Literature DB >> 32025382

Light-harvesting chlorophyll a/b-binding protein-coding genes in jatropha and the comparison with castor, cassava and arabidopsis.

Yongguo Zhao1,2, Hua Kong2, Yunling Guo2, Zhi Zou2.   

Abstract

The Lhc (light-harvesting chlorophyll a/b-binding protein) superfamily represents a class of antennae proteins that play indispensable roles in capture of solar energy as well as photoprotection under stress conditions. Despite their importance, little information has been available beyond model plants. In this study, we presents a first genome-wide analysis of Lhc superfamily genes in jatropha (Jatropha curcas L., Euphorbiaceae), an oil-bearing plant for biodiesel purpose. A total of 27 members were identified from the jatropha genome, which were shown to distribute over nine out of the 11 chromosomes. The superfamily number is comparable to 28 present in castor (Ricinus communis, Euphorbiaceae), but relatively less than 35 in cassava (Manihot esculenta, Euphorbiaceae) and 34 in arabidopsis (Arabidopsis thaliana) that experienced one or two recent whole-genome duplications (WGDs), respectively. In contrast to a high number of paralogs present in cassava and arabidopsis, few duplicates were found in jatropha as observed in castor, corresponding to no recent WGD occurred in these two species. Nevertheless, 26 orthologous groups representing four defined families were found in jatropha, and nearly one-to-one orthologous relationship was observed between jatropha and castor. By contrast, a novel group named SEP6 was shown to have been lost in arabidopsis. Global transcriptome profiling revealed a predominant expression pattern of most JcLhc superfamily genes in green tissues, reflecting their key roles in photosynthesis. Moreover, their expression profiles upon hormones, drought, and salt stresses were also investigated. These findings not only improve our knowledge on species-specific evolution of the Lhc supergene family, but also provide valuable information for further studies in jatropha. ©2020 Zhao et al.

Entities:  

Keywords:  Evolution; Harvesting chlorophyll a/b-binding protein; Lhc superfamily; Synteny analysis; Arabidopsis thaliana; Expression profile; Jatropha curcas; Manihot esculenta; Ricinus communis; Whole-genome duplication

Year:  2020        PMID: 32025382      PMCID: PMC6993755          DOI: 10.7717/peerj.8465

Source DB:  PubMed          Journal:  PeerJ        ISSN: 2167-8359            Impact factor:   2.984


Introduction

Light-harvesting chlorophyll a/b-binding protein (Lhc) superfamily, defined by the presence of a conserved chlorophyll-binding (CB) domain in the transmembrane alpha-helix, is composed of four distinct nuclear-encoded antennae protein families in green plants, i.e., Lhc, Lil (light-harvesting-like), PsbS (photosystem II subunit S), and FCII (ferrochelatase II) (Klimmek et al., 2006; Zou & Yang, 2019a). In contrast to an orphan group present in both PsbS and FCII families, the Lhc family, initially known as CAB (chlorophyll a/b-binding protein), contains two evolutionary groups named Lhca and Lhcb that are associated with photosystem I or II (PSI/II), respectively (Jansson, 1999; Klimmek et al., 2006). The Lil family includes four diverse subfamilies, i.e., OHP (one-helix protein), SEP (stress-enhanced protein), Lil1 or ELIP (early light-induced protein), and Lil8 or Psb33 (photosystem II protein 33) (Engelken, Brinkmann & Adamska, 2010; Zou, 2018). Among them, OHP and SEP can be further divided into several groups: the OHP subfamily includes two groups named OHP1/Lil2 and OHP2/Lil6, whereas the SEP subfamily contains six groups, i.e., SEP1/Lil4, SEP2/Lil5, SEP3/Lil3, SEP4, SEP5, and SEP6 (Engelken, Brinkmann & Adamska, 2010; Zou & Yang, 2019a). Investigation of their origin suggested that OHP is more primitive, which is more likely to result from the plastid-encoded HLIP (high light-induced protein) via gene transfer after the primary endosymbiosis (Koziol et al., 2007; Engelken, Brinkmann & Adamska, 2010). In addition to light harvesting and transport, growing evidence shows that Lhc superfamily members are also involved in regulation and distribution of excitation energy between PSI and PSII, maintenance of thylakoid membrane structure, photoprotection as well as response to various stresses (Pan et al., 2011; Fan et al., 2015; Fristedt et al., 2015; Hey et al., 2017; Myouga et al., 2018). Jatropha curcas L. (2n = 22), commonly known as jatropha, physic nut, barbados nut, or purging nut, is a perennial large shrub or small tree (Mazumdar et al., 2018; Zou et al., 2016; Zou et al., 2018). Jatropha belongs to the Euphorbiaceae family, which also includes castor (also known as castor bean, Ricinus communis L.) and cassava (Manihot esculenta Crantz) and is characterized with high photosynthesis and high biomass (Zou et al., 2018; Zou & Yang, 2019a; Zou & Yang, 2019b). As a potential non-edible energy crop, jatropha produces high level of fossil fuel-like oil in its seeds, which can be easily processed into biodiesel (Fairless, 2007; Berchmans & Hirata, 2008; Kumar & Sharma, 2008; Maghuly & Laimer, 2013). Additionally, this species also has several unique characteristics like easy propagation, rapid growth, and adaptation to semiarid and barren soil environments (Montes & Melchinger, 2016). Although originated from Mesoamerica, jatropha can now be widely found in many tropical and subtropical countries of Africa and Asia (Wu et al., 2015; Li et al., 2017). Nevertheless, its commercial cultivation has failed mainly due to low productivity (Montes & Melchinger, 2016; Mazumdar et al., 2018). Thereby, uncovering the molecular mechanism underlying and characterization of genes involved in yield formation are prerequisites. In this study, we would like to present a first genome-wide analysis of the Lhc supergene family in jatropha, including gene structures, chromosome (Chr) locations, evolutionary relationships, sequence characteristics, global expression profiles as well as comprehensive comparison with arabidopsis, cassava, and castor. These results will not only improve our knowledge on species-specific evolution of the Lhc supergene family, but also provide valuable information for further functional analysis in jatropha.

Materials & Methods

Identification of Lhc superfamily genes

As shown in Table S1, 34 AtLhc superfamily genes were retrieved from TAIR (https://www.arabidopsis.org/, Araport11) according to previous literatures. To facilitate evolutionary analysis, 28 and 35 superfamily members present in castor and cassava (see Table S1), two Euphorbiaceous plants, were also obtained from Phytozome (Version 12, https://phytozome.jgi.doe.gov/pz/portal.html). Homologs present in the jatropha genome (Wu et al., 2015) were identified via the tBLASTn (Altschul et al., 1997; E-value, 1e–5) search by using above protein sequences as queries. Gene models of candidates were revised via aligning mRNA to loci-encoding scaffolds. Presence of the conserved CB domain (PF00504) was checked using MOTIF Search (https://www.genome.jp/tools/motif/), and exon-intron structures were displayed using Gene Structure Display Server (GSDS 2.0, https://gsds.cbi.pku.edu.cn/). Putative transmembrane helix (TMH) was predicted using CCTOP (http://cctop.enzim.ttk.mta.hu/) as well as sequence alignment. Chloroplast transit peptide (TP) of deduced proteins and biochemical parameters of mature peptides were determined using ChloroP (Version 1.1, https://www.cbs.dtu.dk/services/ChloroP/) and ProtParam (https://web.expasy.org/protparam/), respectively.

Chromosome location and synteny analysis

Gene distribution on chromosomes was analyzed using MAPchart 2.3 (Voorrips, 2002). For synteny analysis, the all-to-all BLASTP method was used to identify duplicate pairs, and MicroSyn (Cai et al., 2011) was used to detect microsynteny. Orthologs across different species were inferred from the best-reciprocal-hit (BRH)-based BLAST analysis as well as synteny analysis for jatropha and castor.

Sequence alignment, phylogenetic, and conserved motif analyses

Multiple sequence alignment was carried out using MUSCLE (Edgar, 2004). Phylogenetic tree construction was performed using MEGA7 (Kumar, Stecher & Tamura, 2016) with the maximum likelihood method (bootstrap: 1,000). Conserved motifs were identified using MEME (https://meme-suite.org/tools/meme): any number of repetitions; maximum number of motifs, 25; minimum sites, 2; and, the optimum width of each motif, between 6 and 100 residues.

Gene expression analysis

Transcriptome datasets used for expression profiling are shown in Table S2. Except for tissue-specific transcriptomes, other samples were performed for at least two biological replicates. Quality control of raw reads was carried out using fastQC (https://www. bioinformatics.babraham.ac.uk/projects/fastqc/). Read mapping were performed using Bowtie 2 (Langmead & Salzberg, 2012), and the relative transcript level of each gene was presented as FPKM (fragments per kilobase of exon per million fragments mapped, for pair-ended samples) or RPKM (Reads per kilobase per million mapped reads, for single-ended samples) (Mortazavi et al., 2008). RSEM (v1.2.27) (Li & Dewey, 2011) with parameters “log2Ratio ≥ 1” and “FDR <0.001” were used to determine differentially expressed genes.

Results

Identification and chromosome locations of 27 Lhc superfamily genes in jatropha

The BLAST search resulted in 27 JcLhc superfamily genes from the jatropha genome (Wu et al., 2015), which represent four previously defined families (i.e., Lhc, Lil, PsbS, and FCII) or eight subfamilies (i.e., Lhca, Lhcb, PsbS, OHP, SEP, ELIP, Psb33, and FCII). Each subfamily contains one to nine members that were named after their orthologs in castor (see below), i.e., JcLhca1–6, JcLhcb1.1–1.2, JcLhcb2–8, JcPsbS, JcELIP, JcOHP1–2, JcSEP1–6, JcPsb33, and JcFCII, respectively. These genes were shown to distribute over 25 scaffolds. Although most scaffolds contain a single member, two of them harbor two, i.e., scaffold160 (i.e., JcLhcb1.1 and JcLhcb1.2) and scaffold211 (i.e., JcLhca6 and JcSEP5) (Table 1). With the help of 1,208 available genetic markers, these genes were further anchored to nine chromosomes, and the gene number of each chromosome varies from one to five (Fig. 1).
Table 1

27 Lhc superfamily genes identified in jatropha.

SubfamilyGene nameLocus IDScaffold positionNucleotide length (bp, from start to stop codons)Intron no.EST no.AATP lengthTMHOrthologOG
CDSGeneRcMeAt
LhcaJcLhca1JCGZ_23938scaffold794:74368-75803(−)7381,07630245453RcLhca1MeLhca1.1 MeLhca1.2AtLhca1Lhca1
JcLhca2JCGZ_17961scaffold502:3176588-3178724(+)8131,49141270583RcLhca2MeLhca2.1 MeLhca2.2AtLhca2Lhca2
JcLhca3JCGZ_15032scaffold42:178242-179765(−)8161,17128271383RcLhca3MeLhca3AtLhca3Lhca3
JcLhca4JCGZ_11643scaffold328:2197266-2195814(−)75091722249483RcLhca4MeLhca4.1 MeLhca4.2AtLhca4Lhca4
JcLhca5JCGZ_04265scaffold159:84206-85704(+)7951,25550264573RcLhca5MeLhca5AtLhca5Lhca5
JcLhca6JCGZ_07509scaffold211:3089530-3091440(−)7921,61240263423RcLhca6MeLhca6AtLhca6Lhca6
LhcbJcLhcb1.1JCGZ_04588scaffold160:101030-101541(+)798798028265353RcLhcb1.1 RcLhcb1.2 RcLhcb1.3MeLhcb1.1 MeLhcb1.2 MeLhcb1.3AtLhcb1.1 AtLhcb1.2 AtLhcb1.3 AtLhcb1.4 AtLhcb1.5Lhcb1
JcLhcb1.2JCGZ_04587scaffold160:97668-99902(−)798798017265353RcLhcb1.1 RcLhcb1.2 RcLhcb1.3MeLhcb1.1 MeLhcb1.2 MeLhcb1.3AtLhcb1.1 AtLhcb1.2 AtLhcb1.3 AtLhcb1.4 AtLhcb1.5Lhcb1
JcLhcb2JCGZ_18481scaffold529:239615-242657(−)7982,225110265373RcLhcb2MeLhcb2.1 MeLhcb2.2AtLhcb2.1 AtLhcb2.2 AtLhcb2.3Lhcb2
JcLhcb3JCGZ_00703scaffold108:360030-361580(−)8041,20225267443RcLhcb3MeLhcb3AtLhcb3Lhcb3
JcLhcb4JCGZ_25025scaffold843:295347-296708(+)85895718285313RcLhcb4MeLhcb4AtLhcb4.1 AtLhcb4.2Lhcb4
JcLhcb8JCGZ_01281scaffold11:738853-741122(+)8401,78610279313RcLhcb8MeLhcb8AtLhcb8Lhcb8
JcLhcb5JCGZ_06701scaffold200:160436-162429(−)8761,57351291413RcLhcb5MeLhcb5AtLhcb5Lhcb5
JcLhcb6JCGZ_20203scaffold645:375633-376811(+)76584411254493RcLhcb6MeLhcb6AtLhcb6Lhcb6
JcLhcb7JCGZ_08016scaffold221:188978-192485(−)1,0143,05050337523RcLhcb7MeLhcb7AtLhcb7Lhcb7
PsbSJcPsbSJCGZ_12094scaffold339:857142-859344(−)8251,72632274624RcPsbSMePsbSAtPsbSPsbS
ELIPJcELIPJCGZ_02231scaffold119:1376949-1378080(−)58580826194863RcELIPMeELIPAtELIP1 AtELIP2ELIP
OHPJcOHP1JCGZ_09105scaffold250:2426033-2426931(−)35755222118481RcOHP1MeOHP1AtOHP1OHP1
JcOHP2JCGZ_08332scaffold224:432321-435041(+)5522,33910183471RcOHP2MeOHP2.1 MeOHP2.2AtOHP2OHP2
SEPJcSEP1JCGZ_23193scaffold7:432788-436707(−)4383,49833145712RcSEP1MeSEP1AtSEP1SEP1
JcSEP2JCGZ_09398scaffold255:592063-593949(+)5821,32210193462RcSEP2MeSEP2AtSEP2SEP2
JcSEP3JCGZ_03488scaffold137:779011-781250(+)7801,919242591002RcSEP3MeSEP3.1 MeSEP3.2AtSEP3.1 AtSEP3.2SEP3
JcSEP6JCGZ_26324scaffold906:2486216-2487759(−)75993220252882RcSEP6MeSEP6SEP6
JcSEP4JCGZ_06634scaffold20:991705-992601(+)57057000189562RcSEP4MeSEP4AtSEP4SEP4
JcSEP5JCGZ_07816scaffold211:5206555-5210867(−)4473,90940148751RcSEP5MeSEP5AtSEP5SEP5
Psb33JcPsb33JCGZ_17235scaffold5:830004-833169(+)8672,80321288621RcPsb33MePsb33.1 MePsb33.2AtPsb33Psb33
FCIIJcFCIIJCGZ_24260scaffold813:61000-71385(−)1,5009,60090499861RcFCIIMeFCIIAtFCIIFCII

Notes.

amino acid

Arabidopsis thaliana

base pair

coding sequence

expressed sequence tag

Manihot esculenta

orthologous group

Ricinus communis

transmembrane helix

transit peptide)

Figure 1

Chromosomal locations of JcLhc superfamily genes.

Chromosome serial numbers are indicated at the top of each chromosome. Chr: chromosome.

Notes. amino acid Arabidopsis thaliana base pair coding sequence expressed sequence tag Manihot esculenta orthologous group Ricinus communis transmembrane helix transit peptide) The expression of all JcLhc genes was supported by available Sanger sequencing-derived expressed sequence tags (ESTs) and/or RNA sequencing (RNA-seq), where JcLhcb1.1 harbors the maximum of 28 EST hits. The intron number of these genes varies from zero to nine: approximately 11.11% of genes are intronless, and 29.63%, 22.22%, 11.11%, 11.11%, 11.11% or 3.70% contain two, one, three, four, five and nine introns, respectively (Table 1 and Fig. 2). Similar exon-intron structure was also observed in castor, cassava, and arabidopsis (see Table S1), implying a conserved evolution between these species. The average length of coding sequences (CDS) is about 760 bp, varying from 357 bp of JcOHP1 to 1,500 bp of JcFCII. Compared with CDS, the intron length is relatively more variable, ranging from 79 bp of JcLhcb6 to 8,100 bp of JcFCII and with the average length of 1,259 bp (Table 1 and Fig. 2). The CDS of JcLhcb1.1 and JcLhcb1.2, which are reversely clustered on scaffold160, was shown to exhibit 96.7% identity. Thereby, they are more likely to result from tandem duplication (Zou, Yang & Zhang, 2019; Zou & Yang, 2019a; Zou & Yang, 2019c).
Figure 2

Exon-intron structures of JcLhc superfamily genes.

The graphic representation of the gene models is displayed using GSDS. GSDS: gene structure display server.

Chromosomal locations of JcLhc superfamily genes.

Chromosome serial numbers are indicated at the top of each chromosome. Chr: chromosome.

Exon-intron structures of JcLhc superfamily genes.

The graphic representation of the gene models is displayed using GSDS. GSDS: gene structure display server.

Synteny analysis and determination of orthologous groups

Orthologs of JcLhc superfamily genes in castor, cassava, and arabidopsis were further identified by using the BRH method, resulting in 26 orthologous groups (OGs) when the definition was confined to at least one member present in more than two species examined (Table 1). The result is highly consistent with phylogenetic analysis (see below) as well as synteny analysis performed between jatropha and castor, where one-to-one orthologous relationship was observed with exception of the Lhcb1 group with two-to-three (Table 1). Interestingly, RcLhcb1.2, which may originate by dispersed duplication, is located on scaffold30005 together with RcLhca3. However, no collinear gene was found for RcLhcb1.2 in jatropha (see Fig. S1). By contrast, orthologous relationships between jatropha and cassava/arabidopsis are relatively complex, which include one-to-one, one-to-two, one-to-three, and two-to-five, corresponding to one or more recent WGDs occurred in these two species. It is worth noting that, SEP6, a recently identified group that is present in jatropha, castor, and cassava, is absent from arabidopsis (Table 1), implying species/lineage-specific gene loss. Additionally, species-specific gene expansion was also observed: duplicates identified in jatropha (one) and castor (two) were shown to result from tandem or dispersed duplication, respectively; nine duplicates identified in cassava were derived from tandem duplication (three) and whole-genome duplication (WGD) (six); in arabidopsis, four or five duplicates were derived from tandem duplication and WGD, respectively (Table 1 and Table S1). Although not exactly the same within a family, the exon-intron structure is highly conserved within a certain OG: Lhcb1 and SEP4 are intronless; one-intron-containing groups include Lhcb2/-4/-6/-8, OHP2, and SEP2, whereas two-intron groups include Lhca3/-4, Lhcb3, ELIP, OHP1, SEP3/-6, and Psb33; Lhca1 and SEP1 feature three introns, whereas Lhca2/-6, and SEP5 feature four introns; three groups (i.e., Lhcb5/-7 and Lhca5) contain five introns, whereas only one group (i.e., FCII) harbors nine introns (Fig. 2, Table 1, and Table S1).

Phylogenetic analysis, sequence features, and conserved motifs

As shown in Table 1, the deduced JcLhc superfamily proteins consist of 118–499 amino acids (AA) with one to four TMHs (Fig. S2), and the predicted length of transit peptide ranges from 31 to 100 residues (Table 1). Several physical and chemical parameters of mature peptides were further calculated: the molecular weight (MW) and isoelectric point (pI) values of mature proteins in jatropha range from 7.55 to 46.76 kilodalton (kDa) or from 4.56 to 9.99, respectively; about 81.48% of JcLhc superfamily proteins harbor a pI value of less than 7, which is relatively less than 85.71% in castor, 91.43% in cassava, or 91.18% in arabidopsis; and, about 59.26% of JcLhc superfamily proteins harbor a grand average of hydropathicity (GRAVY) value of less than 0, which is relatively less than 64.29% in castor, 62.86% in cassava, or 73.53% in arabidopsis (Table 1 and Table S1). Except for JcPsb33 that contains a CB-like domain (see Fig. S3), all other JcLhc superfamily proteins include the core CB domain of approximately 20 AA (see Table S1). Nevertheless, their overall sequence similarity was shown to be considerably low, even within the conserved Lhc family (ranging from 27.2% to 98.5%, see Table S3). To keep the analysis reliable, an independent phylogenetic tree was constructed for each subfamily by using full-length proteins from jatropha, castor, cassava, and arabidopsis. As shown in Fig. 3A, subfamilies Lhca, Lhcb, OHP, and SEP are clearly clustered into six, eight, two or six phylogenetic groups respectively, corresponding to 22 OGs as described above, i.e., Lhca1–6, Lhcb1–8, OHP1, OHP2, and SEP1–6. Among them, Lhcb8 and SEP6 exhibit a closer relationship with Lhcb4 and SEP3, with a similarity of 79.5% or 55.5%, respectively (Table S3), where JcLhcb8 harbors a relative shorter C-terminal in relation to JcLhcb4 (Fig. S2).
Figure 3

Phylogenetic and conserved motif analyses of jatropha, castor, cassava, and arabidopsis Lhc superfamily proteins.

(A) Phylogenetic analysis of Lhca, Lhcb, PsbS, ELIP, OHP, SEP, Psb33, and FCII subfamilies; (B) Distribution of conserved motifs. Sequence alignment was performed using MUSCLE and unrooted phylogenetic trees were constructed using MEGA7 (maximum likelihood method; bootstrap, 1,000 replicates). Only bootstrap values at nodes supported by a posterior probability of ≥50% are given. The distance scale denotes the number of amino acid substitutions per site. The name of each OG is indicated next to the corresponding group. OG: orthologous group.

Phylogenetic and conserved motif analyses of jatropha, castor, cassava, and arabidopsis Lhc superfamily proteins.

(A) Phylogenetic analysis of Lhca, Lhcb, PsbS, ELIP, OHP, SEP, Psb33, and FCII subfamilies; (B) Distribution of conserved motifs. Sequence alignment was performed using MUSCLE and unrooted phylogenetic trees were constructed using MEGA7 (maximum likelihood method; bootstrap, 1,000 replicates). Only bootstrap values at nodes supported by a posterior probability of ≥50% are given. The distance scale denotes the number of amino acid substitutions per site. The name of each OG is indicated next to the corresponding group. OG: orthologous group. To reveal possible divergence of members within a certain OG and between different OGs/(sub)families, conserved motifs were analyzed using MEME. As shown in Fig. 3B and Table 2, motifs are highly variable between subfamilies or even between different evolutionary groups, and considerably more motifs were identified in the Lhc family as compared with PsbS, FCII, and Lil families. Among 25 motifs identified, Motif 1, which is characterized as the CB domain, is widely distributed, including Psb33s. Motif 19, which is characterized as chloroplast transit peptide, is also widely found. Motifs 25 and 11 are characterized as part of the Rieske-like domain (PF13806), where Motif 11 is Psb33-specific and Motif 25 is also present in Lhca1s. The Ferrochelatase domain (PF00762), which is FCII-specific, was shown to include Motifs 21, 12, 10, and 24. Among them, Motif 10 is also present in SEP3s and SEP6s. Motif 7, which includes the WYGPDR/WYGEER domain, is widely found in Lhcb1, −2,  − 3,  − 5, and −7 groups. WYGPDR has been proven to be essential for trimerization (Hobe et al., 1995; Rogl & Kühlbrandt, 1999), however, experimental evidence is still needed for WYGPD and WYGEER varieties. By contrast, little information is available for other motifs, including several group-specific motifs such as Motifs 8, 9, 18, 20, and 22.
Table 2

Detailed information of 25 motifs identified in this study.

Motifs were identified using MEME.

MotifE-value Sites Width Best match
Motif 12.5e−1,98820521EJINGRLAMLGFLGFLVQEIL
Motif 26.2e−1,1702460ARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAG
Motif 39.4e−9926923YLDGELPGDYGFDPAGLSADPET
Motif 48.6e−8946421TGKGPJENLADHLADPVHNNI
Motif 52.6e−5825821GSFDPLGLADDPEAFAELKVK
Motif 63.0e−5464029TLFVIELJLIGYVEFRRWADLDNPGSVYP
Motif 71.9e−3743221SPWYGPDRVKYLGPFSGETPS
Motif 84.2e−331873KFVDPRWIGGTWDLKQFZKDGKTDWDAVIDAEAKRRKWLEENPESSSNDEPVVFDTSIIPWWAWIKRYHLPEA
Motif 91.4E−216941QNLAKNVAGDIIGTRTEAADVKSTPFQPYSEVFGLQRFREC
Motif 103.5E−2051248KTLLFVAVAGVLLIRKNEDIETLKKLLDETTLYDKQWQATWKDZNPSS
Motif 119E−200580IENRSPAEGAYSEGLJNAKLTQDGCIVCPTTDSTFDLRTGAIKDWYPKNPVLRVLTPALRTLYVYPVKTDEENIYISLRG
Motif 121E−170480KVYVGMRYWHPFTEEAIEQIKRDGITKLVVLPLYPQFSISTSGSSLRLLESIFREDEYLVNMQHTVIPSWYQREGYIKAM
Motif 138.1E–1661329DVGYPGGLWFDPLGWGSGSPEKVKELRTK
Motif 143.6E–1592715SWYDAGKVEYFAGSS
Motif 151.8E–1542521TVCVKADPDRPLWFPGSTPPE
Motif 165.4E–1532411WAYATNFVPGK
Motif 177.6E–1492021PSAPEVMGNGRVTMRKTVKKA
Motif 188.6E–1421241TGKGLLAQLNJETGJPIYELEPLVLFNVLFALFAAINASKD
Motif 193.6E–1408011MATSTLAASSS
Motif 206.1E–140480GAFHFIEPVWWRVGYSKLKGDTLDYLGIPGLHLAGSQGVIVIAICQALLMVGPEYARYCGIEALEPLGIYLPGDINYPGG
Motif 213.4E–142857GPEPLLGVZPFLINLLADPVIERLPYVGAFLVKPLEAFISLVPLPKVEEGLASYGGG
Motif 222E–98553PPPKPAAQVALDDKNVITLEFQRQKAKELQEYFKQKKLEETDQGPFFGFLGKN
Motif 234.3E–982311PLGEVTDPJYP
Motif 244.6E–92457AYQSRVGPVEWLKPYTDETIIELGRKGVKNLLAVPISFVSEHIETLEEIDVEYKELA
Motif 251.4E–1061029NWVPAVPLAALPGGZATYJGQPVPTGLLP

Detailed information of 25 motifs identified in this study.

Motifs were identified using MEME. Although these motifs are usually conserved within a certain OG, species-specific gain or loss was also observed. For example, the conserved Motifs 15, 23, and 10 are absent from AtLhca5, AtLhca3 or AtFCII, respectively, whereas the widely present Motif 8 in SEP3s and SEP6s is replaced by Motif 3 in MeSEP6 (Fig. 3).

Expression profiles of JcLhc superfamily genes

Global gene expression profiles were investigated in various tissues, i.e., root (from 15-day-old seedlings), leafage (from 4-year-old plants, half expanded), leaf (mature leaf, fully expanded), IND (undifferentiated inflorescence of 0.5  cm diameter), PID1 (female flower with carpel primordia beginning to differentiate), PID2 (female flower with three distinct carpels formed), STD1 (male flower with stamen primordia beginning to differentiate), STD2 (male flower with ten complete stamens formed), and developing seed (19–28 days after pollination). Despite the expression of all identified genes, their transcript levels are highly variable over different tissues. As shown in Fig. 4, the majority of JcLhc superfamily genes are predominantly expressed in leaf, and the total transcript level of the whole superfamily in STD1, PID2, STD2, PID1, leafage, root, and seed accounts for 42.82%, 24.26%, 23.71%, 21.41%, 21.16%, 18.01%, 5.83%, or 1.75% of that in leaf, respectively. According to tissue-specific expression patterns, JcLhc superfamily genes can be divided into five main clusters: Cluster I is mostly expressed in leafage, including JcPsbS, JcFCII, and four Lils (i.e., JcOHP2, JcSEP1, JcSEP2, and JcELIP); Clusters II and III that contain the vast majority of Lhc family members and include approximately 63.00% of the whole superfamily are predominantly expressed in mature leaf, where Cluster III is also highly abundant in leafage (i.e., JcLhca6, JcLhcb7, JcLhcb8, JcOHP1, JcSEP3, JcSEP4, JcSEP5, and JcPsb33); Cluster IV that only includes JcSEP6 is preferentially expressed in root, whereas Cluster V is typically expressed in STD1 (i.e., JcLhcb1.2, JcLhcb2, and JcLhcb6) (Fig. 4). It is worth noting that, JcLhcb1.1 represents the most expressed gene in most tissues examined, implying its key roles.
Figure 4

Tissue-specific expression profiles of JcLhc superfamily genes.

Color scale represents FPKM normalized log10 transformed counts where navy indicates low expression and firebrick3 indicates high expression. FPKM: fragments per kilobase of exon per million fragments mapped; IND, undifferentiated inflorescence of 0.5 cm diameter; PID1, female flower with carpel primordia beginning to differentiate; PID2, female flower with three distinct carpels formed; STD1, male flower with stamen primordia beginning to differentiate; STD2, male flower with ten complete stamens formed.

Tissue-specific expression profiles of JcLhc superfamily genes.

Color scale represents FPKM normalized log10 transformed counts where navy indicates low expression and firebrick3 indicates high expression. FPKM: fragments per kilobase of exon per million fragments mapped; IND, undifferentiated inflorescence of 0.5 cm diameter; PID1, female flower with carpel primordia beginning to differentiate; PID2, female flower with three distinct carpels formed; STD1, male flower with stamen primordia beginning to differentiate; STD2, male flower with ten complete stamens formed. Given drought and salt are two of the most important abiotic stresses affecting plant growth and development, photosynthesis, and crop yield, we thereby investigated the response patterns of JcLhc superfamily genes post drought or salt treatment in leaves and roots of eight-week-old seedlings. After withholding irrigation for 1, 4 or 7 d, the total superfamily transcripts in roots were not significantly changed, by contrast, initial increase followed by significant decrease were observed in leaves. The result is consistent with the fact that the net photosynthesis rate (Pn) and stomatal conductance had decreased to 80% or 20% of those in the control after the start of the stress treatment for 2 and 7 d, respectively (Zhang et al., 2015). For 1 d, seven or three genes were significantly regulated in leaves and roots, respectively. Among them, JcLhcb1.1, JcLhcb1.2, JcLhcb3, JcELIP, JcSEP2, and JcSEP5 were upregulated in leaves, whereas JcOHP2 was downregulated; JcLhcb3 and JcFCII were downregulated in roots, whereas JcPsbS was upregulated. For 4 d, ten or seven genes were significantly regulated in leaves and roots, respectively. Among them, JcLhca4, JcLhcb2, JcLhcb4, and JcELIP were upregulated in leaves, whereas JcLhcb1.1, JcLhcb1.2, JcLhcb3, JcLhcb5, JcLhcb7, and JcLhcb8 were downregulated; JcLhca3, JcLhca4, JcLhcb3, JcLhcb8, and JcPsbS were upregulated in roots, whereas JcLhca1 and JcFCII were downregulated. For 7 d, 19 or seven genes were significantly regulated in leaves and roots, respectively. Among them, JcLhca4, JcLhcb2, JcPsbS, JcELIP, JcOHP1, JcSEP2, and JcSEP5 were upregulated in leaves, whereas JcLhca3, JcLhca5, JcLhcb1.1, JcLhcb1.2, JcLhcb3, JcLhcb5, JcLhcb6, JcLhcb8, JcSEP1, JcSEP3, JcSEP4, and JcPsb33 were downregulated; JcLhca1, JcLhcb1.1, JcLhcb1.2, JcLhcb3, JcLhcb5, and JcFCII were downregulated in roots, whereas JcOHP1 was upregulated (Fig. 5).
Figure 5

Expression profiles of JcLhc superfamily genes upon drought, salt, BA, or GA treatments.

Color scale represents RPKM normalized log10 transformed counts where navy indicates low expression and firebrick3 indicates high expression. RPKM, Reads per kilobase per million mapped reads.

Expression profiles of JcLhc superfamily genes upon drought, salt, BA, or GA treatments.

Color scale represents RPKM normalized log10 transformed counts where navy indicates low expression and firebrick3 indicates high expression. RPKM, Reads per kilobase per million mapped reads. Similar to drought treatment, after applying 100 mM NaCl for 2 h, 2 d or 7 d, gradual downregulation of total transcripts was only observed in leaves. For 2 h, five or three genes were significantly regulated in leaves and roots, respectively. Among them, JcLhcb2, JcOHP2, JcSEP2, and JcFCII were downregulated in leaves, whereas JcLhcb1.2 was upregulated; in roots, JcLhcb8, JcSEP5, and JcFCII were downregulated. For 2 d, six genes were significantly regulated in both leaves and roots, respectively. Among them, JcELIP, JcSEP2, JcSEP4, and JcFCII were upregulated in leaves, whereas JcOHP2 and JcSEP1 were downregulated; JcLhca1, JcLhca2, JcLhcb8, and JcSEP5 were upregulated in roots, whereas JcLhcb1.1 and JcLhcb1.2 were downregulated. For 7 d, nine or seven genes were significantly regulated in both leaves and roots, respectively. Among them, JcLhca3, JcLhcb1.1, JcLhcb1.2, JcLhcb3, JcLhcb5, JcLhcb8, JcSEP1, and JcSEP4 were downregulated in leaves, whereas JcLhcb2 was upregulated; JcLhca3, JcLhcb1.2, JcLhcb3, JcLhcb5, and JcSEP5 were downregulated in roots, whereas JcELIP and JcFCII were upregulated (Fig. 5). Downregulation of most regulated genes is highly consistent with gradual decrease of Pn, where the Pn values of 2 and 7 d after stress treatment accounted for 83% or 50% of the control, respectively (Zhang et al., 2014). Responses to gibberellin acid (GA) and 6-benzylaminopurine (BA) treatments were also examined in young axillary buds. Application of 10 µM GA for 12 h resulted in one upregulated (i.e., JcFCII) and two downregulated (i.e., JcSEP2 and JcSEP5) genes, in contrast, no evident effect was observed for the same concentration of BA (Fig. 5).

Discussion

In green plants, the Lhc superfamily is consisted of four antennae protein families that play essential roles in light-harvesting and photoprotection (Jansson, 1999; Klimmek et al., 2006; Zou, 2018). Despite their importance, extensive research is still limited to the model plant arabidopsis and few other species such as Chlamydomonas reinhardtii, Physcomitrella patens, castor, and cassava (Elrad & Grossman, 2004; Klimmek et al., 2006; Alboresi et al., 2008; Engelken, Brinkmann & Adamska, 2010; Zou, Huang & An, 2013; Zou & Yang, 2019a). Among them, it’s well established that cassava and arabidopsis experienced one or two additional WGDs after the so-called γ hexaploidization event shared by all core eudicots: the recent WGD occurred in cassava is called ρ, which was estimated to occur within a window of 39–47 million years ago (Mya) (Bredeson et al., 2016; Zou, Yang & Zhang, 2019; Zou & Yang, 2019a; Zou & Yang, 2019b; Zou & Yang, 2019c), whereas two recent WGDs occurred in arabidopsis are known as β and α, which were estimated to occur within a window of 61–65 or 23–50 Mya, respectively (Bowers et al., 2003). From this point of view, analysis of species without recent WGDs may improve our knowledge on species-specific evolution of this special gene family. Jatropha, another economically Euphorbiaceous plant for potential biodiesel purpose, is a good candidate for such study. According to comparative genomics analysis, jatropha may share a common ancestor with cassava and castor at approximately 65 Mya (Bredeson et al., 2016), and no additional WGD occurred after their divergence. In the present study, a first genome-wide identification and global analysis of Lhc superfamily genes were performed in jatropha, and the superfamily number of 27 members identified in this species is comparable to 28 reported in castor but relatively less than 35 or 34 present in cassava and arabidopsis, respectively (Klimmek et al., 2006; Engelken, Brinkmann & Adamska, 2010; Zou, Huang & An, 2013; Zou & Yang, 2019a). Nevertheless, 26 OGs representing four families (i.e., Lhc, Lil, PsbS, and FCII) were found in jatropha as observed in castor and cassava (Zou, Huang & An, 2013; Zou & Yang, 2019a). Few recent duplicates were identified in jatropha as well as castor, corresponding to no recent WGD occurred in these two species (Chan et al., 2010; Wu et al., 2015). Compared with castor that contains two dispersed duplicates, only one duplicate derived from tandem duplication was found in jatropha. By contrast, considerably more duplicates, i.e., nine, were identified in both cassava and arabidopsis (Table S1), reflecting the occurrence of one or two recent WGDs (Bowers et al., 2003; Bredeson et al., 2016). Despite having the same number of duplicates, cassava contains relatively more WGD duplicates (6 vs 5) but less local duplicates (3 vs 4), implying species-specific evolution pattern. Interestingly, duplicates in both jatropha and castor are confined to the Lhcb1 group, however, in cassava and arabidopsis, local duplicates were also found in the Lhcb2 group (Table S1). Among four families identified, both PsbS and FCII include a single member in four species examined in this study. By contrast, Lhc and Lil families are relatively complex. The Lhc family contains 14 OGs representing two subfamilies (i.e., Lhca and Lhcb), whereas the Lil family includes ten OGs representing four subfamilies (i.e., ELIP, OHP, SEP, and Psb33). According to crystal analyses, the Lhc family members usually contain three alpha-helixes, whereas the PsbS family features four (Kühlbrandt, Wang & Fujiyoshi, 1994; Pan et al., 2011; Fan et al., 2015). By contrast, one to three helixes were shown to be present in Lil proteins, i.e., one for OHPs and Psb33s, two for SEPs, and three for ELIPs (Jansson, 1999; Engelken, Brinkmann & Adamska, 2010; Fristedt et al., 2015; Beck et al., 2017). Similar results were also observed in this study, however, both JcSEP5 and JcFCII were shown to contain a single helix. It is noteworthy that, among 26 OGs identified, SEP6 is absent from arabidopsis. SEP6 exhibits about 41.7%, 40.5% or 39.0–40.3% sequence identity with SEP3 in jatropha, castor and cassava respectively, implying their early divergence and species-specific gene loss. Indeed, SEP6 orthologs were broadly found in dicots, including Carica papaya and Aquilegia coerulea (Zou & Yang, 2019a). Additionally, Lhcb8 shows approximately 72.0%, 69.9%, 72.6% or 64.2–65.3% identity with Lhcb4 in jatropha, castor, cassava, and arabidopsis, respectively. Lhcb8 is widely present in core eudicots but not in A. coerulea and monocots, suggesting its recent origin. According to synteny analysis performed in arabidopsis, Lhcb8 is more likely to be a duplicate of Lhcb4 generated along the γ event (Bowers et al., 2003; Wang, Tan & Paterson, 2013). Potential roles of JcLhc superfamily genes could be inferred from their expression patterns and function-characterized orthologs in arabidopsis and other species. According to GO annotation, they belong to thylakoid membrane proteins that have activity of chlorophyll binding, pigment binding, xanthophyll binding, lipid binding, protein binding, iron-sulfur cluster binding, oxidoreductase, ferrochelatase as summarized in Table S4. Our transcriptional profiling not only supports the expression of all 27 JcLhc superfamily genes identified in this study, but also reveals key genes in a certain tissue, development stage or environment condition. Similar to that reported in arabidopsis (Jansson, 1999; Klimmek et al., 2006), genes encoding JcLhca1 to −4 and JcLhcb1 to −6, which are characterized as abundant Lhc proteins, were highly expressed in most examined jatropha tissues, especially in mature leaf. By contrast, four genes encoding so-called rare Lhc proteins (i.e., JcLhca5, JcLhca6, JcLhcb7, and JcLhcb8) are lowly expressed, exhibiting a similar expression pattern to members of Lil, PsbS, and FCII families. The result is consistent with our cluster analysis, which divides JcLhc superfamily genes into five clusters named I, II, III, IV, and V. These genes encoding abundant Lhc proteins belong to Clusters II and V, whereas rare Lhc genes were divided into Cluster III with the exception of JcLhca5. Clustering JcLhca5 into Cluster II is due to its leaf-preferential expression pattern, but not the transcript level. Compared with mature leaf, leafage is considerably more sensitive to high light and other stresses. This is not surprising that the majority of members in Lil, PsbS, and FCII families are highly expressed in this special tissue, comprising Clusters I and III. It is worth noting that, JcSEP6, the unique member in Clusters IV, is lowly expressed in most examined tissues with the exception of root. As a recently identified superfamily member, the detailed function of SEP6 still needs to be investigated. Furthermore, most JcLhc superfamily genes were regulated by drought and/or salt, two most important abiotic stresses affecting crop growth and yield (Zhang et al., 2014; Zhang et al., 2015). As expected, more genes are downregulated, especially for the leaf tissue, corresponding to decrease of transpiration rate and stomatal conductance (Zhang et al., 2015). Nevertheless, frequent upregulation of certain members was also observed, i.e., JcLhca4, JcELIP, JcPsbS, JcSEP2, JcSEP5, and JcOHP1. Interestingly, JcLhca2 and JcLhca5 exhibit distinct responses upon drought or salt stress, whereas JcLhca2 was specifically regulated by salt and JcLhca4, JcLhcb4, JcLhcb6, JcLhcb7, JcPsbS, JcOHP1, JcSEP2 and JcPsb33 were only regulated by drought. The involvement of Lhc superfamily genes in stress response has been well documented in arabidopsis and other species, including high light, chloroplast retrograde signal, oxidative stress, abscisic acid, etc. (Montané & Kloppstech, 2000; Staneloni, Rodriguez-Batiller & Casal, 2008; Gerotto et al., 2011; Tibiletti et al., 2016). For example, ELIPs, as the name suggests, are induced by early and high light, as well as other stresses such as UV-B, cold, heat, drought, salt, hypoxia, and anoxia described in this study and elsewhere (Heddad et al., 2006; Hayami et al., 2015). In arabidopsis, knockout and overexpression of ELIPs resulted in decreased chlorophyll levels (Casazza et al., 2005; Tzvetkova-Chevolleau et al., 2007). Another high-light induced gene, PsbS, acts as the main sensor of the low pH in plants and plays an essential role in nonphotochemical quenching (Bergantino et al., 2003; Li et al., 2004; Gerotto et al., 2011; Fan et al., 2015; Tibiletti et al., 2016). OHPs, which are related to HLIPs in cyanobacteria, are essential for the formation of the PSII reaction center. In arabidopsis, mutations in AtOHP1 or AtOHP2 caused severe growth deficits, reduced pigmentation, and disturbed thylakoid architecture (Beck et al., 2017; Hey & Grimm, 2018; Myouga et al., 2018; Li et al., 2019). By contrast, two plant hormones (i.e., BA and GA), which can improve shoot branching after application to young axillary buds (Ni et al., 2017), had little effect on transcriptional regulation of JcLhc superfamily genes.

Conclusion

This study presents a first genomics analysis of the Lhc supergene family in jatropha, resulting in 27 members that are distributed across nine out of 11 chromosomes. Despite a relatively smaller number of members, 26 orthologous groups representing four families were found, where SEP6 represents a novel group that has been lost in the model plant arabidopsis. Nearly one-to-one orthologous relationship was observed between jatropha and castor, however, species-specific gene expansion was observed in these two species as well as cassava and arabidopsis. Exon-intron structures, protein motifs, and expression profiles of JcLhc superfamily genes were also analyzed and discussed. These findings provide valuable information for further studies in jatropha and species beyond.

Matched locations of RcLhc superfamily genes on nine jatropha chromosomes

The chromosome serial numbers are indicated at the top of each chromosome, and 27 RcLhc superfamily genes are shown just behind their collinear genes in jatropha (where RcLhcb1.2 with no collinear gene in jatropha). (Chr: chromosome; Jc: Jatropha curcas; Rc: Ricinus communis). Click here for additional data file.

Multiple sequence alignment of the JcLhc superfamily

(A) Sequence alignment of the JcLhc family; (B) Sequence alignment of the JcLil family; (C) Sequence alignment of JcPsbS with RcPsbS, MePsbS, and AtPsbS; (D) Sequence alignment of JcFCII with RcFCII, MeFCII, and AtFCII. Sequence alignment was performed using MUSCLE and predicted TMHs were underlined. (TMH: transmembrane helix). Click here for additional data file.

Sequence features of Psb33s in jatropha as well as castor, cassava, and arabidopsis

Sequence alignment was performed using MUSCLE. The predicted chloroplast transit peptide and Lhc motif-bearing TMH region were boxed. (TMH: transmembrane helix). Click here for additional data file.

Detailed information of Lhc superfamily genes in jatropha, castor, cassava, and arabidopsis

1 Conserved domains were predicted using MOTIF (CB, Chloroa_b-bind, PF00504; Rieske-like, PF00355; Ferrochelatase, PF00762). 2 Chloroplast transit peptide was predicted using ChloroP. 3 Duplicated modes in arabidopsis were determined based on studies of Wang, Tan & Paterson (2013) and related references therein. (AA, amino acid; CB, chlorophyll a/b-binding; GRAVY, grand average of hydropathicity; p I, isoelectric point; kDa, kilodalton; MW, molecular weight; TP, transit peptide; TMH, transmembrane helix; WGD, whole-genome duplication). Click here for additional data file. Click here for additional data file. Click here for additional data file. Click here for additional data file.
  52 in total

1.  Integrated genome sequence and linkage map of physic nut (Jatropha curcas L.), a biodiesel plant.

Authors:  Pingzhi Wu; Changpin Zhou; Shifeng Cheng; Zhenying Wu; Wenjia Lu; Jinli Han; Yanbo Chen; Yan Chen; Peixiang Ni; Ying Wang; Xun Xu; Ying Huang; Chi Song; Zhiwen Wang; Nan Shi; Xudong Zhang; Xiaohua Fang; Qing Yang; Huawu Jiang; Yaping Chen; Meiru Li; Ying Wang; Fan Chen; Jun Wang; Guojiang Wu
Journal:  Plant J       Date:  2015-03       Impact factor: 6.417

2.  Stable Accumulation of Photosystem II Requires ONE-HELIX PROTEIN1 (OHP1) of the Light Harvesting-Like Family.

Authors:  Fumiyoshi Myouga; Kaori Takahashi; Ryoichi Tanaka; Noriko Nagata; Anett Z Kiss; Christiane Funk; Yuko Nomura; Hirofumi Nakagami; Stefan Jansson; Kazuo Shinozaki
Journal:  Plant Physiol       Date:  2018-02-01       Impact factor: 8.340

3.  Differential expression and localization of early light-induced proteins in Arabidopsis.

Authors:  Mounia Heddad; Hanna Norén; Verena Reiser; Marina Dunaeva; Bertil Andersson; Iwona Adamska
Journal:  Plant Physiol       Date:  2006-07-07       Impact factor: 8.340

4.  Unravelling angiosperm genome evolution by phylogenetic analysis of chromosomal duplication events.

Authors:  John E Bowers; Brad A Chapman; Junkang Rong; Andrew H Paterson
Journal:  Nature       Date:  2003-03-27       Impact factor: 49.962

5.  Role of PSBS and LHCSR in Physcomitrella patens acclimation to high light and low temperature.

Authors:  Caterina Gerotto; Alessandro Alboresi; Giorgio M Giacometti; Roberto Bassi; Tomas Morosinotto
Journal:  Plant Cell Environ       Date:  2011-04-13       Impact factor: 7.228

6.  Crystal structures of the PsbS protein essential for photoprotection in plants.

Authors:  Minrui Fan; Mei Li; Zhenfeng Liu; Peng Cao; Xiaowei Pan; Hongmei Zhang; Xuelin Zhao; Jiping Zhang; Wenrui Chang
Journal:  Nat Struct Mol Biol       Date:  2015-08-10       Impact factor: 15.369

7.  Abundantly and rarely expressed Lhc protein genes exhibit distinct regulation patterns in plants.

Authors:  Frank Klimmek; Andreas Sjödin; Christos Noutsos; Dario Leister; Stefan Jansson
Journal:  Plant Physiol       Date:  2006-03       Impact factor: 8.340

8.  Abscisic acid, high-light, and oxidative stress down-regulate a photosynthetic gene via a promoter motif not involved in phytochrome-mediated transcriptional regulation.

Authors:  Roberto J Staneloni; María José Rodriguez-Batiller; Jorge J Casal
Journal:  Mol Plant       Date:  2007-10-08       Impact factor: 13.164

9.  Draft genome sequence of the oilseed species Ricinus communis.

Authors:  Agnes P Chan; Jonathan Crabtree; Qi Zhao; Hernan Lorenzi; Joshua Orvis; Daniela Puiu; Admasu Melake-Berhan; Kristine M Jones; Julia Redman; Grace Chen; Edgar B Cahoon; Melaku Gedil; Mario Stanke; Brian J Haas; Jennifer R Wortman; Claire M Fraser-Liggett; Jacques Ravel; Pablo D Rabinowicz
Journal:  Nat Biotechnol       Date:  2010-08-22       Impact factor: 54.908

10.  MicroSyn: a user friendly tool for detection of microsynteny in a gene family.

Authors:  Bin Cai; Xiaohan Yang; Gerald A Tuskan; Zong-Ming Cheng
Journal:  BMC Bioinformatics       Date:  2011-03-18       Impact factor: 3.169

View more
  4 in total

1.  Identification and expression analysis of chlorophyll a/b binding protein gene family in grape (Vitis vinifera).

Authors:  Yunchun Wei; Xu Lu; Jinyu Bao; Congcong Zhang; Haokai Yan; Kang Li; Meishuang Gong; Sheng Li; Shaoying Ma
Journal:  Physiol Mol Biol Plants       Date:  2022-07-06

2.  Identification of Differentially Expressed Genes Reveal Conserved Mechanisms in the Rice-Magnaporthe oryzae Interaction.

Authors:  Dong Liang; Zhongqiang Qi; Yan Du; Junjie Yu; Mina Yu; Rongsheng Zhang; Huijuan Cao; Xiayan Pan; Junqing Qiao; Tianqiao Song; Youzhou Liu; Zhiyi Chen; Yongfeng Liu
Journal:  Front Plant Sci       Date:  2022-04-05       Impact factor: 5.753

3.  Genome-Wide Identification of the LHC Gene Family in Kiwifruit and Regulatory Role of AcLhcb3.1/3.2 for Chlorophyll a Content.

Authors:  Juan Luo; Muhammad Abid; Jing Tu; Puxing Gao; Zupeng Wang; Hongwen Huang
Journal:  Int J Mol Sci       Date:  2022-06-10       Impact factor: 6.208

4.  Pseudocrossidium replicatum (Taylor) R.H. Zander is a fully desiccation-tolerant moss that expresses an inducible molecular mechanism in response to severe abiotic stress.

Authors:  Selma Ríos-Meléndez; Emmanuel Valadez-Hernández; Claudio Delgadillo; Maria L Luna-Guevara; Mario A Martínez-Núñez; Mishael Sánchez-Pérez; José L Martínez-Y-Pérez; Analilia Arroyo-Becerra; Luis Cárdenas; Martha Bibbins-Martínez; Ignacio E Maldonado-Mendoza; Miguel Angel Villalobos-López
Journal:  Plant Mol Biol       Date:  2021-06-29       Impact factor: 4.076

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.