation to memory B cells and plasmablasts and production of class-switched anti-RpoC serum antibodies and apoptosis of some germinal center cells due to disadvantageous mutations. The co-stimulatory effect of MID/hag through binding to the Fc part of IgD selects for retention of IgD on a fraction of the stimulated germinal center B cells. Meanwhile a clone acquires mutations in proto-oncogenes, tumor suppressor genes as well as chromosomal translocations and may transform into LP cells. However, the transformed IgD+ LP cells still gain growth advantage by the interaction of their BCRs with M. catarrhalis RpoC and MID/hag. A potential role for superantigen-driven germinal center reactions in the generation of highly mutated IgV regions in so-called IgD-only B cells has previously been proposed[30]. The high mutation load in IgVH genes isolated from IgD+ NLPHL patients identifies a germinal center origin for the respective LP cells, which would require cognate T-cell help. This is supported by the presence of “permissive” HLA-DRB1*04/*07 haplotypes. Indeed, several high-affinity T-cell epitopes are predicted for these haplotypes, suggesting that these haplotypes can provide cognate follicular T-cell help for RpoC-specific B cells. Thus, in addition to the two M. catarrhalis-derived stimuli, a third stimulus may be provided in respective individuals by antigen-specific CD4+ T-helper cells, resulting in the extensive proliferation of B cells with a specificity for M. catarrhalis RpoC. During germinal center reactions, the chronically stimulated B cells likely acquire transforming events, resulting in the development of the malignant clone[4]. Because all RpoC-reactive BCRs derived from LP cells were IgD+, the additional stimulation by the MID/hag protein is likely to be essential for the pathogenetic role played by M. catarrhalis in this scenario, as this finding indicates that the LP precursor cells are selected to retain IgD expression[31-33]. Contributions to lymphomagenesis from the chronic stimulation by T helper cells that have been activated by infectious pathogens or autoantigens have been demonstrated for some other lymphomas[32-34]. However, with the exception of hepatitis C virus, the target antigens of the BCRs from these lymphomas have either not been defined or have been shown to be autoantigens, and a combined antigen-specific and superantigenic stimulation, as has been identified here for NLPHL, has never been reported. In contrast with NLPHL, no RpoC-antibodies were observed in the sera of a cohort of 50 THRLBCL patients. THRLBCL is an aggressive B-cell lymphoma that is closely related to NLPHL. Transformations of NLPHL into THRLBCL-like cases have been observed. However, the lack of RpoC-antibodies in THRLBCL patients suggests a different pathogenic mechanism than that observed for the Moraxella-induced NLPHL subtype. Furthermore, NLPHL cases that are Moraxella sp.-induced do not present with a THRLBCL-like morphology. Given recent reports from retrospective analyses regarding less intensive treatments and active surveillance strategies for NLPHL[35], the results of the present study might further raise discussions regarding how to treat this Moraxella sp.-induced NLPHL subgroup, in particular. These results raise the question of whether antibiotic treatment and/or vaccination strategies could be used to prevent relapses of Moraxella sp.-induced NLPHL. Finally, the shared, specific BCR antigen found in IgD+ LP cells could be therapeutically exploited as the targeting moiety for different therapeutic formats, such as antigen/toxin conjugates, bispecific CD3 or CD16 constructs or CAR-T cells, resulting in the selective delivery of a therapeutic payload to RpoC-reactive B cells and leaving other B cells unaffected[36].

Methods

Study samples

The study was approved by the local ethics committees of the Universities in Frankfurt and Homburg. Frozen tissue sections of NLPHL specimens from the Dr. Senckenberg Institute of Pathology, Goethe University Hospital, Frankfurt/Main, Germany, from the Department of Pathology, Tampere University, Tampere, Finland, from the Institute of Pathology, CHUV Lausanne, Switzerland, and from the Department of Pathology, Uppsala University Hospital, Sweden, were analyzed. Informed consent of the patients was obtained in accordance with the Declaration of Helsinki. Sera of patients with NLPHL and sera of healthy controls were obtained at the medical school Homburg/Saar, Germany. Moreover, sera of patients with cHL or NLPHL were obtained from the HD13 (ISRCTN63474366), HD14 (ISRCTN04761296), HD15 (ISRCTN32443041), HD16 (NCT00736320), HD17 (NCT01356680) and HD18 (NCT00515554) trials of German Hodgkin Study Group (GHSG) as control and validation cohort[37-40]. Sera from patients with THRLBCL were obtained from the RICOVER (NCT00052936), Hi-CHOEP (NCT00129090), UNFOLDER (NCT00278408), FLYER (NCT00278421), CHOP-R-ESC (NCT00290667) trials of the German High-Grade Non-Hodgkin Lymphoma Study Group (DSHNHL)[41-44].

Laser microdissection and IgV region gene PCR

Single, clearly identifiable LP cells were microdissected with an ultraviolet laser (PALM microdissection system, Zeiss Axiovert 200M microscope), pooled in groups of 30 cells and resuspended in 18 µl 1x PCR buffer and digested with 2 µl of proteinase K (Roche, Grenzach, Germany) at 55 °C for 4 h, followed by enzyme inactivation at 95 °C for 10 min. The LP cell lysates were subjected to two rounds of VH-, Vκ-, and Vλ-specific seminested PCRs (30 and 44 cycles in the first and second round of PCR, respectively) using IgV family-specific primers and J primer mixes, and Expand high fidelity PCR kit (Roche) as described by Küppers et al. [45].

Expression of recombinant BCRs

The amplified IgV region genes were sequenced and analyzed with IMGT-V-Quest for functionality, V, D, and J segment usage and indications for somatic mutations. If both a functional heavy and light chain variable region gene was amplified, the IgV region genes were cloned into TOPO Zero-Blunt vector (Invitrogen Life Technologies, Darmstadt, Germany)[46]. IgV gene fragments were re-extended at the 5′ and 3′ ends according to the proper immunoglobulin germline genes. Complete IgV genes were inserted via ApaLI and XhoI for IgVκ or IgVλ in front of a κ-constant or λ-constant region gene, respectively, and via NcoI and BstEII for IgVH in front of a γ-1 constant region gene into a modified pCES-1 vector for expression of the Fab fragments[47]. Fabs were expressed and purified[23].

Antigen screening

To screen for potential reactivity of Fabs against bacterial antigens, heat-inactivated lysates of 13 different bacterial strains or patient isolates including M. catarrhalis, M. osloensis, M. nonliquefaciens, Streptococcus pneumoniae, Streptococcus pyogenes, Haemophilus influenzae, Staphylococcus aureus, coagulase-negative staphylococci, Klebsiella pneumoniae, Enterobacteriacae, Escherichia coli, Acinetobacter radioresistens, Neisseria spp., as well as DNA from M. catarrhalis and osloensis isolated from a patient, were provided by the Institute of Medical Microbiology and Hygiene of the University of Saarland, Homburg/Saar, Germany. Inactivated lysates of M. catarrhalis strain ATCC 43617 RO 108 and lysates of Bartonella henselae strain Marseille (Bartonella adhesin A positive), were provided by the Institute of Medical Microbiology and Infection Control of the Hospital of the Goethe University Hospital, Frankfurt/Main (Supplementary Table 3), were spotted onto PVDF membranes each with a dose of 10 µg. The dot blots of bacterial lysates were blocked in 10% (w/v) non-fat dry milk powder in TBST [TBS, 0.1% (v/v) Tween 20] at 4 °C overnight, washed twice in TBST and incubated for 1 h with the individual Fabs, each at a concentration of 10 µg/ml. Following three 30-min TBST washes and subsequent incubation for 1 h at room temperature with biotinylated goat anti-human heavy and light chain Fab antibody (DIANOVA, 109-065-088) at a dilution of 1:5000 (v/v) the arrays and blots were incubated for 10 min at room temperature with Strep-POX (1:5000) in 2% (w/v) milk/TBST and binding was detected using the ECL system (Amersham Pharmacia, Freiburg, Germany). Unprocessed scans of the dot blots are provided at the end of the Supplementary information. To extend the screening for infectious antigens, the recombinant NLPHL-Fabs were screened together with recombinant Fabs of different B-cell neoplasias at concentrations of 1, 10, and 20 µg/ml on an infectious disease epitope microarray (PEPperCHIP®/Heidelberg, Germany) consisting of 3760 database-derived B-cell epitopes from 190 pathogens, including 113 viruses, 41 bacteria, 25 parasites, 10 worms, and 1 pathogenic fungus. Goat anti-human IgG (H + L) conjugated to DyLight680 (1:5000) was used as secondary antibody and incubated for 45 min at room temperature. As a scanner the LI-COR Odyssey Imaging System was used with a scanning offset of 0.65 mm, a resolution of 21 µm and scanning intensities of 7/7 (red = 700 nm/green = 800 nm). Data quantification was followed by removal of spots with a deviation of more than 40%. Screening, scanning, and data analysis was performed by PEPperPRINT GmbH in Heidelberg, Germany. To screen Fabs against autoantigens, high-density cDNA library protein expression macroarrays (UniPex 1 & 2, Bioscience, Dublin, Ireland) consisting of 15,300 spotted UniPEx expression clones derived from human fetal brain, T cells, lung, and colon, which, after induction of expression, represent 7390 distinct recombinant human proteins were used[19]. Protein-macroarrays were blocked in 10% (w/v) non-fat dry milk powder in TBST at 4 °C overnight, washed twice in TBST and incubated for 1 h with pooled Fabs for the protein-arrays, each at a concentration of 10 µg/ml. Following three 30 min TBST washes and subsequent incubation for 1 h at room temperature with biotinylated goat anti-human Fab antibody (DIANOVA, 109-065-088) at a dilution of 1:5000 (v/v) the arrays and blots were incubated for 10 min at room temperature with Strep-POX (1:5000) in 2% (w/v) milk/TBST and binding was detected using the ECL system (Amersham Pharmacia).

Antigen characterization

To characterize antigens detected in the M. catarrhalis lysate, PAGE separations of M. catarrhalis lysates from a clinical isolate propagated from a patient with respiratory infection and a lysate of the strain ATCC 43617 RO 108 were performed and were Western blotted under reducing and non-reducing conditions with M. catarrhalis-reactive LP cell-derived recombinant Fabs and highly diluted (10−6) serum of a patient with IgD-secreting multiple myeloma. To identify the specific M. catarrhalis antigen of 150–160 kDa detected by Western blot out of more than 1800 known M. catarrhalis genes, an approach based on published literature and hypothetic assumptions was chosen to select possible candidate antigens. Literature search resulted firstly in the selection of MID/hag as possible candidate antigen, as it had previously been proposed as an antigen involved in the generation of IgD-only B cells, although the molecular weight is reported to be higher than that of the identified target antigen[30]. Moreover, only very few proteins of M. catarrhalis outer membrane vesicles have been reported to have as high molecular weights as the identified antigen of 150–160 kDa[16]. In a published list of the 50 most immunogenic B cell epitopes of M. catarrhalis, RpoC was the only protein with a molecular weight around 155 kDa[48]. By these means RpoC was selected as second hypothetic M. catarrhalis candidate antigen. To characterize antigens detected in the M. osloensis lysate, the lysate was separated in two-dimensional gels, followed by silver staining and Western blot with M. osloensis-reactive LP cell-derived recombinant Fabs as primary antibody (patient #11) followed by mass spectroscopy (Proteome Factory AG, Berlin, Germany). In short, NCBIprot database version 20161128 was used (106762850 sequences, 39119668168 residues) with the following parameters: enzyme: trypsin; fixed modifications: carbamidomethyl (C); variable modifications: deamidated (NQ), oxidation (M); mass values: monoisotopic; protein mass: unrestricted; peptide mass tolerance: ±3 ppm; fragment mass tolerance: ±0.6 Da; max missed cleavages; instrument type: ESI-Trap. The MID/hag and RpoC gene from M. catarrhalis and SUCLG1 gene from M. osloensis were amplified from the respective bacterial DNA. The expression clones of human pyruvate carboxylase, RPS27a and SMCHD1 were obtained from the manufacturer (Bioscience, Dublin, Ireland), the latter as control antigen, as reported previously[23]. Genes of MID/hag and RpoC from M. catarrhalis and of SUCLG1 from M. osloensis were cloned (Supplementary Table 1) with a C-terminal FLAG-tag into pSFI vector and expressed in HEK293. Nunc maxisorb ELISA plates were coated overnight at 4 °C with murine anti-FLAG antibody (Sigma, F3165, Munich) 1:2500 v/v. After blocking with 1.5% (w/v) gelatin in TBS and washing steps with TBS with Triton-X, recombinant NLPHL-derived Fabs were added at 10 µg/ml or patient sera at 1:100 for 1 h at room temperature. After washing-step with TBS-Tx biotinylated goat anti-human IgG (heavy and light chain) (Dianova) 1:2500 v/v or sheep anti-human IgG1, IgG2, IgG3, and IgG4 (Binding Site, AU006, AU007, AU008, and AU009, Birmingham, UK) 1:5000 (v/v) or rabbit anti-human IgM (Dianova, 109-476-129) 1:2500 v/v were added for 1 h at room temperature followed by washing step with TBS. For the determination of IgG subclasses and IgM biotinylated correspondent secondary antibodies were applied. This was followed by peroxidase-labeled streptavidin (Roche) 1:50,000. To verify specific reactivity of IgD+, NLPHL derived Fabs against M. catarrhalis RpoC, recombinant Fabs derived from 11 cases of PCNSL, 12 cases of DLBCL, 10 cases of MCL, and 12 cases of CLL were screened against M. catarrhalis lysates on dot blots and against recombinant FLAG-tagged M. catarrhalis RpoC by ELISA[22,23,49].

Generation of DEV cells expressing recombinant BCRs

The only existing NLPHL cell line (DEV) was cultured at 37 °C in an atmosphere containing 5% CO2 in RPMI-1640 medium supplemented with penicillin (100 U/ml), streptomycin (0.1 mg/ml), ultraglutamine (2 mM), and 20% fetal calf serum, and transfected with a pRTS expression vector with an IgV region heavy chain and constant regions Cγ1–Cγ4, Cµ1–Cµ4, or Cδ1–Cδ4 with membrane coding exons TM1 and TM2 for the transmembrane region and the cytoplasmic tail followed by a 2A sequence and the light chain variable region and light chain constant region gene. Transfection of DEV cells was performed after three washing steps with RPMI-1640 at a cell density of 2 × 107/ml in RPMI-1640 without FCS on ice. Two times 106 cells equalizing a volume of 100 µl were transfected with 5 µg plasmid DNA by electroporation using Gene Pulser (Biorad) with a 0.2 cm cuvette, a voltage of 140 V and 30 ms pulses. Subsequently cells were immediately put again on ice and cultured in RPMI-1640 medium supplemented with 20% FCS (Sigma, F2442). Cell lines stably expressing recombinant membranous BCR were selected with hygromycin at 250 µg/ml. Expression of recombinant BCR was induced by addition of doxycycline[50]. Successful transfection was verified by IgV region gene PCRs of transfected cell lines, by Western blot of the FLAG-tagged recombinant BCRs and surface expression of the transfected His-tagged BCR was determined by flow cytometry. In detail, surface expression of recombinant patient-derived BCRs on the membrane of DEV cell line was verified by flow cytometry using the BD FACS Canto and either the original DEV cell line or DEV cell lines transfected to express LP cell-derived BCR, which contain His6 tags. Cells were incubated with murine Anti-His antibody (Qiagen, 34660, Hilden, Germany) (1:500) followed by biotinylated anti-murine antibody (1:200) and PE-labeled streptavidin (Qiagen, 016-110-084) (1:500) each for 20 min at 4 °C with washing steps in between (Supplementary Fig. 15).

BCR and NF-κB pathway activation and proliferation assay

For Western blot analysis of the BCR pathway activation of transfected DEV cells either expressing a BCR with reactivity against M. catarrhalis RpoC or a different antigen, respectively, and of IgD, IgG, or IgM class, 1 × 106 cells were incubated with no antigen, recombinant RpoC at 5 µg/ml, RpoC and MID/hag fragment 2&3, MAZ at 5 µg/ml or anti-IgM/IgD at 1 µg/ml. As primary antibodies rabbit antibodies against pTyr525/526 SYK diluted 1:2000, pTyr759 PLCγ2 diluted 1:1000, pTyr223 BTK diluted 1:1000, and pTyr96 BLNK diluted 1:1000 (B cell signaling sampler kit, 9768, CST, Massachusetts, USA), rabbit antibody against actin diluted 1:2000 (Sigma, A5060), and murine antibody against MYC at a concentration of 1 µg/ml (Santa Cruz) were utilized, followed by washing steps and incubation with POX-conjugated anti-rabbit or anti-mouse antibodies diluted at 1:3000. For analysis of the NF-κB pathway mouse antibody against IKKα and IκBα, rabbit antibodies against IKK, pSer176/180 IKKα/β, pSer536 NF-κB p65, NF-κB p65, and against pSer32 IκBα were used (NF-κB pathway sampler kit, 9936, CST, Massachusetts, USA). For the analysis of cytoplasmatic calcium changes by flow cytometry a FACS Canto analyzer was used and Fluo-4/AM dye (Molecular probes, Invitrogen, F14201). Transfected DEV cells either expressing IgD+ BCRs with reactivity against RpoC or against a different antigen were resuspended in calcium-free and magnesium-free phosphate-buffered saline, and loaded with Fluo-4/AM dye (final concentration 2 μM, Invitrogen, Karlsruhe, Germany) for 30 min at room temperature. Antigen was added followed by flow cytometry of the cells. Ionomycin (10 ng/μl, Sigma-Aldrich, 407952) was used as a positive control for the release of calcium from internal stores. Intracellular calcium levels were repeatedly analyzed immediately after adding the antigen to the dye-loaded cells and mixing. To exclude cell debris DEV cell line was gated for relatively high FSC and low SSC. EZ4U, a non-radioactive proliferation assay (Biomedica, BI-5000), was performed according to the manufacturer’s instructions with DEV cells (IgD−), and the DEV cell line transfected to express RpoC-reactive surface BCR of the IgD class, and as further control a DEV cell line expressing RpoC-reactive membranous IgG BCR. The IgV genes were derived from case 3, and the IgD constant region gene from PBMCs of a healthy blood donor[51,52]. M. catarrhalis RpoC and as a control recombinant human SLP2, which is a frequent antigenic target of paraproteins from patients with multiple myeloma, were added at 10 µg/ml. Recombinant fragments of M. catarrhalis MID/hag spanning amino acids 1–761 (fragment 1), amino acids 920–1368 (fragment 2), and amino acids 920–2090 (fragment 3) were added to DEV cell cultures at 5 µg/ml. Adsorbance of Formazan at 450 nm was determined after 3 days at 37 °C. Statistical significance was calculated by multiple t-tests (Prism7, graphpad).

Cytotoxicity and apoptosis assays

For the analysis of the direct cytotoxic effects of immunotoxins a lactate dehydrogenase (LDH) release assay was used (Roche, 04744926001). 5 × 103 DEV cells per well, stably transfected to express the BCR of case #3 with reactivity against M. catarrhalis RpoC or of case #5 without reactivity against M. catarrhalis RpoC were incubated with RpoC/ETA or Ars2/ETA at concentrations from 0.1 to 10 µg/ml, or without an immunotoxin. Percent-specific lysis was determined after 24 h at 37 °C as follows: (experimental lysis−spontaneous lysis)/(maximum lysis–spontaneous lysis) × 100. Maximum lysis was determined by adding 10% Triton X-100. LDH was measured according to the protocol of the LDH assay kit (Roche, Mannheim, Germany). ELISA read out was done using a Victor II apparatus (PerkinElmer, Rodgau, Germany). For the analysis of apoptosis, 5 × 105 cells/ml suspension of DEV cells stably transfected to express either a BCR with reactivity against RpoC or a different antigen were treated by adding RpoC/ETA, MAZ/ETA (both at 0.5 µg/ml) or RpoC/ETA and MID/hag for 24 h at 37 °C, 5% CO2. Following the incubation, cells were washed twice with PBS and resuspended in 500 µl binding buffer. 5 µl of AnnexinV-FITC (SIGMA, APOAF) and 10 µl of propidium iodide (SIGMA) were added to each cell suspension and incubated for 10 min at room temperature, followed by analysis by FACS Canto. In addition, the effects of the immunotoxins were measured by trypan blue assays at 0, 24, and 48 h.

HLA typing

HLA-typing of class I and II human leukocyte antigens (HLA) was performed for all patients with IgD+ LP cells by sequence-based typing (Labor Thiele, Kaiserslautern, Germany).

Analysis of binding and internalization

To analyze binding to and internalization of RpoC into DEV cells transfected to express RpoC-reactive BCRs, a synthetic RpoC peptide consisting of the amino acid sequence VAAKDVVNADGDVVVPSGALIDERL with a C-terminal FITC (purity > 95%, Genecust, Luxembourg) was added at a concentration of 10 µg/ml or as a control CD30/FITC to DEV lines transfected either with RpoC-reactive BCR (derived from case #6) or without RpoC-reactive BCRs (derived from case #5) for 30 min at 4 °C. Cells were then immediately, or after 1 h incubation at 37 °C analyzed. To determine surface binding or internalization of RpoC/FITC half of the cells were washed and analyzed directly by flow, and the other half of cells was washed, treated by azide 2% for 5 min to solve the surface-bound antigen, washed again followed by flow cytometry.
  42 in total

1.  Hodgkin and Reed-Sternberg cells in lymphocyte predominant Hodgkin disease represent clonal populations of germinal center-derived tumor B cells.

Authors:  A Braeuninger; R Küppers; J G Strickler; H H Wacker; K Rajewsky; M L Hansmann
Journal:  Proc Natl Acad Sci U S A       Date:  1997-08-19       Impact factor: 11.205

2.  IgD positive L&H cells identify a unique subset of nodular lymphocyte predominant Hodgkin lymphoma.

Authors:  Sonam Prakash; Thomas Fountaine; Mark Raffeld; Elaine S Jaffe; Stefania Pittaluga
Journal:  Am J Surg Pathol       Date:  2006-05       Impact factor: 6.394

3.  Somatic hypermutation of SOCS1 in lymphocyte-predominant Hodgkin lymphoma is accompanied by high JAK2 expression and activation of STAT6.

Authors:  Anja Mottok; Christoph Renné; Klaus Willenbrock; Martin-Leo Hansmann; Andreas Bräuninger
Journal:  Blood       Date:  2007-07-25       Impact factor: 22.113

4.  L&H cells in lymphocyte-predominant Hodgkin's disease.

Authors:  R Küppers; K Rajewsky; A Braeuninger; M L Hansmann
Journal:  N Engl J Med       Date:  1998-03-12       Impact factor: 91.245

5.  Origin of nodular lymphocyte-predominant Hodgkin's disease from a clonal expansion of highly mutated germinal-center B cells.

Authors:  T Marafioti; M Hummel; I Anagnostopoulos; H D Foss; B Falini; G Delsol; P G Isaacson; S Pileri; H Stein
Journal:  N Engl J Med       Date:  1997-08-14       Impact factor: 91.245

6.  High familial risk in nodular lymphocyte-predominant Hodgkin lymphoma.

Authors:  Silva Saarinen; Eero Pukkala; Pia Vahteristo; Markus J Mäkinen; Kaarle Franssila; Lauri A Aaltonen
Journal:  J Clin Oncol       Date:  2013-01-02       Impact factor: 44.544

7.  Distinctive expression pattern of the BCL-6 protein in nodular lymphocyte predominance Hodgkin's disease.

Authors:  B Falini; B Bigerna; L Pasqualucci; M Fizzotti; M F Martelli; S Pileri; A Pinto; A Carbone; S Venturi; R Pacini; G Cattoretti; E Pescarmona; F Lo Coco; P G Pelicci; I Anagnastopoulos; R Dalla-Favera; L Flenghi
Journal:  Blood       Date:  1996-01-15       Impact factor: 22.113

8.  Frequent occurrence of BCL6 rearrangements in nodular lymphocyte predominance Hodgkin lymphoma but not in classical Hodgkin lymphoma.

Authors:  Iwona Wlodarska; Peet Nooyen; Brigitte Maes; José I Martin-Subero; Reiner Siebert; Patrick Pauwels; Chris De Wolf-Peeters; Anne Hagemeijer
Journal:  Blood       Date:  2002-09-12       Impact factor: 22.113

9.  Origin and pathogenesis of nodular lymphocyte-predominant Hodgkin lymphoma as revealed by global gene expression analysis.

Authors:  Verena Brune; Enrico Tiacci; Ines Pfeil; Claudia Döring; Susan Eckerle; Carel J M van Noesel; Wolfram Klapper; Brunangelo Falini; Anja von Heydebreck; Dirk Metzler; Andreas Bräuninger; Martin-Leo Hansmann; Ralf Küppers
Journal:  J Exp Med       Date:  2008-09-15       Impact factor: 14.307

10.  Nodular lymphocyte predominant hodgkin lymphoma and T cell/histiocyte rich large B cell lymphoma--endpoints of a spectrum of one disease?

Authors:  Sylvia Hartmann; Claudia Döring; Christina Jakobus; Benjamin Rengstl; Sebastian Newrzela; Thomas Tousseyn; Xavier Sagaert; Maurilio Ponzoni; Fabio Facchetti; Chris de Wolf-Peeters; Christian Steidl; Randy Gascoyne; Ralf Küppers; Martin-Leo Hansmann
Journal:  PLoS One       Date:  2013-11-11       Impact factor: 3.240

View more
  6 in total

Review 1.  Hodgkin Lymphoma: Biology and Differential Diagnostic Problem.

Authors:  Taishi Takahara; Akira Satou; Toyonori Tsuzuki; Shigeo Nakamura
Journal:  Diagnostics (Basel)       Date:  2022-06-20

Review 2.  An Update on the Pathology and Molecular Features of Hodgkin Lymphoma.

Authors:  Akira Satou; Taishi Takahara; Shigeo Nakamura
Journal:  Cancers (Basel)       Date:  2022-05-26       Impact factor: 6.575

Review 3.  Role of Specific B-Cell Receptor Antigens in Lymphomagenesis.

Authors:  Lorenz Thurner; Sylvia Hartmann; Frank Neumann; Markus Hoth; Stephan Stilgenbauer; Ralf Küppers; Klaus-Dieter Preuss; Moritz Bewarder
Journal:  Front Oncol       Date:  2020-12-09       Impact factor: 6.244

Review 4.  Molecular biology of Hodgkin lymphoma.

Authors:  Marc A Weniger; Ralf Küppers
Journal:  Leukemia       Date:  2021-03-08       Impact factor: 11.528

Review 5.  The Grey Zones of Classic Hodgkin Lymphoma.

Authors:  Jan Bosch-Schips; Massimo Granai; Leticia Quintanilla-Martinez; Falko Fend
Journal:  Cancers (Basel)       Date:  2022-01-31       Impact factor: 6.639

6.  3D analyses reveal T cells with activated nuclear features in T-cell/histiocyte-rich large B-cell lymphoma.

Authors:  Aresu Sadeghi Shoreh Deli; Sonja Scharf; Yvonne Steiner; Julia Bein; Martin-Leo Hansmann; Sylvia Hartmann
Journal:  Mod Pathol       Date:  2022-02-16       Impact factor: 8.209

  6 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.