Literature DB >> 32284663

Clinical, immunological and genetic characteristic of patients with clinical phenotype associated to LRBA-deficiency in Colombia.

Catalina Martínez-Jaramillo1, Sebastian Gutierrez-Hincapie1, Julio César Orrego Arango2, Gloria María Vásquez-Duque3, Ruth María Erazo-Garnica3, Jose Luis Franco1, Claudia Milena Trujillo-Vargas1.   

Abstract

BACKGROUND: LPS-responsive beige -like anchor protein (LRBA) deficiency is a primary immunodeficiency disease caused by loss of LRBA protein expression, due to biallelic mutations in LRBA gene. LRBA deficiency patients exhibit a clinically heterogeneous syndrome. The main clinical complication of LRBA deficiency is immune dysregulation. Furthermore, hypogammaglobulinemia is found in more than half of patients with LRBA-deficiency. To date, no patients with this condition have been reported in Colombia.
OBJECTIVE: To evaluate the expression of the LRBA protein in patients from Colombia with clinical phenotype associated to LRBA-deficiency.
METHODS: In the present study the LRBA-expression in patients from Colombia with clinical phenotype associated to LRBA-deficiency was evaluated. After then, the clinical, the immunological characteristics and the possible genetic variants in LRBA or other genes associated with the immune system in patients that exhibit decrease protein expression was evaluated.
RESULTS: In total, 112 patients with different clinical manifestations associated to the clinical LRBA phenotype were evaluated. The LRBA expression varies greatly between different healthy donors and patients. Despite the great variability in the LRBA expression, six patients with a decrease in LRBA protein expression were observed. However, no pathogenic or possible pathogenic biallelic variants in LRBA, or in genes related with the immune system were found.
CONCLUSION: LRBA expression varies greatly between different healthy donors and patients. Reduction LRBA-expression in 6 patients without homozygous mutations in LRBA or in associated genes with the immune system was observed. These results suggest the other genetic, epigenetic or environmental mechanisms, that might be regulated the LRBA-expression.
Copyright © 2019 Universidad del Valle.

Entities:  

Keywords:  Common variable immunodeficiency; Enteropathy; Hypogammaglobulinemia; Idiopathic Thrombocytopenic Purpura; Immunoglobulin A deficiency; LRBA; Systemic Lupus Erythematosus; Whole Exome Sequencing; X-linked agammaglobulinemia

Mesh：

Substances：

Year:  2019        PMID： 32284663      PMCID： PMC7141146          DOI： 10.25100/cm.v50i3.3969

Source DB:  PubMed          Journal:  Colomb Med (Cali)        ISSN： 0120-8322


Remark

Introduction

Primary immunodeficiency diseases (PID) are a heterogeneous group of inheritable genetic disorders that cause quantitative and/or functional alterations in different mechanisms involved in the immune response . PIDs are considered “rare” diseases, but most prevalence estimates have been based on selected populations (e.g. specialty clinics, disease registries) . However, these the frequencies are much higher than the reported estimates based on the registry data suggesting both underreporting and ascertainment bias. Therefore, the data obtained from registries does not provide adequate coverage to estimate prevalence or age distribution of PID . LPS-responsive beige -like anchor protein (LRBA) deficiency is a PID caused by loss of LRBA protein expression. LRBA deficiency is an autosomal recessive disorder caused by either homozygous or compound heterozygous mutations in LRBA gene . LRBA deficiency results in a clinically variable syndrome with a wide spectrum of clinical manifestations. The main clinical LRBA deficiency complication is the immune dysregulation, followed by organomegaly and recurrent infections. Among patients with immune dysregulation, enteropathy is the most common clinical manifestation, followed by autoimmune hemolytic anemia and idiopathic thrombocytopenic purpura . Furthermore, hypogammaglobulinemia is found 57% of the patients. Among patients with hypogammaglobulinemia, 17% of patients had reduced IgM and IgG levels, 17% had reduced IgA and IgG levels, and the 34% had low titers of all three immunoglobulin isotypes. In addition, the 16% patients had reduced IgA levels only, and 16% had low IgG levels . To date, no patients with this condition have been reported in Colombia. The goal of the present study was to evaluate the expression of the LRBA protein in patients with clinical phenotype associated to LRBA-deficiency from Colombia. Subsequently, to evaluate the clinical, immunological characteristics and the possible genetic variants involved in the regulation of the expression of this protein or other associated with an immune system in patients that exhibit decrease LRBA expression.

Materials and Methods

Summary of the methodology is showed in the Figure S1
Figure S1

Summary of the methodology

Human subjects

Patients referred to the Grupo de Inmunodeficiencias Primarias de la Universidad de Antioquia (Medellín, Colombia) presenting with any clinical manifestation of the LRBA deficiency (Immune dysregulation: enteropathy, autoimmune hemolytic anemia, idiopathic thrombocytopenic purpura, granulomatous-lymphocytic interstitial lung disease, type I diabetes and/or chronic autoimmune hepatitis; organomegaly: splenomegaly, lymphadenopathy and/or hepatomegaly; hypogammaglobulinemia: low titer IgM, IgG or IgA levels, or reduced all three immunoglobulin isotypes) were recruited to evaluate the LRBA expression in peripheral blood mononuclear cells (PBMC). Excluded were patients with incomplete diagnosis according to the criteria of the specialist. Healthy controls matched by age and gender with patients, parents and siblings were also included and samples were run in parallel with those of the patients, this was performed to ensure that the variability of expression was not inherent to age or sex and to determine if other members of the family also was affected the expression of the protein. The study was approved by the Institutional Review Board from Sede de Investigación Universitaria (SIU), Universidad de Antioquia, UdeA. Written informed consent was obtained from all participants involved in this study.

Evaluation LRBA expression

Western Blot (WB) Analysis

PBMC were obtained from peripherical blood (PB) isolated by density gradient centrifugation using Ficoll-Hypaque (Sigma-Aldrich, St Louis, MO). PBMC were resuspended in RPMI 1640 medium with L-glutamine and sodium bicarbonate (Sigma-Aldrich), supplemented with 10% of heat-inactivated fetal bovine serum (FBS, Gibco, MA, USA), 2% penicillin/streptomycin mixture (Lonza, Walkersville, MD) (Complete RPMI) and stimulated with phytohemagglutinin A (PHA, 10 mg/mL, Sigma-Aldrich). Cells were harvested and lysed using the RIPA buffer (Cell Signaling, MA) containing a protease inhibitor cocktail (Amresco, GA) and 0.1 M Phenyl methanesulfony fluoride (PMSF, Sigma-Aldrich). Protein levels were measured using the Quick Start(Bradford Protein Assay (Bio-Rad, CA) following manufacturer instructions. Lysates were resolved by SDS-PAGE (Polyacrylamide from Amresco, 10% gradient gel). Proteins were transferred onto polyvinylidenedifluoride (PVDF) membranes (Bio-Rad) and incubated with polyclonal rabbit anti-human LRBA antibody (HPA023597, Sigma-Aldrich), anti-GAPDH (Sigma-Aldrich) and anti-rabbit IgG-peroxidase antibody as secondary antibody (Sigma-Aldrich), were used for the protein detection. Signals were detected by the Western Blotting Luminol Reagent (Santa Cruz Biotechnology, TX) using the Syngene G:Box XR5 chemiluminescent and multicolor fluorescent imaging system (Integrated Scientific Solutions, San Diego, CA). Band quantification was performed using ImageJ 1.48v software (National Institutes of Health, Bethesda, MA). As a control of the reduction of the LRBA expression, the patient's cell lysate CVID022 was used, since it exhibited a decrease in the expression from the first WB performed.

Flow cytometry analysis (Fluorescence-activated cell sorting-FACS)

Ex vivo PB cells and PBMC stimulated w/o PHA (10 µg/mL), were intracellularly stained with the polyclonal anti-LRBA antibody (HPA019366, Sigma-Aldrich) using anti Rabbit PE-F(ab)`2 Donkey IgG (Sigma-Aldrich) as a secondary antibody. Intracellular cell staining was performed using Cytofix/Cytoperm and the Perm/Wash solutions from BD following the manufacturer’s instructions. Cells were re-suspended in Dulbecco PBS 1X (dPBS Sigma-Aldrich) prior to analysis. FACS was performed using a Fortessa II (BD, Franklin Lakes, NJ) and analyzed using the FlowJo V9.9.5 software (Tree Star, Inc. Ashland, OR). Furthermore, to evaluate LRBA staining specificity from the polyclonal antibody by FACS, the immunization LRBA peptide of the anti-LRBA polyclonal antibody (HPA019366, Sigma-Aldrich) was synthesized by ProteoGenix (Schiltigheim, France) and then diluted in dPBS (Sigma-Aldrich) at a final concentration of 4 mg/mL. Then, different peptide concentrations (2, 0.2, 0.02, 0.002 mg/mL diluted in dPBS) were incubated with the anti-LRBA antibody, and subsequently, specific binding of this anti-LRBA antibody mixture to the cells was evaluated ex vivo intracellular in CD3+ cells from PBMC.

Immunologic studies

Clinical information and immunological analysis (immunoglobulin levels, lymphocyte subpopulation numbers in peripherical blood) from patients were obtained from the Grupo de inmunodeficiencias primarias diagnostic service records.

Whole-Exome Sequencing (WES)

Genomic DNA (gDNA) was isolated from PB obtained from patients and their parents using the DNA Isolation Kit from Puregene™ (Gentra Systems, Minneapolis, MN) following manufacturer’s instructions. gDNA were subjected to WES by Macrogen® (Seoul, Korea), using the Illumina HiSeq X Ten Sequencing System. gDNA were subjected to library preparation, which introduced adapters into the genomic DNA, while fragmenting it into 100 bp segments. The adapter sequence was used to amplify fragmented gDNA in a limited cycle polymerase chain reaction. The DNA was enriched for exonic fragments, which were also amplified5. Sequences were aligned for variant calling and annotation with the human genome reference sequence (hg19 build) using BWA software (http://bio-bwa.sourceforge.net). Downstream processing was performed with Samtools - Faidx and Picard - Dict software, PICARD (http://broadinstitute.github.io/picard/), and the genome analysis toolkit (GATK), https://software.broadinstitute.org/gatk/best-practices/workflow?id=11145. The command line to select variants in candidate genes was: variants in genes previously associated with PID, population frequency <1% in both 1000 genome and Exome Aggregation Consortium (ExAC), nonsynonymous, located in exonic o splicing regions, deleterious effect predicted by SIFT, Polyphen2, MutationTaster or CADD (Table S1). Homozygote mutations were filtered because we suspected a recessive pattern of inheritance (Fig. S2).
Table S1

Summary of deleteriousness prediction methods used in this study

NameScoreInformation used
SIFT (Sorting Intolerant from tolerant)Ranges from 0 to 1. The amino acid substitution is predicted damaging if the score is ≤ 0.05 and tolerated if the score is > 0.05.It predicts whether an amino acid substitution affects protein function based on sequence homology and the physical properties of amino acids.
PolyPhen-2 (Polymorphism Phenotyping v2)Ranges from 0.0 (tolerated) to 1.0 (deleterious)It predicts possible impact of an amino acid substitution on the structure and function of a human protein using straightforward physical and comparative considerations.
0.0 to 0.15: benign.
0.15 to 0.85: possibly damaging.
0.85 to 1.0: damaging.
MutationTasterThe prob value is the probability of the prediction, i.e. a value close to 1 indicates a high 'security' of the prediction. Please note that the prob value used here is NOT the p value (probability of error) as used in t-test statistics.DNA sequence conservation, splice site prediction, mRNA stability prediction and protein feature annotations.
PROVEAN (Protein Variation Effect Analyzer) The scores are averaged within and across clusters to generate the final PROVEAN score. If the PROVEAN score is equal to or below a predefined threshold (e.g. -2.5), the protein variant is predicted to have a "deleterious" effect.It predicts whether an amino acid substitution or indel has an impact on the biological function of a protein.
CADD (Combined Annotation Dependent Depletion)( 1563 distinct variant annotation retrieved from Ensembl Variant Effect predictor (VEP), data from the ENCODE project and information from UCSC genome browser tracks.
Figure S2

Workflow for whole-exome sequencing analysis

To predict the intronic variants effect, the In-silico tools EX-SKIP was also used (http://ex-skip.img.cas.cz/). Also, NetGene2 (http://www.cbs.dtu.dk/services/NetGene2/) and Fruitfly (http://www.fruitfly.org/seq_tools/promoter.html) predictors were used for testing splice site variants. The reference sequences NM_006726.4 was used for the analysis of the LRBA variants.

Blast Analysis

A BLAST analysis (Basic Local Alignment Search Tool, https://blast.ncbi.nlm.nih.gov) was performed to evaluate if the peptides recognized by the anti-LRBA polyclonal antibodies used in this study (HPA019366 and HPA023597, Sigma-Aldrich) were cross-reacting with other human proteins. The peptides of the anti-LRBA polyclonal antibodies (HPA019366 and HPA023597, Sigma-Aldrich) were subjected to a blast analysis against all reference proteins using the following parameters: Database: refseq protein; Organism: Homo sapiens (taxid:9606); Algorithm: blatstp (protein-protein BLAST).

Statistical analysis

Pearson correlation coefficient using GraphPad Prism 5 (https://www.graphpad.com/support/prism-5-updates/) was performed to measure the statistical correlation between the intensity of the LRBA detection by WB (LRBA band intensity) and the LRBA staining by FACS (Mean fluorescence intensity, MFI).

Results

Detection of LRBA in peripheral blood (PB) cells

To confirm the sensitivity of this test and the accuracy of two different LRBA antibodies commercially available, we standardized the evaluation of LRBA expression in human PBMC by WB and FACS. Using WB, the LRBA band at 319 kDa in PHA-stimulated PBMC cells from healthy donors (HD) was detect (Fig. 1A). Also, LRBA by FACS in ex vivo PB cells and PBMC stimulated w/o PHA. LRBA is constitutively expressed in CD3+ cells from PB ex vivo and in unstimulated PBMC after three days of incubation was detect, however, upon stimulation with PHA, the expression is increased two-fold (Fig. 1B). the correlation between the ability of WB and FACS to detect LRBA was evaluated (Fig. 1C), and a positive correlation (r: 0.4723 p: 0.0112) between the level of LRBA detection among both techniques was observed. To assure the specificity of our antibodies, a BLAST analysis was performed to evaluate if every epitope recognized by the anti-LRBA antibodies was aligning with others human proteins (Fig. 1D). Besides the 100% match with the LRBA protein, these epitopes also matched with the paralog protein NBEA in 36% and 44%, respectively. These results indicate that the polyclonal anti-LRBA antibodies used by us could also recognized NBEA but this possibility is ruled out because this protein has a very limited expression to brain . In addition, the antibody Ab HPA019366 showed specific binding to intracellular LRBA that was lost when adding a specific LRBA-blocking peptide in a dose-dependent manner (Fig. 1E).
Figure 1

Standardization of the LRBA staining in human peripheral blood cells. Phytohemaglutinin A (PHA)-stimulated peripheral blood mononuclear cells (PBMC) cells from healthy donors (HD) were obtained and immediately lysed to extract and quantified proteins (40 µg) that were tested in a Western blot with the antibody anti-LRBA (HPA023597, Sigma) using GAPDH as a constitutively expressed protein. Bands were detected at 319 and 37 KDa, respectively (A). Consecutively, ex vivo PB cells and PBMC stimulated w/o PHA (1 µg/mL) were intracellularly stained with the antibody anti-LRBA (HPA019366, Sigma) using anti Rabbit PE- F(ab)`2 Donkey IgG as a secondary antibody. Dotted lines indicate the staining only with the secondary antibody. Continued lines represent the staining with the anti-LRBA antibody together with the secondary antibody. Shown is the LRBA staining gating only the CD3+ cells (B). A Pearson correlation analysis was performed by comparing the intensity of the LRBA detection by western blot (LRBA band intensity) and the LRBA staining by FACS (Mean fluorescence intensity, MFI) (C). Also, a BLAST analysis (https://blast.ncbi.nlm.nih.gov) was performed to evaluate if the peptide recognized by the anti-LRBA antibodies used in this study were cross-reacting with NBEA (Sequence from www.ncbi.nlm.nih.gov/nuccore/NC_000013.11) (NBEA is a paralog of LRBA) (D). Considering that anti-LRBA antibodies obtained commercially are policlonal, the specificity of recognition was also evaluated using the LRBA peptide SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV as a competitive reagent at different concentrations. The percentage of the recognition of the cell LRBA protein was calculated (E).

Expression of LRBA in patients with clinical phenotype associated to LRBA-deficiency

According the inclusion criteria, one hundred and twelve patients were recruited, 29 patients with common variable immunodeficiency (CVID), 14 with X-linked agamaglobulinemia (XLA), 55 with idiopathic hypogammaglobulinemia (IHG), 1 with selective IgA deficiency (SIgAD), 5 with enteropathies, 3 with Idiopathic thrombocytopenic purpura and 5 with systemic lupus erythematosus (SLE) (Fig. 2A). In our cohort, patients with CVID, IHG, XLA and SIgAD presented with either hypo or agammaglobulinemia, 9 CVID patients exhibited autoimmune manifestations (Table S2).
Figure 2

LRBA expression in patients. One hundred and twelve patients were recruited to evaluate the LRBA expression by westerm blot (WB). PHA-stimulated PBMC from 25 healthy donors and patients were obtain and lysed to extract and quantify proteins (40 μg) that were tested in a WB with the anti-LRBA antibody Ab HPA023597 (Sigma) using either GAPDH or TUBA as a constitutively expressed protein. Bands were detected at 319 kDa for LRBA, 37 KDa for GAPDH and 49 KDa for TUBA. Normalization of the LRBA band intensity against the constitutive protein (GAPDH or TUBA) is shown in (A). WB band intensities of LRBA in PHA-stimulated cells from patients with LRBA decreased expression is shown in (B). CVID: Common Variable Immunodeficiency, XLA: X-linked agammaglobulinemia, IHG: Hypogammaglobulinemia, SIgAD: Selective IgA Deficiency, ITP: Idiopathic thrombocytopenic purpura, SLE: Systemic Lupus Erythematosus. The gray bars represent the repeated samples. The red arrows indicate the patients with decrease in LRBA who continued in the study

Table S2

Summary of autoimmune manifestations in CVID and IHG patients

DiseaseCodeAutoimmune manifestations
CVID001Hypothyroidism
003Hypothyroidism
004Discoid lupus, ulcerative colitis
005Hemolytic anemia and autoimmune hepatitis
007Hypothyroidism, inflammatory bowel disease
011Autoimmune thyroiditis and autoimmune hepatitis
017Hypothyroidism
023Hypothyroidism
036Autoimmune Thrombocytopenia
IHG033Hypothyroidism
039Hypothyroidism
049Hypothyroidism
052Autoimmune neutropenia

CVID: Common Variable Immunodeficiency, IHG Hypogammaglobulinemia

The relative expression expression of LRBA was evaluated by WB in 25 HD and quantified using densitometry, to normalize it against the expression of the constitutive protein (either TUBA or GAPDH) (Fig. 2A). Optimal cut-of point of LRBA to distinguish between “decrease LRBA expression” and “normal LRBA expression” was selected considering the minimum value of LRBA expression among HD (cut of point 0.5). As a negative control, CVID022 was used since this sample was always negative for the expression of LRBA (Fig. 2A). Also, the LRBA expression in ex-vivo PB cells and PBMC stimulated w/o PHA by FACS was evaluated (Figure S3). LRBA exhibited a 2.3-fold decrease in ex-vivo patient´cells compared to that in HD cells. Therefore, the reduction in the expression of LRBA in lymphocytes from CVID022 was observed not only by WB but also by FACS. Unfortunately, it was not possible to evaluate the LRBA expression by flow cytometry in the other patients with decreased LRBA expression by WB. Similar results were observed in PBMC w/o PHA-stimuli. Nevertheless, the effect was more evident in PHA-stimulated PBMC with an 8-fold decrease in the expression of LRBA in the patient as compared to a HD (Figure S3).
Figure S3

LRBA expression in PHA-stimulated PBMC from CVID022 by FACS. Ex-vivo periphericalblood cells and PBMC stimulated w/o PHA (1 μg/ml) were intracellularly stained with the antibody anti-LRBA (HPA019366, Sigma) using anti Rabbit PE- F(ab)`2 Donkey IgG as a secondary antibody. Dotted lines indicate the staining only with the secondary antibody. Continued lines represent the staining with the anti-LRBA antibody together with the secondary antibody. Shown is the LRBA staining gating only the CD3+ cells. The red line represents the LRBA mean fluorescence intensity (MFI) from the corresponding experiment in the HD

Decrease LRBA expression in nine protein lysates from PHA-stimulated PBMC was observed (Figure 2A, gray bars), but only were repeated in eight and confirmed in six lysates by obtaining a second blood sample: two CVID patients (CVID22 and CVID024), two XLA patients, (XLA012 and XLA014) and two hypogammaglobulinemia patients (IHG001 and IHG002) (Figure 2 red arrow). Interestingly, the hypogammaglobulinemia patients are siblings. It is important to mention that CVID027 is a sister of these siblings, however she did not show decrease LRBA expression in PBMC (Figure 2A). There was no difference in the expression of LRBA by WB in cells obtained from patients with the different clinical conditions evaluated in comparison to HD (Mean/SD of the normalized band intensity: HD: 0.86/0.25; CVID: 0.69/0.32; XLA: 0.86/0.47; IHG: 0.90/0.35; enteropathies: 1.1/0.31; ITP: 0.98/0.25 and SLE: 0.77/0.2). Interestingly, an increase in the LRBA expression in 7 patients was observed (XLA001, XLA011, IHG003, IHG022, IHG022, IHG038, Entero003). The Figure 2B show WB band intensities of LRBA in PHA-stimulated cells from patients with LRBA decreased expression

Clinical phenotype of patients with decreased LRBA expression

The clinical characteristics of the patients is showed in the Table 1. The CVID022 patient is a female born full-term in 1982, product of the first pregnancy to unrelated healthy parents from Medellin (Antioquia-Colombia). Although no family history of recurrent infections, autoimmunity or hematological malignancies was documented, rhinitis, bronchitis, diabetes type II, asthma and chronic obstructive pulmonary disease were described in the family members.
Table 1

Summary of the clinical characteristics of patients with decreased LRBA expression

PatientCurrent Age (y)Age at first symptom (y)Age at diagnosis (y)Recurrent InfectionsGastrointestinal diseasesOther clinical manifestations
AllergiesAnemia
CVID022361013Tonsillitis, pneumonia, otitis, sinusitis.Diarrhea with mucus (giardiasis and amebiases) gastritis and duodenal polyps RhinitisYes
CVID02419235Tonsillitis, pneumonia, otitis, parotitis, periorbital cellulitis, sinusitis.Appendicitis with abdominal sepsis, irritable bowel disease Conjunctivitis, Rhinitis-
XLA012711Urinary tract infection, otitis, Aspergillosis†, chronic bronchial syndrome, sinusitis. Acute gastroenteritis and diarrheal disease (Salmonellosis) -Yes
XLA014411Upper respiratory tract infections, otitis, sinusitis.-Rhinitis-
Hipo001 913Bronchiolitis, pneumonia, otitis media, laryngitis Gastroesophageal reflux disease (GERD) grade IV, food allergy Asthma-
Hipo002 1114Otitis, tonsillitis Gastrointestinal infection, diarrhea, chronic abdominal pain --

† This infection was systemic but not recurrent.

† This infection was systemic but not recurrent. The CVID024. patient is a male, born full-term in 1998 to unrelated healthy parents. He is the first child and has a younger healthy brother. His father is from Medellin and his mother from Bolivar (Antioquia-Colombia). He only had a family history of type II diabetes and asthma in his paternal grandmother. At age 8, two variants in TACI were identified in a compound heterozygous pattern of inheritance: One variant, c.121G>C (p.41D>H) in exon 2 and the second variant c.297_299insT (p.Q99fsX6) in exon 3. However, both variants were also identified in the unaffected mother and brother of the patient. The father was found wild type for both variants. The XLA012.patient is a male, born by C-section in 2010 to unrelated healthy parents from Cúcuta (Norte de Santander, Colombia). He has also a healthy older sister. Diabetes and hypertension were reported in his maternal grandmother. Familiar history of a deceased uncle at the age of 5 due to “edema” was also documented. The genetic diagnosis of XLA was performed at age 2 with the detection of the mutation c.1573C>T p.Arg525X in Btk. During the five years follow up, a chronic bronchial syndrome, anemia and chronic sinusitis has been documented. The patient XLA014.is a male, born full-term in 2013, product of the second pregnancy to unrelated healthy parents from Santa Rosa del Sur de Bolivar (Santander-Colombia). His mother had a previous spontaneous abortion and he has also a healthy younger sibling. Hematological cancer was reported in his paternal grandmother. IHG001 is a male, born in 2008 in Medellin - Colombia from unrelated healthy parents. He was the product of the third pregnancy, born prematurely at 34 weeks of gestation by C-section with hyaline membrane disease. His father suffered from allergic rhinitis and his maternal grandmother documented asthma and hypothyroidism. He has also a cousin with hypothyroidism. His sister (IHG002) was born in 2006. She was the product of the second pregnancy, born at 36 weeks of gestation by C-section. These siblings have the older sister (CVID027) who had normal serum immunoglobulins and LRBA expression in PBMC.

Immunological phenotype in patients with decrease LRBA expression

An immunological analysis of the different lymphocyte subsets in PB from all patients with LRBA decrease in PBMC did not show a common and distinctive phenotypic feature (Table 2). However, the immunological characteristics from the different patients were confirmed according to the disease group. All patients with CVID exhibited a serum IgG and IgA decrease. The T cell subpopulations in PB were normal in the CVID patients. A decrease in the memory B cells (IgD+/CD27+) was observed in both patients however, only CVID022 had a decreased in the switched memory B cells (IgD-/CD27+). With regard to the XLA patients, the decrease in the three serum Ig isotypes was observed in XLA012 whereas no serum Ig data previous to the IVIG replacement therapy was found for XLA14. Notorious was the very low numbers of PB B cells observed in these patients. Also, some minor alterations of CD3+ T cells were observed in the XLA patients. Interestingly, the two siblings with IHG exhibited different immunological phenotype. IHG001 exhibited very low levels of serum IgG and IgA whereas IHG002 presented with only decreased serum IgG. However, both exhibited increase in the memory B cell subpopulation (Table 2).
Table 2

Immunological characterization of the patients with decreased LRBA expression in PHA-stimulated PBMC

Patients
CVID022CVID024XLA012XLA014IHG001IHG002
Immunoglobulin levels (mg/dL)
IgG0 ↓19.2 ↓111.8 ↓ND6.4 ↓675.4 ↓
IgM5.7 ↓55.1 ↑53.1ND64.082.0
IgA2.1 ↓2 ↓5.2 ↓ND<3.3 ↓72.2
Lymphocytes Percentages/Absolute numbers (cells/mm 3 )
CD3+ 64.0/1,16974.0/2,96390.5/2222 ↑88.0/4,738 ↑64.4/2,65574.0/2,776
CD3+ CD4+ 44.8/52423.4/93756.7/1,393 ↑25.6/1,36635.2/1,45235.8/1,346
CD3+ CD8+ 52.0/60640.2/1,61027.4/67358.3/3,111 ↑23.3/96131.8/1,196
CD19+ 8.2/147 ↓12.8/2300.7/16 ↓0.1/3 ↓23.3/961 ↑17.6/660
CD19+/CD21+ 7.0/12511.0/1970.4/110.0/122.1/91416.1/606
CD19+CD27+ 14.8/22 ↓16.0/37----24.8/238 ↑30.6/202 ↑
IgD+/CD27- 77.2/113 ↑68.0/156----71.7/689 ↑63.6/420 ↓
IgD+/CD27+ 10.5/15 ↓5.9/14 ↓----15.1/145 ↑15.6/103 ↑
IgD-/CD27+ 4.3/6 ↓10.1/23----9.7/93 ↑15.0/99 ↑
IgD+/CD38+ 0.5/112.9/30----11.1/107--
IgD-/CD38++ 0.0/0 ↓3.3/2.1----0.93/9 ↑1.5/10
CD24++/CD38++0.5/1 ↓12.8/29----11/10613.0/86

Ig: Immunoglobulin, ND: no data. The arrows down indicate decrease and the arrows upwards with respect to the reference value.

Ig: Immunoglobulin, ND: no data. The arrows down indicate decrease and the arrows upwards with respect to the reference value.

LRBA variants in the patients with decrease LRBA expression.

WES was performed in the patients with decrease LRBA expression. Overall, eighteen either non-synonymous exonic or intronic LRBA variants were identified in these patients (Table 3). Five variants with population frequency (1% were found (Table 3, gray bars), which two possibly pathogenic variants rs148385798 in CVID022 patient and the rs950337550 in CVID024 patient were found (Table 3, red box). The variant rs148385798 is a heterozygous missense change c.T194C in the exon 2 which correspond to the change p.I65T in the ConA domain of the protein. The In silico analysis predicted to be “deleterious” with SIFT (score: 0.02); “disease causing” with MutationTaster (p-value: 0.995) and “deleterious” in PROVEAN (score: -2.558) and CADD score was 16.37. The second variant rs950337550 is the heterozygous missense variant c.6892A>G in exon 46 which confers a p.K2298E change in the BEACH domain. The in silico analysis predicted to be “deleterious” with SIFT (score: 0.005); “disease causing” with MutationTaster (p-value: 1) and “Non-deleterious” with PROVEAN (score: -1.44).
Table 3

LRBA variants in the patients with decrease LRBA expression in PHA-stimulated PBMC

Patients LocationRefAltExons/intronsSNPAllelesFrequency
CVID022151199080GAExonrs2290846het0.15
151207127 CTExonrs3749574het0.16
151242312 CTIntronrs11737450het0.18
151753134 A-Intronrs145452262het0.062
151765243 GAIntronrs186080hom0.75
151935601AGExonrs148385798het0.002
151408800TCIntronrs7674989hom0.2
151656589CTIntronrs1993109het0.4
151829659 TCIntronrs1201207hom0.04
151773593GCExonrs1782360hom0,29
XLA12 151207127 CTExonrs3749574het0.16
151236393AGIntronrs74459799het0.0062
151242312 CTIntronrs11737450het0.18
151357938GAExonrs950337550het0.000008
151765243 GAIntronrs186080hom0.75
151817507CTIntronrs1813134het0.011
XLA14 151765243 GAIntronrs115139393hom0.75
151829659 TC-Intron151829659hom0.96
151231371 TCIntronrs1813134het0.52
151187011-GAGATIntronrs201486611het0.69
IHG001 IHG002 151231371 TCIntronrs1813134hom0.52
151235987GAIntron--het--
151753134 A-Intronrs145452262het0.062
151762104GAIntronrs893110507het0.00004
151765243 GAIntron rs186080het0.75

Ref: allele reference, Alt: allele altered, SNP: single nucleotide polymorphism, hom: homozygous, het: heterozygous. Highlighted in gray are the variants with a frequency <0.001 in the 1,000 genomes project (http://www.internationalgenome.org). The variables indicated in red are pathogenic or possibly pathogenic according to the predictors in silico.

Ref: allele reference, Alt: allele altered, SNP: single nucleotide polymorphism, hom: homozygous, het: heterozygous. Highlighted in gray are the variants with a frequency <0.001 in the 1,000 genomes project (http://www.internationalgenome.org). The variables indicated in red are pathogenic or possibly pathogenic according to the predictors in silico. Considering that LRBA inheritance pattern is autosomal recessive and that we had not found biallelic variants, we continued to the variants analysis in other genes involved in the immune system.

Other relevant variants found by Whole Exome Sequencing (WES) analysis

Were identified 50,300 high-quality variants in the CVID022 exome. Among them, 17056 were homozygous and 33244 heterozygous (Table 4). The variants in PID genes were first analyzed and homozygous variants in three genes (PLCG2, POLE, RLTPR) were found. However, these variants were localized in intronic regions, very distant from the proximal exon. To proceed with the WES analysis, following the hypothesis of a recessive mood of inheritance, homozygous or compound heterozygous variants were selected. These variants should fulfill also the defined criteria. Three candidate genes (KCNN3, TRPM3, ECT2L) were selected, however KCNN3 and TRPM3 are not expressed in lymphoid tissues. Moreover, the patient’s father also carried both variants in ECT2L. Finally, we evaluated the de novo heterozygous variants. One variant in Mitochondrial Ribosomal Protein L3 (MRL3) was found. Diseases associated with MRPL3 include Combined Oxidative Phosphorylation Deficiency 9 . however, this is a severe condition that primarily impairs neurological and liver function.
Table 4

Summary of whole-exome sequencing results in patients with decrease LRBA expression

VariantsCVID022XLA012XLA014IHG001IHG002
Total number 50,30053,00252,82153,21553,215
Number of Homozygous17,05614,78515,01514,65414,654
Number of Heterozygous33,24420,73120,53021,35221,352
PID related PLCG2, POLE, RLTPR BTK BTK ---
Homozygous candidates KCNN3, TRPM3 ------ PLCL2, FDFT1, GPRIN2
Heterozygous candidates ECT2L ------ SEC22B
In XLA12, 53,002 variants were identified, 14,785 homozygous and 20,730 heterozygous (Table 4). Within the PID genes, 27 variants were identified. Among them, the variant c.1573C>T p.Arg525X in BTK was confirmed. In other genes, no potential pathogenic candidate variants were found. In XLA14, 52,821 high-quality variants were identified in the exome, 15,015 were homozygous and 20,530 heterozygous (Table 4). Within the PID-related genes, 40 variants were found and one variant potentially pathogenic one in BTK gene was identified. This correspond to c.622+1G>A (NM_001287344). 3. An in silico analysis (fruit fly and NetGene2) showed that the effects of the BTK mutation conferring a change in the splice donor site at the end of the intron 6 within this gene affecting the protein at the PH domain. In the IHG001 and IHG002 siblings, a total of 53,215 variants were found in both. Homozygous and heterozygous variant numbers are specified in Table 4. However, no common homozygous or compound heterozygotes in PDI genes were identified. Homozygous variants in PLCL2, FDFT1 and GPRIN2, however, their father had the same homozygous variants in PLCL2 and FDFT1 and their mother had same homozygous variants in GPRIN2. Also, compound heterozygotes variants in SEC22B were found, however, their father carried the same variants.

Discussion

In this work, the expression of LRBA in 112 patients with clinical manifestations associated with LRBA-deficiency was evaluated. The inter-individual and intra-individual concordance in detection of LRBA expression in PHA-stimulated PBMC was observed. LRBA expression as detected by WB, was very heterogeneous in HDs. This heterogeneity has also been reported by Gamez et al. , who found by FACS, a MFI range between 2.14 - 10.00 (min-max) in the relative expression of LRBA in PBMC upon stimulation with PHA for four days in HD. Among these patients, decrease LRBA expression in nine protein lysates from patients was observed, after repeated, only in six protein lysates from patients was observed decrease. We still do not know why cells from some patients exhibited discordant LRBA expression levels in different blood samples and time points. A possible explanation for these results is an immune-triggered cellular senescence. Different factors such as persistent viral infections, stress and inflammatory syndromes induce the accumulation of T cells with characteristics of senescence . It is possible that these patients have been going through periods of stress or infection with the consequence of an induced senescence and alterations in the proliferation of the cells. Since the detection of LRBA expression in PBMC in our settings is an activation-dependent phenomenon, decrease activation of senescent cells could lead to a decrease in the immune cell-detected expression of LRBA. However, an activation marker, such as CD69, should be included in the staining controls in the future studies. On the other hand, an increase in the LRBA expression in 7 patients was also observed. To date, overexpressed of this gene associated with some PID has not been reported, however, Wang et al. , in 2004 reported by microarray and real time PCR analyses that LRBA is overexpressed in several cancers relative to their normal tissue controls. Additionally, the expression of cell activation must have been monitor in our patient’cells, since it has been previously shown that LRBA expression increases upon cell activation . This could be stated as one of the limitations of our results since decreased LRBA expression by WB might have been caused by poor immune cell activation. However, we had always sample limitation due to the enormous amount of protein required to perform the WB. Moreover, there has been no correlation among the intensity of the LRBA expression by flow and the proliferation index in B cells in healthy donors (Data not shown). On the other hand, patients with poor proliferation of T and B cells included in this cohort, exhibited normal LRBA expression by WB (Data not shown). The patients with decrease LRBA expression exhibited different phenotypic and immunologic characteristic. However, all patients presented with a reduction in IgG and recurrent infections and all except one presented gastropathy. Pathogenic or potentially pathogenic biallelic variants neither in LRBA nor in other immune-related genes were not observed. LRBA expression in PBMC may be decreased due to epigenetic mechanisms . Epigenetic mechanisms determine the phenotype without changes in the genotype, which operate at the transcriptional and post-transcriptional level of gene activity as well as at the level of protein translation and post-translational modifications. They participate in such processes as cell differentiation, morphogenesis, variability and adaptability of an organism and may be affected by both genetic and environmental factors . Moreover, epigenetic changes have been proposed to contribute to the CVID pathogenesis. Rodríguez-Cortez et al. , demonstrated by high-throughput DNA methylation analysis, in monozygotic twins discordant for CVID, predominant gain of DNA methylation in B cells in the CVID patients with respect to those from the healthy siblings. Taking together, the application of epigenetic studies to identify and characterize not only molecular signatures of LRBA deficiency as well as the mechanisms underlying disease pathogenesis and responses to new therapeutic modalities are required. Another possible explanation of the decrease in the expression of LRBA in PHA-stimulated PBMC from patients with no mutations in either LRBA or other genes by WES, would be the presence of pathogenic mutation in regulatory elements, including promoters, enhancers, insulators, and silencers in LRBA. Any variant that is located within a functional genomic region has the potential ability to cause a dysregulation on gene expression through modifying regulatory elements, possibly resulting in diseases pathogenesis . In recent years, genome-wide association studies (GWAS) identified over ten thousand variants associated with various diseases/traits, ~90% of which localize outside of known protein-coding regions . In addition, to evaluate the copy number variation and coverage rate of every LRBA exon, to exclude a second heterozygous variant in patients with high clinical suspicion of LRBA deficiency, are required in future studies. In the present study, variables with clinical significance in LRBA were not found, then, we continued with the analysis of variables in other genes throughout the exome. A new variant (c.622+1G>A NM_001287344) in BTK that probably confers a lost in the splice donor site at the end of the intron 6 in the XLA14 patient was found. When a naturally-occurring splice-sites are abolished by mutations, the spliceosome usually either employs the next available legitimate splice-site (exon skipping) or selects the next best, albeit illegitimate, splice-site in the vicinity (cryptic splice-site utilization) . In this specific case, the mRNA transcription might be impaired after exon 6, affecting the protein from the amino acid 25 and generating a new truncated protein. The aberrant mRNAs could be removed by nonsense-mediated decay pathway, which targets mRNAs harboring premature termination codons for degradation . Thus, the truncated protein, might not contain the PH, SH3, SH2, and protein kinase domains of the protein and therefore, might be either not functional or subjected to degradation by the Ubiquitin-Proteasome Pathway. However, the exact effect of the mutation should be verified in functional studies. Taking together, the results from this study indicate, LRBA expression varies greatly between different HDs and patients PBMC. Despite the great variability in the LRBA expression in the different samples, six patients exhibited a decrease expression of this protein by WB in PHA-stimulated PBMC. No genes were detected associated with the defective LRBA production by these cells in these patients. Homozygous mutations in LRBA cause LRBA-deficiency affecting the protein expression. However, reduction LRBA-expression in patients without homozygous mutations or in associated genes were present. These results suggest the other genetic, epigenetic or environmental mechanisms, that might be regulated the LRBA-expression. The specificity of the LRBA detection by WB and FACS was previously evaluated. A positive correlation between the ability of WB and FACS to detect LRBA was demonstrated. FACS experiments using competitive epitopes to validate the specificity of recognition of LRBA were also performed. With these results, we demonstrated that antibodies showed specific binding to intracellular LRBA that was lost when adding a specific LRBA-blocking peptide in a dose-dependent manner.

Contribución del estudio

Introducción

Las inmunodeficiencias primarias (IDP) son un grupo heterogéneo de trastornos genéticos hereditarios que causan alteraciones cuantitativas y/o funcionales en diferentes mecanismos involucrados en la respuesta inmune . Las IDP se consideran enfermedades "raras", pero la mayoría de las estimaciones de prevalencia se han basado en poblaciones seleccionadas (por ejemplo, clínicas especializadas, registros de enfermedades) . Sin embargo, estas frecuencias son mucho más altas que las estimaciones reportadas basadas en los datos del registro, lo que sugiere sesgos de subregistro y de verificación. Por lo tanto, los datos obtenidos de los registros no proporcionan una cobertura adecuada para estimar la prevalencia o la distribución por edad de IDP . La deficiencia de LRBA (del inglés: Lipopolysaccharide (LPS)-Responsive and Beige-like Anchor protein) es una IDP autosómica recesiva causada por la pérdida de expresión de la proteína LRBA debido a mutaciones homocigotas o heterocigotas compuestas en el gen LRBA . La deficiencia de LRBA produce un síndrome clínicamente variable con un amplio espectro de manifestaciones clínicas. La principal complicación clínica de la deficiencia de LRBA es la disregulación inmune, seguida de organomegalia e infecciones recurrentes. Entre los pacientes con disregulación inmune, la enteropatía es la manifestación clínica más común, seguida de anemia hemolítica autoinmune y púrpura trombocitopénica idiopática . Además, la hipogammaglobulinemia se encuentra en el 57% de los pacientes. Entre los pacientes con hipogammaglobulinemia, el 17% de los pacientes tienen reducción de los niveles de IgM e IgG, el 17% presentan reducción los niveles de IgA e IgG, y el 34% muestran títulos bajos de los tres isotipos de inmunoglobulinas. Además, el 16% de los pacientes tenían solamente niveles reducidos de IgA y el 16% tenían niveles bajos de IgG4. Hasta la fecha, no se han reportado pacientes con esta afección en Colombia. El objetivo del presente estudio fue evaluar la expresión de la proteína LRBA en pacientes colombianos con fenotipo clínico asociado a la deficiencia de LRBA. Posteriormente, evaluar las características clínicas, inmunológicas y las posibles variantes genéticas involucradas en la regulación de la expresión de esta proteína u otra asociada con el sistema inmune en pacientes que exhiben disminución de la expresión de LRBA.

Materiales y Métodos

El resumen de la metodología se muestra en la Figura S1
Figura S1

Resumen de la metodología.

Sujetos humanos

Pacientes remitidos al Grupo de Inmunodeficiencias Primarias de la Universidad de Antioquia (Medellín, Colombia) que presentan alguna manifestación clínica asociado con el fenotipo de la deficiencia de LRBA (Disregulación inmune: enteropatía, anemia hemolítica autoinmune, púrpura trombocitopénica idiopática, enfermedad pulmonar intersticial linfocítica granulomatosa, diabetes melitus tipo I y/o hepatitis autoinmune crónica; organomegalia: esplenomegalia, linfadenopatía y / o hepatomegalia; hipogammaglobulinemia: niveles bajos de IgM, IgG o IgA de título, o los tres isotipos de inmunoglobulina reducidos) se reclutaron para evaluar la expresión de LRBA en células mononucleares de sangre periférica (CMSP) Se excluyeron pacientes con diagnóstico incompleto según los criterios del especialista. También se incluyeron controles sanos apareados por edad y género con los pacientes, padres y hermanos y se analizaron muestras en paralelo con las de los pacientes, esto se realizó para garantizar que la variabilidad de la expresión no fuera inherente a la edad o el sexo y para determinar si otro miembros de la familia también tenían afectada la expresión de la proteína. El estudio fue aprobado por el Comité de Ética Institucional de la Sede de Investigaciones Universitarias (SIU), Universidad de Antioquia, UdeA. Se obtuvo el consentimiento informado por escrito de todos los participantes involucrados en este estudio.

Evaluación de la expresión LRBA

Análisis de Western Blot (WB)

Las CMSP se obtuvieron de sangre periférica aislada por centrifugación en gradiente de densidad usando Ficoll-Hypaque (Sigma-Aldrich, St Louis, MO). Las CMSP se resuspendieron en medio RPMI 1640 con L-glutamina y bicarbonato de sodio (Sigma-Aldrich), suplementado con 10% de suero fetal bovino inactivado por calor (SFB, Gibco, MA, EE. UU.), penicilina/estreptomicina al 2% (Lonza, Walkersville, MD) (RPMI completo) y estimulado con fitohemaglutinina A (PHA, 10 mg/mL, Sigma-Aldrich). Las células se cosecharon y se lisaron usando buffer RIPA (Cell Signaling, MA) que contiene un cóctel inhibidor de proteasa (Amresco, GA) y fluoruro de fenilmetanosulfonia 0,1 M (PMSF, Sigma-Aldrich). Los niveles de proteína se midieron usando el Ensayo de proteína Quick Start® Bradford (Bio-Rad, CA) siguiendo las instrucciones del fabricante. Los lisados ​​se resolvieron mediante SDS-PAGE (Poliacrilamida de Amresco, gel de gradiente al 10%). Las proteínas se transfirieron a membranas de fluoruro de polivinilideno (PVDF) (Bio-Rad) y se incubaron con anticuerpo policlonal de conejo anti-LRBA humano (HPA023597, Sigma-Aldrich), anti-GAPDH (Sigma-Aldrich) y anticuerpo anti-IgG-peroxidasa anti-conejo como secundario anticuerpo (Sigma-Aldrich). Las señales fueron detectadas por el Western Blotting Luminol Reagent (Santa Cruz Biotechnology, TX) usando el sistema de imágenes quimioluminiscentes y fluorescentes multicolores Syngene G: Box XR5 (Integrated Scientific Solutions, San Diego, CA). La cuantificación de la banda se realizó utilizando el software ImageJ 1.48v (National Institutes of Health, Bethesda, MA). Como control de la reducción de la expresión de LRBA, se usó el lisado celular del paciente CVID022, ya que exhibía una disminución en la expresión del primer WB que realizamos.

Análisis de citometría de flujo (FACS- Fluorescence-activated cell sorting)

Las células de sangre periférica ex vivo y las CMSP estimuladas sin PHA (10 µg/mL) se tiñeron intracelularmente con el anticuerpo policlonal anti-LRBA (HPA019366, Sigma-Aldrich) usando anti-conejo PE-F (ab) `2 Donkey IgG (Sigma -Aldrich) como anticuerpo secundario. La tinción celular intracelular se realizó con Cytofix/Cytoperm y las soluciones Perm/Wash de Becton Dickinson (BD) siguiendo las instrucciones del fabricante. Las células se resuspendieron en Dulbecco PBS 1X (dPBS Sigma-Aldrich) antes del análisis. FACS se realizó con Fortessa II (BD, Franklin Lakes, NJ) y se analizó con el software FlowJo V9.9.5 (Tree Star, Inc. Ashland, OR). Además, para evaluar la especificidad de tinción de LRBA del anticuerpo policlonal por FACS, el péptido reconocido por del anticuerpo policlonal anti-LRBA (HPA019366, Sigma-Aldrich) fue sintetizado por ProteoGenix (Schiltigheim, Francia) y luego diluido en dPBS (Sigma-Aldrich ) a una concentración final de 4 mg/mL. Luego, se incubaron diferentes concentraciones de los péptidos (2, 0.2, 0.02, 0.002 mg/mL diluidos en dPBS) con el anticuerpo anti-LRBA, y posteriormente, se evaluó en células ex vivo CD3+ provenientes de CMSP la expresión intracelular de LRBA, luego de la adición de esta mezcla de anticuerpo anti-LRBA/peptido.

Estudios inmunológicos

La información clínica y el análisis inmunológico (niveles de inmunoglobulina, números de subpoblación de linfocitos en sangre periférica) de pacientes se obtuvieron de los registros del servicio de diagnóstico del Grupo de Inmunodeficiencias Primarias.

Secuenciación del exoma completo (WES- Whole-Exome Sequencing)

El ADN genómico (ADNg) se aisló de sanfre periferica obtenida de pacientes y sus padres utilizando el kit de aislamiento de ADN de Puregene ™ (Gentra Systems, Minneapolis, MN) siguiendo las instrucciones del fabricante. Los ADNg fueron sometidos a WES por Macrogen® (Seúl, Corea), utilizando el sistema de secuenciación Illumina HiSeq X 10. El ADNg se sometió a una preparación de biblioteca, que introdujo adaptadores en el ADN genómico, mientras lo fragmentaba en segmentos de 100 pb. La secuencia del adaptador se usó para amplificar el ADNg fragmentado en una reacción en cadena de la polimerasa de ciclo limitado. El ADN se enriqueció con fragmentos exónicos, que también se amplificaron . Las secuencias se alinearon para la variantes y se anotaron con la secuencia de referencia del genoma humano (hg19 build) utilizando el software BWA (http://bio-bwa.sourceforge.net). El procesamiento posterior se realizó con el software Samtools - Faidx y Picard - Dict, PICARD (http://broadinstitute.github.io/picard/) y el kit de herramientas de análisis del genoma (GATK), https://software.broadinstitute.org/gatk/best-practices/workflow?id=11145. La línea de comando para seleccionar variantes en genes candidatos fue: variantes en genes previamente asociados con IDP, frecuencia de población <1% tanto en la base de batos de 1000 genomes como en el Consorcio de Agregación del Exoma (ExAC), no sinónimas, ubicadas en regiones exónicas o de splicing, efectos deletereos predicho por SIFT, Polyphen2, MutationTaster o CADD (Tabla S1). Las mutaciones homocigóticas se filtraron porque sospechábamos un patrón de herencia recesivo (Figura S2).
Tabla S1

Resumen de los métodos de predicción deletéreos utilizados en este estudio

NameScoreInformation used
SIFT (Sorting Intolerant from tolerant)El rango va de 0 a 1. Se predice que la sustitución de aminoácidos es dañina si el puntaje es ≤ 0.05 y se tolera si el puntaje es> 0.05.Predice si una sustitución de aminoácidos afecta la función de la proteína según la homología de secuencia y las propiedades físicas de los aminoácidos.
PolyPhen-2 (Polymorphism Phenotyping v2)Rangos de 0.0 (tolerado) a 1.0 (perjudicial)Predice el posible impacto de una sustitución de aminoácidos en la estructura y función de una proteína humana utilizando consideraciones físicas y comparativas directas.
0.0 a 0.15: benigno.
0.15 a 0.85: posiblemente dañino.
0.85 a 1.0: dañino.
MutationTasterEl valor prob es la probabilidad de la predicción, es decir, un valor cercano a 1 indica una alta 'seguridad' de la predicción. Tenga en cuenta que el valor prob utilizado aquí NO es el valor p (probabilidad de error) como se usa en las estadísticas de prueba t.Conservación de la secuencia de ADN, predicción del sitio de empalme, predicción de estabilidad de ARNm y anotaciones de características de proteínas.
PROVEAN (Protein Variation Effect Analyzer) Los puntajes se promedian dentro y entre los grupos para generar el puntaje PROVEAN final. Si el puntaje PROVEAN es igual o inferior a un umbral predefinido (por ejemplo, -2.5), se predice que la variante de proteína tendrá un efecto "perjudicial".Predice si una sustitución de aminoácidos o indel tiene un impacto en la función biológica de una proteína.
CADD (Combined Annotation Dependent Depletion)( 1563 anotaciones de variante distintas recuperadas del predictor de efecto de variante Ensembl (VEP), datos del proyecto ENCODE e información de las pistas del explorador del genoma UCSC.
Figura S2

Flujo de trabajo para el análisis de secuenciación de exoma completo

Para predecir el efecto de las variantes intrónicas, también se utilizó la herramienta In-silico EX-SKIP (http://ex-skip.img.cas.cz/). Además, se utilizaron predictores NetGene2 (http://www.cbs.dtu.dk/services/NetGene2/) y Fruitfly (http://www.fruitfly.org/seq_tools/promoter.html) para evaluar las variantes en sitios de empalme. Las secuencias de referencia NM_006726.4 se usaron para el análisis de las variantes de LRBA.

Análisis de BLAST

Se realizó un análisis BLAST (del inglés, Basic Local Alignment Search Tool, https://blast.ncbi.nlm.nih.gov) para evaluar si los péptidos reconocidos por los anticuerpos policlonales anti-LRBA utilizados en este estudio (HPA019366 y HPA023597, Sigma- Aldrich) reaccionaron de forma cruzada con otras proteínas humanas. Los péptidos de los anticuerpos policlonales anti-LRBA (HPA019366 y HPA023597, Sigma-Aldrich) se sometieron a un análisis de BLAST contra todas las proteínas de referencia utilizando los siguientes parámetros: Base de datos: proteína refseq; Organismo: Homo sapiens (taxid: 9606); Algoritmo: blatstp (proteína-proteína BLAST).

Análisis estadístico

Se realizó el coeficiente de correlación de Pearson utilizando GraphPad Prism 5 (https://www.graphpad.com/support/prism-5-updates/) para medir la correlación estadística entre la intensidad de la detección de LRBA por WB (intensidad de banda de LRBA) y el Tinción de LRBA por FACS (intensidad media de fluorescencia, IMF).

Resultados

Detección de LRBA en células de sangre periférica.

Para confirmar la sensibilidad de esta prueba y la precisión de dos diferentes anticuerpos anti-LRBA disponibles comercialmente, estandarizamos la evaluación de la expresión de LRBA en CMSP humanas por WB y FACS. Usando WB, se detectó la banda LRBA a 319 kDa en células CMSP estimuladas con PHA de donantes sanos (DS) (Figura 1A). Además, se detectó LRBA por FACS en células de sangre periférica ex vivo y en CMSP estimuladas y sin PHA. El LRBA se expresa constitutivamente en células CD3+ de sangre periférica ex vivo y en CMSP no estimuladas después de tres días de incubación, sin embargo, tras la estimulación con PHA, la expresión aumenta dos veces (Figura 1B). Se evaluó la correlación entre la capacidad de WB y FACS para detectar LRBA (Figura 1C), y se observó una correlación positiva (r: 0.4723, p 0.0112) entre el nivel de detección de LRBA entre ambas técnicas. Para asegurar la especificidad de nuestros anticuerpos, se realizó un análisis BLAST para evaluar si cada epítope reconocido por los anticuerpos anti-LRBA se estaba alineando con otras proteínas humanas (Figura 1D). Además del 100% de coincidencia con la proteína LRBA, estos epítopes también coincidieron con la proteína paraloga NBEA en 36% y 44%, respectivamente. Estos resultados indican que los anticuerpos policlonales anti-LRBA utilizados por nosotros también podrían reconocer NBEA, pero esta posibilidad se descarta porque esta proteína tiene una expresión muy limitada en el cerebro . Además, el anticuerpo HPA019366 mostró una unión específica a LRBA intracelular que se perdió al agregar un péptido de bloqueo específico de LRBA de una manera dosis dependiente (Figura 1E).
Figura 1

Estandarización de la tinción de LRBA en células de sangre periférica humana. Se obtuvieron células mononucleares de sangre periférica (CMSP) estimuladas con fitohemaglutinina A (PHA) de donantes sanos (DS) y se lisaron inmediatamente para extraer y cuantificar proteínas (40 ug) que se analizaron en una transferencia Western Blot (WB) con el anticuerpo anti-LRBA (HPA023597 , Sigma) usando GAPDH como una proteína expresada constitutivamente. Se detectaron bandas a 319 y 37 KDa, respectivamente (A). Consecutivamente, las células de sangre periférica ex vivo y las CMSP estimuladas sin PHA (1 µg / ml) se tiñeron intracelularmente con el anticuerpo anti-LRBA (HPA019366, Sigma) usando anti-conejo PE-F (ab) `2 Donkey IgG como anticuerpo secundario. Las líneas punteadas indican la tinción solo con el anticuerpo secundario. Las líneas continuas representan la tinción con el anticuerpo anti-LRBA junto con el anticuerpo secundario. Se muestra la tinción de LRBA solamente las células CD3+ activadas (B). Se realizó un análisis de correlación de Pearson comparando la intensidad de la detección de LRBA por WB (intensidad de banda de LRBA) y la tinción de LRBA por FACS (intensidad de fluorescencia media, IMF) (C). Además, se realizó un análisis BLAST (https://blast.ncbi.nlm.nih.gov) para evaluar si el péptido reconocido por los anticuerpos anti-LRBA utilizados en este estudio tenían reacción cruzada con NBEA (Secuencia de www.ncbi .nlm.nih.gov/nuccore/NC_000013.11) (NBEA es un paralog de LRBA) (D). En función de los anticuerpos anti-LRBA que se comercializan son policlonales, la especificidad de reconocimiento también se evaluó mediante el péptido LRBA SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV como un reactivo competitivo a diferentes concentraciones. Se calculó el porcentaje de reconocimiento de la proteína LRBA celular (E).

Expresión de LRBA en pacientes con fenotipo clínico asociado a deficiencia de LRBA

Acorde a los criterios de inclusión, se reclutaron ciento doce pacientes, 29 pacientes con inmunodeficiencia común variable (ICV), 14 con agamaglobulinemia ligada al cromosoma X (XLA, del inglés, X-linked agamaglobulinemia), 55 con hipogammaglobulinemia idiopática (IHG, del inglés, idiopathic hypogammaglobulinemia), 1 con deficiencia selectiva de IgA (SigAD, del inglés, selective IgA deficiency), 5 con enteropatías, 3 con púrpura trombocitopénica idiopática y 5 con lupus eritematoso sistémico (LES) (Figura 2A). En nuestra cohorte, los pacientes con ICV, IHG, XLA y SIgAD presentaron hipo o agammaglobulinemia, 9 pacientes con ICV exhibieron manifestaciones autoinmunes (Tabla S2). La expresión relativa de LRBA fue evaluada por WB en 25 DS y cuantificada usando densitometría, para normalizarla contra la expresión de la proteína constitutiva (TUBA o GAPDH) (Figura 2A). Se seleccionó el punto de corte óptimo de LRBA para distinguir entre "expresión disminuida de LRBA" y "expresión normal de LRBA " considerando el valor mínimo de la expresión de LRBA entre DS (corte del punto 0.5).
Figura 2

Expresión de LRBA en pacientes. Ciento doce pacientes fueron reclutados para evaluar la expresión de LRBA por westerm blot (WB). Se obtuvieron CMSP estimuladas con PHA de 25 donantes sanos para extraer y cuantificar proteínas (40 μg) que se analizaron en un WB con el anticuerpo anti-LRBA Ab HPA023597 (Sigma) usando GAPDH o TUBA como proteína expresada constitutivamente. Se detectaron bandas a 319 kDa para LRBA, 37 KDa para GAPDH y 49 KDa para TUBA. La normalización de la intensidad de la banda LRBA contra la proteína constitutiva (GAPDH o TUBA) se muestra en (A). Las intensidades de la banda WB de LRBA en células estimuladas con PHA de pacientes con expresión disminuida de LRBA se muestran en (B). ICV o CVID: inmunodeficiencia común variable, XLA: agammaglobulinemia ligada a X, IHG: hipogammaglobulinemia, SIgAD: deficiencia selectiva de IgA, PTI: púrpura trombocitopénica idiopática, LES: lupus eritematoso sistémico. Las barras grises representan las muestras repetidas. Las flechas rojas indican los pacientes con disminución de LRBA que continuaron en el estudio.

Tabla S2

Resumen de manifestaciones autoinmunes en pacientes con CVID e IHG

EnfermedadCodeManifestación autoinmune
ICV001Hipotiroidismo
003Hipotiroidismo
004Lupus discoide, colitis ulcerosa
005Anemia hemolítica y hepatitis autoinmune
007Hypothyroidism, inflammatory bowel disease
011Hipotiroidismo, enfermedad inflamatoria intestinal.
017Hipotiroidismo
023Hipotiroidismo
036Trombocitopenia autoinmune
IHG033Hipotiroidismo
039Hipotiroidismo
049Hipotiroidismo
052Neutropenia autoinmune

ICV: Inmunodeficiencia común variable, IHG Hipogammaglobulinemia

Como control negativo, se usó CVID022 ya que esta muestra siempre fue negativa para la expresión de LRBA (Figura 2A). Además, se evaluó la expresión de LRBA en células de sangre perférica ex-vivo y CMSP estimuladas y sin PHA por FACS (Figura S3). El LRBA exhibió una disminución de 2.3 veces en las células de pacientes ex vivo en comparación con las células DS. Por lo tanto, la reducción en la expresión de LRBA en linfocitos de CVID022 se observó no solo por WB sino también por FACS. Desafortunadamente, no fue posible evaluar la expresión de LRBA mediante citometría de flujo en los otros pacientes con disminución de la expresión de LRBA por WB. Se observaron resultados similares en CMSP sin estímulos de PHA. Sin embargo, el efecto fue más evidente en las CMSP estimuladas con PHA con una disminución de ocho veces en la expresión de LRBA en el paciente en comparación con una DS (Figura S3).
Figura S3

Expresión de LRBA en CMSP estimulada por PHA de CVID022 por FACS. Las células de sangre periférica ex-vivo y CMSP estimuladas sin PHA (1 μg / ml) se tiñeron intracelularmente con el anticuerpo anti-LRBA (HPA019366, Sigma) usando IgG de burro anti-conejo PE-F (ab) `2 como anticuerpo secundario. Las líneas punteadas indican la tinción solo con el anticuerpo secundario. Las líneas continuas representan la tinción con el anticuerpo anti-LRBA junto con el anticuerpo secundario. Se muestra la tinción de LRBA que activa solo las células CD3+. La línea roja representa la intensidad media de fluorescencia de LRBA (IMF) del experimento correspondiente en DS

Se observó una disminución de la expresión de LRBA en nueve lisados ​​de proteínas de CMSP estimuladas con PHA (Figura 2A, barras grises), pero solo se repitieron en ocho y se confirmaron en seis lisados ​​por obtención de una segunda muestra de sangre: dos pacientes con CVID (CVID22 y CVID024), dos pacientes con XLA (XLA012 y XLA014) y dos pacientes con hipogammaglobulinemia (IHG001 e IHG002) (Figura 2 flecha roja). Curiosamente, los pacientes con hipogammaglobulinemia son hermanos. Es importante mencionar que CVID027 es hermana de estos hermanos, sin embargo, no mostró disminución de la expresión de LRBA en CMSP (Figura 2A). No hubo diferencias en la expresión de LRBA por WB en células obtenidas de pacientes con las diferentes condiciones clínicas evaluadas en comparación con DS (media/DE de la intensidad de banda normalizada: DS: 0.86/0.25; CVID: 0.69/0.32; XLA: 0.86/0.47; IHG: 0.90/0.35; enteropatías: 1.10/0.31; ITP: 0.98/0.25 y SLE: 0.77/ 0.20). Curiosamente, se observó un aumento en la expresión de LRBA en siete pacientes (XLA001, XLA011, IHG003, IHG022, IHG022, IHG038, Entero003). La Figura 2B muestra las intensidades de banda de WB de LRBA en células estimuladas con PHA de pacientes con expresión disminuida de LRBA.

Fenotipo clínico de pacientes con expresión disminuida de LRBA

Las características clínicas de los pacientes se muestran en la Tabla 1. La paciente CVID022 es una mujer nacida a término en 1982, producto del primer embarazo de padres sanos no relacionados de Medellín (Antioquia-Colombia). Aunque no se documentaron antecedentes familiares de infecciones recurrentes, autoinmunidad o neoplasias hematológicas, los miembros de la familia describieron rinitis, bronquitis, diabetes tipo II, asma y enfermedad pulmonar obstructiva crónica.
Tabla 1

Resumen de las características clínicas de pacientes con disminución de la expresión de LRBA

PacienteEdad actualEdad del primer síntomaEdad de diagnósticoInfecciones recurrentesEnfermedades gastrointestinalesOtras manifestaciones clínicas
AlergiasAnemia
CVID022361013Amigdalitis, neumonía, otitis, sinusitis.Diarrea con moco (giardiasis y amebiasis), gastritis y pólipos duodenales.RinitisYes
CVID02419235Amigdalitis, neumonía, otitis, parotitis, celulitis periorbitaria, sinusitis.Apendicitis con sepsis abdominal, enfermedad del intestino irritable.Conjuntivitis, Rinitis-
XLA012711Infección del tracto urinario, otitis, aspergilosis*, síndrome bronquial crónico, sinusitis. Gastroenteritis aguda y enfermedad diarreica (Salmonelosis).-Yes
XLA014411Infecciones del tracto respiratorio superior, otitis, sinusitis.-Rinitis-
Hipo001 913Bronquiolitis, neumonía, otitis media, laringitis.Enfermedad por reflujo gastroesofágico grado IV, alergia alimentaria.Asma-
Hipo002 1114Otitis, amigdalitis.Infección gastrointestinal, diarrea, dolor abdominal crónico.--

*. Esta infección fue sistémica pero no recurrente.

*. Esta infección fue sistémica pero no recurrente. El paciente CVID024 es un hombre, nacido a término en 1998 de padres sanos no relacionados. Es el primer hijo y tiene un hermano más joven y saludable. Su padre es de Medellín y su madre de Bolívar (Antioquia-Colombia). Solo tenía antecedentes familiares de diabetes tipo II y asma en su abuela paterna. A los 8 años, se identificaron dos variantes en TACI en un patrón de herencia heterocigoto compuesto: una variante, c.121G> C (p.41D> H) en el exón 2 y la segunda variante c.297_299insT (p.Q99fsX6) en el exón 3. Sin embargo, ambas variantes también se identificaron en la madre y en el hermano del paciente, los cuales no están afectados, El padre portaba ambas variables tipo silvestre. El paciente XLA012 es un hombre, nacido por cesárea en 2010 de padres sanos no relacionados de Cúcuta (Norte de Santander, Colombia). Él también tiene una hermana mayor sana. La diabetes y la hipertensión se informaron en su abuela materna. También se documentó la historia familiar de un tío fallecido a la edad de 5 años debido a "edema". El diagnóstico genético de XLA se realizó a los 2 años con la detección de la mutación c.1573C> T p.Arg525X en Btk. Durante los cinco años de seguimiento, se ha documentado un síndrome bronquial crónico, anemia y sinusitis crónica. El paciente XLA014 es un hombre, nacido a término en 2013, producto del segundo embarazo de padres sanos no relacionados de Santa Rosa del Sur de Bolívar (Santander-Colombia). Su madre tuvo un aborto espontáneo previo y él también tiene un hermano menor saludable. Cáncer hematológico se informó en su abuela paterna. IHG001 es un hombre, nacido en 2008 en Medellín - Colombia de padres sanos no relacionados. Fue el producto del tercer embarazo, nacido prematuramente a las 34 semanas de gestación por cesárea con enfermedad de membrana hialina. Su padre sufría de rinitis alérgica y su abuela materna documentó asma e hipotiroidismo. También tiene un primo con hipotiroidismo. Su hermana (IHG002) nació en 2006. Ella fue el producto del segundo embarazo, nacido a las 36 semanas de gestación por cesárea. Estos hermanos tienen una hermana mayor (CVID027) con inmunoglobulinas séricas normales y expresión de LRBA en CMSP.

Fenotipo inmunológico en pacientes con disminución de la expresión de LRBA

Un análisis inmunológico de los diferentes subgrupos de linfocitos en sangre periférica de todos los pacientes con disminución de LRBA en CMSP no mostró una característica fenotípica común y distintiva (Tabla 2). Sin embargo, las características inmunológicas de los diferentes pacientes se confirmaron según el grupo de enfermedad. Todos los pacientes con ICV exhibieron una disminución de IgG e IgA en suero. Las subpoblaciones de linfocitos T en sangre periférica fueron normales en los pacientes con ICV. Se observó una disminución en los linfocitos B de memoria (IgD+ / CD27+) en ambos pacientes, sin embargo, solo CVID022 tuvo una disminución en los linfocitos B de memoria con cambio de isotipo (IgD- / CD27+). Con respecto a los pacientes con XLA, la disminución en los tres isotipos de Ig en suero se observó en XLA012, mientras que no se encontraron datos de inmunoglobulinas (Ig) en suero previos a la terapia de reemplazo de inmunoglobulina intravenosa (IVIG, del inglés intravenous immunoglobulin) para XLA14. Fue notorio el muy bajo número de linfocitos B de sangre periferica observadas en estos pacientes. Además, se observaron algunas alteraciones menores de los linfocitos T CD3+ en los pacientes con XLA. Curiosamente, los dos hermanos con IHG exhibieron un fenotipo inmunológico diferente. IHG001 exhibió niveles muy bajos de IgG e IgA en suero, mientras que IHG002 presentó solo una disminución de IgG en suero. Sin embargo, ambos exhibieron un aumento en la subpoblación de los linfocitos B de memoria (Tabla 2).
Tabla 2

Caracterización inmunológica de los pacientes con disminución de la expresión de LRBA en CMSP estimuladas con PHA

Pacientes
CVID022CVID024XLA012XLA014IHG001IHG002
Niveles de inmunoglobulinas (mg/dL)
IgG0.0↓ 19.2(111.8(ND6.4↓ 675.42↓
IgM5.7↓ 55.1↑ 53.1ND64.081.99
IgA2.1↓ 2.0↓ 5.2↓ ND<3.25↓ 72.23
LinfocitosPorcentajes/número absoluto(células/mm 3 )
CD3+ 64/1,16974/2,96390.5/2,222↑ 88/4,738↑ 64.4/2,65574.0/2,776
CD3+ CD4+ 44.8/52423.4/93756.7/1,393↑ 25.6/1,36635.2/1,45235.8/1,346
CD3+ CD8+ 52/60640.2/161027.4/67358.3/3111↑ 23.3/96131.8/1,196
CD19+ 8.21/147↓ 12.8/2300.67/16(0.1/3↓ 23.3/961↑ 17.6/660
CD19+/CD21+ 7.02/12511.0/1970.4/110.0/122.1/91416.1/606
CD19+CD27+ 14.75/22↓ 16.0/37----24.77/238↑ 30.6/202↑
IgD+/CD27- 77.2/113↑ 68.0/156----71.7/689↑ 63.6/420↓
IgD+/CD27+ 10.5/15↓ 5.9/14↓ ----15.1/145↑ 15.6/103↑
IgD-/CD27+ 4.3/6↓ 10.1/23----9.67/93↑ 15/99↑
IgD+/CD38+ 0.5/112.9/30----11.1/107--
IgD-/CD38++ 0.0/0↓ 3.3/2.1----0.93/9↑ 1.53/10
CD24++/CD38++0.5/1↓ 12.8/29----11.0/10613/86

Ig: inmunoglobulina, ND: sin datos. Las flechas hacia abajo indican disminución y las flechas hacia arriba con respecto al valor de referencia.

Ig: inmunoglobulina, ND: sin datos. Las flechas hacia abajo indican disminución y las flechas hacia arriba con respecto al valor de referencia.

Variantes de LRBA en los pacientes con disminución de la expresión de LRBA

WES se realizó en los pacientes con disminución de la expresión de LRBA. En general, se identificaron dieciocho variantes no sinónimas en exones o intrónes en LRBA, en estos pacientes (Tabla 3). Se encontraron cinco variantes con una frecuencia de población <1% (Tabla 3, barras grises), de las cuales, dos variantes, rs148385798 en el paciente CVID022 y el rs950337550 en el paciente CVID024 fueron posiblemente patógenas (Tabla 3, recuadro rojo). La variante rs148385798 es un cambio sin sentido heterocigoto c.T194C en el exón 2 que corresponde al cambio p.I65T en el dominio ConA de la proteína. El análisis in silico predijo ser "perjudicial" con SIFT (puntuación: 0.02); "Causante de enfermedad" con MutationTaster (valor p: 0.995) y "perjudicial" en PROVEAN (puntaje: -2.558) y el puntaje CADD fue 16.37. La segunda variante rs950337550 es una variante sin sentido heterocigota c.6892A> G en el exón 46 que confiere un cambio p.K2298E en el dominio BEACH. El análisis en silco predijo que sería "perjudicial" con SIFT (puntuación: 0.005); "Causante de enfermedad" con MutationTaster (valor p: 1) y "No perjudicial" con PROVEAN (puntaje: -1.44).
Tabla 3

Variantes de LRBA en los pacientes con disminución de la expresión de LRBA en CMSP estimuladas con PHA

Pacientes LocalizaciónRefAltExons/intronsSNPAlelosFrec*
CVID022151199080GAExonrs2290846het0.15
151207127CTExonrs3749574het0.16
151242312CTIntronrs11737450het0.18
151753134A-Intronrs145452262het0.062
151765243GAIntronrs186080hom0.75
151935601AGExonrs148385798het0.002
151408800TCIntronrs7674989hom0.2
151656589CTIntronrs1993109het0.4
151829659TCIntronrs1201207hom0.04
151773593GCExonrs1782360hom0.29
XLA12151207127CTExonrs3749574het0.16
151236393AGIntronrs74459799het0.0062
151242312CTIntronrs11737450het0.18
151357938GAExonrs950337550het0.000008
151765243GAIntronrs186080hom0.75
151817507CTIntronrs1813134het0.011
XLA14151765243GAIntronrs115139393hom0.75
151829659TC-Intron151829659hom0.96
151231371TCIntronrs1813134het0.52
151187011-GAGATIntronrs201486611het0.69
IHG001 IHG002151231371TCIntronrs1813134hom0.52
151235987GAIntron--het--
151753134A-Intronrs145452262het0.062
151762104GAIntronrs893110507het0.00004
151765243GAIntron rs186080het0.75

Ref: alelo de referencia, Alt: alelo alterado, SNP: polimorfismo de un solo nucleótido, Frec*: frecuencia, hom: homocigoto, het: heterocigoto. En gris se destacan las variantes con una frecuencia <0.001 en el proyecto 1,000 genomes (http://www.internationalgenome.org). Las variables indicadas en rojo son patógenas o posiblemente patógenas según los predictores en silico.

Ref: alelo de referencia, Alt: alelo alterado, SNP: polimorfismo de un solo nucleótido, Frec*: frecuencia, hom: homocigoto, het: heterocigoto. En gris se destacan las variantes con una frecuencia <0.001 en el proyecto 1,000 genomes (http://www.internationalgenome.org). Las variables indicadas en rojo son patógenas o posiblemente patógenas según los predictores en silico. Teniendo en cuenta que el patrón de herencia LRBA es autosómico recesivo y que no habíamos encontrado variantes bialélicas, continuamos con el análisis de variantes en otros genes involucrados en el sistema inmune.

Otras variantes relevantes encontradas secuenciación del exoma completo (WES- Whole-Exome Sequencing)

Se identificaron 50,300 variantes de alta calidad en el exoma CVID022. Entre ellos, 17,056 fueron homocigotos y 33,244 heterocigotos (Tabla 4). Las variantes en los genes IDP se analizaron primero y se encontraron variantes homocigóticas en tres genes (PLCG2, POLE, RLTPR). Sin embargo, estas variantes se localizaron en regiones intrónicas, muy distantes del exón proximal. Para proceder con el análisis de WES, siguiendo la hipótesis de un estado de herencia recesivo, se seleccionaron variantes homocigóticas o heterocigotas compuestas. Estas variantes deben cumplir también los criterios definidos. Se seleccionaron tres genes candidatos (KCNN3, TRPM3, ECT2L), sin embargo, KCNN3 y TRPM3 no se expresan en los tejidos linfoides. Además, el padre del paciente también portaba ambas variantes en ECT2L. Finalmente, evaluamos las variantes heterocigotas de novo. Se encontró una variante en la proteína L3 mitocondrial ribosómica (MRL3). Las enfermedades asociadas con MRPL3 incluyen la Deficiencia combinada de fosforilación oxidativa 9 . sin embargo, esta es una condición severa que afecta principalmente la función neurológica y hepática.
Tabla 4

Resumen de resultados de secuenciación de exoma completo en pacientes con disminución de la expresión de LRBA

VariantesCVID022XLA012XLA014IHG001IHG002
Número total 50,30053,00252,82153,21553,215
Número de homocigotos17,05614,78515,01514,65414,654
Número de heterocigotos33,24420,73120,53021,35221,352
Genes relacionados con IDPPLCG2, POLE, RLTPRBTKBTK---
Variantes candidatas homocigotas KCNN3, TRPM3------PLCL2, FDFT1, GPRIN2
Variantes candidatas heterocigotosECT2L------ SEC22B
En XLA12, se identificaron 53,002 variantes, 14,785 homocigotas y 20,730 heterocigotas (Tabla 4). Dentro de los genes IDP, se identificaron 27 variantes. Entre ellos, se confirmó la variante c.1573C> T p.Arg525X en BTK. En otros genes, no se encontraron variantes candidatas patogénicas potenciales. En XLA14, se identificaron 52,821 variantes de alta calidad en el exoma, 15,015 fueron homocigóticas y 20,530 heterocigotas (Tabla 4). Dentro de los genes relacionados con IDP, se encontraron 40 variantes y se identificó una variante potencialmente patógena en el gen BTK. Esto corresponde a c.622 + 1G> A (NM_001287344). 3. El análisis in silico (fruit fly y NetGene2) mostró que los efectos de la mutación BTK confieren un cambio en el sitio donante de empalme al final del intrón 6 dentro de este gen que afecta a la proteína en el dominio PH. En los hermanos IHG001 e IHG002, se encontraron un total de 53,215 variantes en ambos. Los números de variantes homocigotos y heterocigotos se especifican en la Tabla 4. Sin embargo, no se identificaron heterocigotos homocigotos o compuestos comunes en los genes IDP. Sin embargo, las variantes homocigotas en PLCL2, FDFT1 y GPRIN2, su padre tenía las mismas variantes homocigotas en PLCL2 y FDFT1 y su madre tenía las mismas variantes homocigotas en GPRIN2. Además, se encontraron variantes heterocigóticas compuestas en SEC22B, sin embargo, su padre portaba las mismas variantes.

Discusión

En este trabajo, se evaluó la expresión de LRBA en 112 pacientes con manifestaciones clínicas asociadas con deficiencia de LRBA. Se observó concordancia interindividual e intraindividual en la detección de la expresión de LRBA en CMSP estimuladas con PHA. La expresión de LRBA detectada por WB fue muy heterogénea en DS. Gamez et al informaron que esta heterogeneidad también se encontró en FACS un rango de IMF entre 2.14 -10.00 (min - max) en la expresión relativa de LRBA en CMSP tras la estimulación con PHA durante cuatro días en DS . Entre estos pacientes, se observó una disminución de la expresión de LRBA en nueve lisados ​​de proteínas de pacientes, después de repetidos, solo se observó una disminución en seis lisados ​​de proteínas de pacientes. Todavía no sabemos por qué las células de algunos pacientes exhibieron niveles discordantes de expresión de LRBA en diferentes muestras de sangre y puntos de tiempo. Una posible explicación de estos resultados es una senescencia celular activada por el sistema inmune. Diferentes factores como las infecciones virales persistentes, el estrés y los síndromes inflamatorios inducen la acumulación de linfocitos T con características de senescencia . Es posible que estos pacientes hayan pasado por períodos de estrés o infección con la consecuencia de una senescencia inducida y alteraciones en la proliferación de las células. Dado que la detección de la expresión de LRBA en CMSP en nuestros entornos es un fenómeno dependiente de la activación, disminuir la activación de las células senescentes podría conducir a una disminución en la expresión de LRBA detectada por las células inmunes. Sin embargo, un marcador de activación, como CD69, debe incluirse en los controles de tinción en los estudios futuros. Por otro lado, también se observó un aumento en la expresión de LRBA en siete pacientes. Hasta la fecha, no se ha informado sobreexpresión de este gen asociado con alguna IDP, sin embargo, Wang et al. en 2004 informó por micromatrices y análisis de PCR en tiempo real que LRBA se sobreexpresa en varios tipos de cáncer en relación con sus controles de tejido normales . Además, la expresión de la activación celular debió haber sido monitoreada en las células de nuestros pacientes, ya que se ha demostrado previamente que la expresión de LRBA aumenta con la activación celular 4. Esto podría afirmarse como una de las limitaciones de nuestros resultados, ya que la disminución de la expresión de LRBA por WB podría haber sido causada por una pobre activación de las células inmunes. Sin embargo, siempre tuvimos una limitación de muestra debido a la enorme cantidad de proteína requerida para realizar el WB. Además, no ha habido correlación entre la intensidad de la expresión de LRBA por citometría de flujo y el índice de proliferación en linfocitos B en donantes sanos (datos no mostrados). Por otro lado, los pacientes con escasa proliferación de células T y B incluidas en esta cohorte, exhibieron una expresión de LRBA normal por WB (datos no mostrados). Los pacientes con disminución de la expresión de LRBA exhibieron diferentes características fenotípicas e inmunológicas. Sin embargo, todos los pacientes presentaron una reducción en IgG e infecciones recurrentes y todos excepto uno presentaron gastropatía. No encontramos variantes bialélicas patógenas o potencialmente patógenas ni en LRBA ni en otros genes relacionados con el sistema inmune. La expresión de LRBA en CMSP puede disminuir debido a mecanismos epigenéticos . Los mecanismos epigenéticos determinan el fenotipo sin cambios en el genotipo, que operan a nivel transcripcional y postranscripcional de la actividad génica, así como a nivel de traducción de proteínas y modificaciones postraduccionales. Participan en procesos como la diferenciación celular, la morfogénesis, la variabilidad y la adaptabilidad de un organismo y pueden verse afectados por factores genéticos y ambientales . Además, se han propuesto cambios epigenéticos pueden contribuir a la patogénesis de ICV. Rodríguez-Cortez et al demostraron mediante análisis de metilación de ADN de alto rendimiento, en gemelos monocigóticos discordantes para ICV, ganancia predominante de metilación de ADN en linfocitos B en los pacientes con ICV con respecto a los de los hermanos sanos . En conjunto, se requiere la aplicación de estudios epigenéticos para identificar y caracterizar no solo las firmas moleculares de la deficiencia de LRBA, así como los mecanismos subyacentes a la patogénesis de la enfermedad y las respuestas a las nuevas modalidades terapéuticas. Otra posible explicación de la disminución en la expresión de LRBA en CMSP estimulada por PHA de pacientes sin mutaciones en LRBA u otros genes por WES, sería la presencia de mutaciones patógenas en elementos reguladores, incluidos promotores, potenciadores, aisladores y silenciadores en LRBA. Cualquier variante que se encuentre dentro de una región genómica funcional tiene la capacidad potencial de causar una disregulación en la expresión génica a través de la modificación de elementos reguladores, posiblemente resultando en la patogénesis de enfermedades . En los últimos años, los estudios de asociación de todo el genoma (GWAS) identificaron más de diez mil variantes asociadas con diversas enfermedades/rasgos, ~ 90% de los cuales se localizan fuera de las regiones de codificación de proteínas conocidas . Además se requieren estudios futuros para evaluar la variación en el número de copias y la tasa de cobertura de cada exón en LRBA, para excluir una segunda variante heterocigótica en pacientes con alta sospecha clínica de deficiencia de LRBA. En el presente estudio, no se encontraron variables con significancia clínica en LRBA, luego, continuamos con el análisis de variables en otros genes en todo el exoma. Se encontró una nueva variante (c.622 + 1G> A NM_001287344) en BTK que probablemente confiere una pérdida en el sitio donante de empalme al final del intrón 6 en el paciente XLA14. Cuando un sitio de splicing natural se elimina por mutaciones, el splicesosoma suele utilizar el siguiente sitio legitimo disponible para el splicing (omisión de exón) o selecciona el siguiente mejor, aunque ilegítimo, sitio de splicing cercano (utilización críptica del splicing) . En este caso específico, la transcripción de ARNm podría estar afectada después del exón 6, afectando la proteína del aminoácido 25 y generando una nueva proteína truncada. Los ARNm aberrantes podrían eliminarse mediante la vía de degradación del ARN mensajero mediada por mutación terminadora, que se dirige a los ARNm que albergan codones de terminación prematura para la degradación . Por lo tanto, la proteína truncada podría no contener los dominios PH, SH3, SH2 y quinasa de la proteína y, por lo tanto, podría no ser funcional o estar sujeta a degradación por la vía Ubiquitina-Proteasoma. Sin embargo, el efecto exacto de la mutación debe verificarse en estudios funcionales. En conjunto, los resultados de este estudio indican que la expresión de LRBA varía mucho en las CMSP entre diferentes DS y pacientes. A pesar de la gran variabilidad en la expresión de LRBA en las diferentes muestras, seis pacientes exhibieron una disminución de la expresión de esta proteína por WB en CMSP estimulada por PHA. No se detectaron genes asociados con la producción defectuosa de LRBA por estas células en estos pacientes. Las mutaciones homocigotas en LRBA causan deficiencia de LRBA que afecta la expresión de la proteína. Sin embargo, la reducción de la expresión de LRBA en pacientes sin mutaciones homocigotas o en genes asociados estaba presente. Estos resultados sugieren los otros mecanismos genéticos, epigenéticos o ambientales, podrían estar regulando la expresión de LRBA. La especificidad de la detección de LRBA por WB y FACS se evaluó previamente. Se demostró una correlación positiva entre la capacidad de WB y FACS para detectar LRBA. También se realizaron experimentos FACS utilizando epítopos competitivos para validar la especificidad del reconocimiento de LRBA. Con estos resultados, demostramos que los anticuerpos mostraron una unión específica al LRBA intracelular que se perdió al agregar un péptido de bloqueo de LRBA específico de una manera dependiente de la dosis.
1) Why was this study done?
LRBA deficiency patients exhibit a clinically heterogeneous syndrome. The main clinical complication of LRBA deficiency is immune dysregulation. Enteropathy, autoimmune hemolytic anemia and idiopathic thrombocytopenic purpura are the most common clinical manifestation. In more than half of patients are at low levels: IgM and IgG or IgA and IgG, IgA only or IgG only. To date, no patients with this condition have been reported in Colombia. Was evaluated of mutations in LRBA in patients from Colombia with predominantly antibody deficiencies such as CVID, XLA, IHG and SIgAD, autoimmune manifestations such as ITP and SLE and/or enteropathies and determine if the cause of the clinical phenotype in these patients is mutations in LRBA or are other genes responsible for the pathogenesis
2) What did the researchers do and find?
Six (n= 112) patients showed decreased in LRBA protein expression. We observed a reduction in two patients with CVID, two with XLA and in two with IHG. These patients exhibit different phenotypic and immunologic characteristic. However, all patients presented with a reduction in IgG and recurrent infections by otitis and sinusitis, and five presented with gastropathy. We didn’t find pathogenic or potentially pathogenic variants neither in LRBA nor in other immune-related genes.
3) What do these findings mean?
The expression of LRBA identifies a lot in the CMSP between different DS and patients. Six patients exhibited a decrease in the expression of this protein. No genes associated with defective LRBA production by these cells were detected in these patients. Homozygous mutations in LRBA cause deficiency that affects protein expression. However, reduced LRBA expression in patients without homozygous mutations or in associated genes were present. These results detect the other genetic mechanisms, epigenetic or environmental, may be regulating the expression of LRBA.
1) Por que se hizo este estudio?
Los pacientes con deficiencia de LRBA exhiben un síndrome heterogéneo clínico, donde la principal complicación clínica es la desregulación inmune. La enteropatía, la anemia hemolítica autoinmune y púrpura trombocitopénica idiopática son las manifestaciones más comunes. Se encuentra en más de la mitad de los pacientes niveles reducidos de IgM e IgG o de IgA e IgG, de IgA solamente o de IgG. Hasta la fecha, no se han reportado pacientes con esta afección en Colombia. Se evaluaron mutaciones en LRBA en pacientes de Colombia con predominantemente deficiencias de anticuerpos como CVID, XLA, IHG y SIgAD, manifestaciones autoinmunes como ITP y SLE y/o enteropatías.
2) Cuales fueron los resultados mas relevantes?
Seis pacientes (n= 112) mostraron disminución en la expresión de la proteína LRBA. Una reducción en la expresión de LRBA en dos pacientes con CVID, dos con XLA y en dos con IHG. Estos pacientes exhiben diferentes características fenotípicas e inmunológicas. Todos los pacientes presentaron una reducción en IgG e infecciones recurrentes como otitis y sinusitis, y cinco presentaron gastropatía. No encontramos variantes patogénicas o potencialmente patogénicas ni en LRBA ni en otros genes relacionados con el sistema inmune.
3) Que significan los hallazgos?
La expresión de LRBA varía mucho en las CMSP entre diferentes DS y pacientes. Seis pacientes exhibieron una disminución de la expresión de esta proteína. No se detectaron genes asociados con la producción defectuosa de LRBA por estas células en estos pacientes. Las mutaciones homocigotas en LRBA causan deficiencia de LRBA que afecta la expresión de la proteína. Sin embargo, la reducción de la expresión de LRBA en pacientes sin mutaciones homocigotas o en genes asociados estaban presentes. Estos resultados sugieren los otros mecanismos genéticos, epigenéticos o ambientales, podrían estar regulando la expresión de LRBA.
  16 in total

Review 1.  Implication of abnormal epigenetic patterns for human diseases.

Authors:  C B Santos-Rebouças; M M G Pimentel
Journal:  Eur J Hum Genet       Date:  2006-10-18       Impact factor: 4.246

2.  Neurobeachin: A protein kinase A-anchoring, beige/Chediak-higashi protein homolog implicated in neuronal membrane traffic.

Authors:  X Wang; F W Herberg; M M Laue; C Wullner; B Hu; E Petrasch-Parwez; M W Kilimann
Journal:  J Neurosci       Date:  2000-12-01       Impact factor: 6.167

3.  Disease-associated variants in different categories of disease located in distinct regulatory elements.

Authors:  Meng Ma; Ying Ru; Ling-Shiang Chuang; Nai-Yun Hsu; Li-Song Shi; Jörg Hakenberg; Wei-Yi Cheng; Andrew Uzilov; Wei Ding; Benjamin S Glicksberg; Rong Chen
Journal:  BMC Genomics       Date:  2015-06-18       Impact factor: 3.969

4.  Primary immunodeficiency diseases worldwide: more common than generally thought.

Authors:  Ahmed Aziz Bousfiha; Leïla Jeddane; Fatima Ailal; Ibtihal Benhsaien; Nizar Mahlaoui; Jean-Laurent Casanova; Laurent Abel
Journal:  J Clin Immunol       Date:  2012-07-31       Impact factor: 8.317

5.  Deregulated expression of LRBA facilitates cancer cell growth.

Authors:  Jia-Wang Wang; Joshua J Gamsby; Steven L Highfill; Linda B Mora; Gregory C Bloom; Tim J Yeatman; Tien-chi Pan; Anna L Ramne; Lewis A Chodosh; W Douglas Cress; Jiandong Chen; William G Kerr
Journal:  Oncogene       Date:  2004-05-20       Impact factor: 9.867

6.  The extended phenotype of LPS-responsive beige-like anchor protein (LRBA) deficiency.

Authors:  Laura Gámez-Díaz; Dietrich August; Polina Stepensky; Shoshana Revel-Vilk; Markus G Seidel; Mitsuiki Noriko; Tomohiro Morio; Austen J J Worth; Jacob Blessing; Frank Van de Veerdonk; Tobias Feuchtinger; Maria Kanariou; Annette Schmitt-Graeff; Sophie Jung; Suranjith Seneviratne; Siobhan Burns; Bernd H Belohradsky; Nima Rezaei; Shahrzad Bakhtiar; Carsten Speckmann; Michael Jordan; Bodo Grimbacher
Journal:  J Allergy Clin Immunol       Date:  2016-01       Impact factor: 10.793

7.  Reversible senescence in human CD4+CD45RA+CD27- memory T cells.

Authors:  Diletta Di Mitri; Rita I Azevedo; Sian M Henson; Valentina Libri; Natalie E Riddell; Richard Macaulay; David Kipling; Maria V D Soares; Luca Battistini; Arne N Akbar
Journal:  J Immunol       Date:  2011-07-25       Impact factor: 5.422

8.  Monozygotic twins discordant for common variable immunodeficiency reveal impaired DNA demethylation during naïve-to-memory B-cell transition.

Authors:  Virginia C Rodríguez-Cortez; Lucia Del Pino-Molina; Javier Rodríguez-Ubreva; Laura Ciudad; David Gómez-Cabrero; Carlos Company; José M Urquiza; Jesper Tegnér; Carlos Rodríguez-Gallego; Eduardo López-Granados; Esteban Ballestar
Journal:  Nat Commun       Date:  2015-06-17       Impact factor: 14.919

9.  Deleterious mutations in LRBA are associated with a syndrome of immune deficiency and autoimmunity.

Authors:  Gabriela Lopez-Herrera; Giacomo Tampella; Qiang Pan-Hammarström; Peer Herholz; Claudia M Trujillo-Vargas; Kanchan Phadwal; Anna Katharina Simon; Michel Moutschen; Amos Etzioni; Adi Mory; Izhak Srugo; Doron Melamed; Kjell Hultenby; Chonghai Liu; Manuela Baronio; Massimiliano Vitali; Pierre Philippet; Vinciane Dideberg; Asghar Aghamohammadi; Nima Rezaei; Victoria Enright; Likun Du; Ulrich Salzer; Hermann Eibel; Dietmar Pfeifer; Hendrik Veelken; Hans Stauss; Vassilios Lougaris; Alessandro Plebani; E Michael Gertz; Alejandro A Schäffer; Lennart Hammarström; Bodo Grimbacher
Journal:  Am J Hum Genet       Date:  2012-05-17       Impact factor: 11.025

10.  A survey of tools for variant analysis of next-generation genome sequencing data.

Authors:  Stephan Pabinger; Andreas Dander; Maria Fischer; Rene Snajder; Michael Sperk; Mirjana Efremova; Birgit Krabichler; Michael R Speicher; Johannes Zschocke; Zlatko Trajanoski
Journal:  Brief Bioinform       Date:  2013-01-21       Impact factor: 11.622
View more
  1 in total

Review 1.  Comprehensive comparison between 222 CTLA-4 haploinsufficiency and 212 LRBA deficiency patients: a systematic review.

Authors:  M Jamee; S Hosseinzadeh; N Sharifinejad; M Zaki-Dizaji; M Matloubi; M Hasani; S Baris; M Alsabbagh; B Lo; G Azizi
Journal:  Clin Exp Immunol       Date:  2021-05-03       Impact factor: 5.732
  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.