Literature DB >> 31969581

A possible role for autoimmunity through molecular mimicry in alphavirus mediated arthritis.

Siva Sai Krishna Venigalla1, Sowmya Premakumar1, Vani Janakiraman2.   

Abstract

Alphaviral infections are foremost in causing debilitating clinical outcomes in humans characterized by rheumatic arthritis like conditions. Though the presence of virus in joints and associated inflammation has been implicated as one of the reasons for the acute and chronic polyarthritis post alphaviral infections, the basis for rheumatic like outcomes is not clear. Through an in silico analysis, we have investigated the possibility of an autoimmune process mediated through molecular mimicry in alphaviral infection induced pathogenicity. Interestingly, sequence alignment of the structural polyproteins belonging to arthritogenic alphaviruses revealed conserved regions which share homology with human proteins implicated in rheumatoid arthritis (RA). These conserved regions were predicted to exhibit binding to HLA class II alleles, showcasing their potential to incite T cell help. Molecular docking of the viral peptide and the corresponding homologous region in the human protein onto HLA-DRB1 revealed strong similarities in their binding patterns. Linear and conformational B cell epitope prediction analyses showed that these potential mimics have high propensity to elicit an efficient B cell response. We thus propose that the origin of polyarthritis post-arthritogenic alphaviral infections may also be mediated through a hitherto unknown autoimmune response due to the presence of cross-reactive epitopes between viral and human proteins.

Entities:  

Mesh:

Substances:

Year:  2020        PMID: 31969581      PMCID: PMC6976597          DOI: 10.1038/s41598-019-55730-6

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Introduction

Alphaviruses belonging to the group IV togoviridae family are positive sense, single stranded RNA viruses. These enveloped viruses are classified as old world and new world. While new world viruses are encephalitogenic, members of the old world are known to induce polyarthritis[1]. The members of the old world viruses include Chikungunya Virus (CHIKV), Ross River Virus (RRV), Mayaro Virus (MAYV), O’nyong nyong virus (ONV), Semiliki Forest Virus (SFV) and the Barmah Forest Virus (BFV). These mosquito transmitted viruses are globally distributed and are known to cause acute febrile illnesses, malaise, maculopapular rashes, myalgia, and severe arthralgia in humans[2-5]. Most often the infection remains endemic, but some viral strains are also associated with large epidemics such as the Chikungunya virus (CHIKV) out-break which was spread across 40 countries with 1.4–6.5 million reported cases globally[6]. Several studies also report a simultaneous increase in alpha virus associated arthritis lasting even after decrease in viral load[7]. While there is a resurgence of alphavirus associated arthritis cases, the knowledge about the molecular level events during infections involved in these conditions and about the direct cause and effect of the phenomenon is very sparse. For instance, macrophages, natural killer cells, CD4+ and CD8+ T lymphocytes have been shown as the main components of the inflammatory cellular infiltrate in animal models of CHIKV and RRV infections[8-10]. Production of a broad range of pro-inflammatory cytokines (IL-6, TNF, IFN-α/β, and IFNγ) and chemokines (MCP-1 and RANTES) post alpha viral infections has also been reported by Lidbury et al.[11]. Interestingly, a comparative study between CHIKV infection induced gene expression and rheumatoid arthritis induced gene expression changes in mouse models showed similarity in induced cytokine (TNF, IL-8, IL-15, IFN-γ, GM-CSF and lymphotoxin B) profiles[12]. Another study by Morrison et al.[13], demonstrated the presence of activated complement products in the serum of RRV infected mice, drawing similarities with the pathogenesis of rheumatoid arthritis[13]. Resemblance between proteins of pathogens and host components has been examined as a trigger for many autoimmune diseases[14]. In these scenarios, initiation of autoimmune disease by an infectious pathogen is hypothesized to involve immune recognition of self-peptides by way of “molecular mimicry”[15] thereby activating autoreactive T cells and generation of autoantibodies. Previous studies[16,17] hypothesized that microbial antigens like pulD from Klebsiella sp., nuclear antigen-1 from Epstein-Barr virus and OSP-A from Borrelia sp. may have a possible association with autoimmune diseases like ankylosing spondylitis, Systemic Lupus Erythematosus (SLE) and Lyme arthritis, respectively. A significant sequence similarity between P2-C protein of Coxsackie virus and glutamate decarboxylase of humans has been proposed as a trigger for Type 1 diabetes[18]. The similitude in clinical manifestation of an alphaviral infection induced arthralgia and rheumatoid arthritis at both phenotypic and molecular levels suggests that alphaviral infections could be a causative link for rheumatoid arthritis. Overarching goal of this study is to explore the possibility of existence of peptides in alphaviruses which may set off an autoimmune response resulting in rheumatoid arthritis like symptoms in alphavirus infected patients. Structural polyproteins of the alphaviruses were scanned for the presence of conserved stretches of amino acids that might share homology with sequences in human proteins implicated in rheumatoid arthritis. These conserved regions were validated in silico both at sequence and structural level for their immunogenic potential in terms of their ability to act as T and B cell epitopes. Overall, our results posit that polyarthritis associated with alpha viral infections may also involve an autoimmune component due to cross reactivity between viral epitopes and host proteins.

Results

Arthritogenic alpha viruses such as Chikungunya virus (CHIKV), Ross river virus (RRV), Semiliki forest virus (SFV), Mayaro virus, O’nyong-nyong virus (ONV) and Barmah forest virus (BFV) are generally associated with rheumatic diseases in humans, primarily characterized by polyarthralgia and polyarthritis. Although most patients recover within few weeks, the clinical conditions last for 6 months to more than 3 years[6]. However, molecular mechanisms contributing to this pathology are not very well understood. In the present study, we show a possible role of autoimmune process mediated through molecular mimicry as a likely cause for arthritic like conditions post alphaviral infections. The overall workflow of the study is depicted in Fig. 1.
Figure 1

Computational pipeline for the prediction of possible induction of rheumatoid arthritis through molecular mimicry post alphaviral infection.

Computational pipeline for the prediction of possible induction of rheumatoid arthritis through molecular mimicry post alphaviral infection.

Multiple sequence alignment reveals conserved regions in the structural polyproteins of arthritogenic alpha viruses

Alphaviral infections share a common feature of inducing RA like conditions, but the commonality in the alphaviruses leading to such a rheumatic outcome is not known. We hypothesized that the commonality could lie in the structural polyprotein of these viruses. Therefore, we have analyzed the structural polyproteins of six arthritogenic alpha viruses for the presence of conserved regions amongst them. As described in the methods section, amino acid sequences of the structural polyproteins of CHIKV, RRV, SFV, ONV, BFV and Mayaro virus were retrieved from UniProt database and subsequently multiple sequence alignment was performed using MUSCLE. Conserved regions identified are shown in Supplementary Fig. 1. The positions of the conserved regions have been depicted in Fig. 2 using the structural polyprotein of the Chikungunya virus as a representative model.
Figure 2

Domain diagram of the regions conserved in the structural polyprotein of the alphaviruses. The regions have been depicted using Chikungunya virus (strain S27 African prototype) structural polyprotein as a representative model.

Domain diagram of the regions conserved in the structural polyprotein of the alphaviruses. The regions have been depicted using Chikungunya virus (strain S27 African prototype) structural polyprotein as a representative model. The structural polyproteins of arthritogenic alphaviruses are about 71% identical at the primary (amino acid sequence) level. A total of 41 conserved regions were identified in the structural polyproteins, with E1 glycoprotein region exhibiting highest conservancy with 18 conserved regions, followed by p62 and capsid proteins harboring 15 and 8 conserved regions respectively.

Conserved regions across alpha viruses share homology with human proteins implicated in arthritis

To deduce the possibility of autoimmune reactions involved in mediating post alphaviral polyarthralgia through the presence of molecular mimics, we performed a sequence similarity search between the conserved regions among arthritogenic alpha viruses and the human proteome using the standard BLASTp program. Each of the 41 conserved regions was scanned against the human proteome. Very interestingly, 24 regions showed varying degrees of homology (52.7% to 100%) with human proteins that have been implicated in arthritis like conditions in humans (Table 1).
Table 1

List of human proteins sharing homology with conserved regions of structural polyproteins of alphaviruses and shown to contribute to rheumatoid arthritis-like-condition.

Viral peptideHuman peptideHuman proteinUniProt ID% similarity
FIPTQTFYFIPTRyanodine receptor 1P21817100%
KGRVVAIVLGGANEGARTALSVVTWARTALSInterleukin-17 receptor CQ8NAC3100%
TSAPCTITGTMGHFILARCPKGITGTMMonocyte differentiation antigen CD14P08571100%
RKGKIHIPFPLANVTCMVPKAPLANVTAlpha-1B-glycoprotein[44]P04217100%
PTVTYGKPTVTYGIntercellular adhesion molecule 1P05362100%
PTVTYGKTVTYLow-density lipoprotein receptor-related protein 2[45]P98164100%
CGTAECTAECInterleukin-23 receptorQ5VWK5100%
PDYSCKVFTGVYPFMWGGAYCFCDYCFCPlatelet glycoprotein 4P16671100%
PDYSCKVFTGVYPFMWGGAYCFCDSCKVFGlucocorticoid receptorP04150100%
PDYSCKVFTGVYPFMWGGAYCFCDSCKVFAndrogen receptorP10275100%
FSTALASSTALALeukocyte cell-derived chemotaxin-2O14960100%
PPCIPCCYEKEPEETLRMLEDNVYEKEPGEEInterleukin-1 receptor accessory proteinQ9NPH387.5%
YSGGRFTIPTGAGKPGDSGRPIFDNGKPGDDGCollagen alpha-1(II) chain[46,47]P0245886%
RKGKIHIPFPLANVTCMVPKAPLANVICTNF receptor-associated factor 6Q9Y4K385.7%
YNMDYPPFGAGRPGQFGDIQSRTPEIASRTPEAnnexin A5[48]P0875885.7%
DIPDAAFTRVVDAPDAAFTRIVitronectinP0400485.7%
PGYYQLLGYYDLLRyanodine receptor 1P2181783.3%
DGTLKIQVSLQIGNGTLKIT-cell surface antigen CD2P0672983.3%
TSAPCTITGTMGHFILARCPKGSAPCTVIntegrin alpha-IIbP0851483.3%
KWQYNSPLVPRDSPLVPLeptin receptorP4835783.3%
KWQYNSPLVPRSPIVPRPeptidoglycan recognition protein 1O7559483.3%
QAPSGFKYWLKESGFIYWLow-density lipoprotein receptor-related protein 2[45]P9816483.3%
DGTLKIQVSLQIGDGTLFKVQVBeta-sarcoglycanQ1658577.8%
MKSDASKFTHEKPEGYYNWHHGAVQKSEADKFTImmunoglobulin superfamily member 6O9597675%
YSGGRFTIPTGAGKPGDSGRPIFDNAGRPGNSGMacrophage scavenger receptor types I and IIP2175775%
KFIVGPMSSAWTPFDNKIVVYKGDVFDNTTVVYInterleukin-23 receptorQ5VWK575%
SKDVYANTQLVLQRPAAGTVHVPYSTKLLLQRPHigh affinity immunoglobulin gamma Fc receptor IP1231475%
APFGCQIATNPVRAMNCAVGNMPISALGQMPISCoagulation factor VP1225975%
RKGKIHIPFPLANVTCMVPKAPMVNVTCMHC class I polypeptide-related sequence BQ2998071.4%
KFIVGPMSSAWTPFDNKIVVYKGDVWIPFQNKLymphocyte antigen 75O6044971.4%
KPGRRERMCMKIENDCIFEVKENECFFEProtocadherin-9Q9HC5671%
SKDVYANTQLVLQRPAAGTVHVPYSQSPAAGTVQGRVPCartilage intermediate layer protein 1[49,50]O7533969.2%
FIPTQTFYPTEKFYComplement C3P0102467%
CGTAECCGVAQCIntegrin alpha-VP0675666.6%
RKGKIHIPFPLANVTCMVPKAIPIPLA-VITTCIVLymphocyte function-associated antigen 3P1925664. 3%
NADLAKLAFKRSSKYDLECAQIPVHYDLDCPTAPIPTNF receptor-associated factor 6Q9Y4K364%
FIPTQTFYFISTQQQVTFHigh affinity immunoglobulin epsilon receptor subunit alphaP1231960%
PGYYQLLGYRETRYQLLN-alpha-acetyltransferase 16Q6N06960%
PTVTYGKPTVTTGSGYGV-set and immunoglobulin domain-containing protein 4Q9Y27960%
RKGKIHIPFPLANVTCMVPKAIPY-LATDVTCVGPToll-like receptor 7Q9NYK157.1%
EGLEVTWGNNDGLDVSWChitinase-3-like protein 2[51]Q1578257.1%
FIPTQTFYIPSRSFYCartilage intermediate layer protein 1[49,50]O7533957%
MKSDASKFTHEKPEGYYNWHHGAVQANKFTETNPQVYYLow-density lipoprotein receptor-related protein 2[45]P9816454%
AYEHVTVIPNTVGVPYKTLVNRPGYPATVGVTQPY–LDRLGYCartilage intermediate layer protein 2Q8IUL852.6%

Human proteins highlighted in bold are experimentally proven to have antibodies developed against them in patients diagnosed with rheumatoid arthritis.

List of human proteins sharing homology with conserved regions of structural polyproteins of alphaviruses and shown to contribute to rheumatoid arthritis-like-condition. Human proteins highlighted in bold are experimentally proven to have antibodies developed against them in patients diagnosed with rheumatoid arthritis.

Potential mimic regions harbor HLA binding motifs

Human leukocyte antigen (HLA) is the most widely distributed molecule with high level of polymorphism and are the major governing factors in initiating cellular immune responses. It is thus important that immunogenic peptides bind to multiple HLA alleles to elicit a strong immune response. The 24 conserved regions of the structural polyprotein (refer Table 1) were analyzed for HLA class II binding ability using propred II server. The nonameric peptides generated from each conserved region were scanned against 51 HLA alleles available in the ProPred II server. The number of nonameric peptides generated from each of 24 conserved regions and the number of peptides predicted to bind to different alleles is summarized in Table 2. Peptides generated from 19 of the conserved regions bound to at least one HLA allele, while the peptides from the remaining 5 of the conserved regions did not bind to any of the alleles.
Table 2

HLA binding profiles of potential mimics from the alpha viral structural proteins. A total of 51 HLA class II alleles were used for the study.

PeptidePeptide Length (aa)Binding profile -HLA Class II
Nonamers generatedNonamers bound% binding
PPCIPCCYEKEPEETLRMLEDNV231500
PTVTYGK7500
EGLEVTWGNN10200
QAPSGFKYWLKE12400
DIPDFTRVVDAP14600
KPGRRERMCMKIENDCIFEVK211336
NADLAKLAFKRSSKYDLECAQIPVH251716
MKSDASKFTHEKPEGYYNWHHGAVQ251716
YSGGRFTIPTGAGKPGDSGRPIFDN251716
YNMDYPPFGAGRPGQFGDIQSRTPE2517212
SKDVYANTQLVLQRPGTVHVPYS2517212
APFGCQIATNPVRAMNCAVGNMPIS2517212
RKGKIHIPFPLANVTCMVPKA2113215
KGRVVAIVLGGANEGARTALSVVTW2517317
KFIVGPMSSAWTPFDNKIVVYKGDV2517318
PDYSCKVFTGVYPFMWGGAYCFCD2416319
PGYYQLL75120
DGTLKIQVSLQIG135120
FSTALAS75120
TSAPCTITGTMGHFILARCPKG2214321
AYEHVTVIPNTVGVPYKTLVNRPGY2517424
CGTAEC124125
KWQYNSPLVPR113133
FIPTQTFY85240
HLA binding profiles of potential mimics from the alpha viral structural proteins. A total of 51 HLA class II alleles were used for the study. As illustrated in Fig. 3, maximum numbers of nonamers were found to be recognized by the allele HLA DRB1_0308, which bound to nine of the conserved region peptides. DRB1_0101 bound to eight and DRB1_1321 bound to seven, DRB1_0102, 0401, 0426, 1101, 1107 and 1120 bound to six conserved region peptides respectively.
Figure 3

Number of conserved regions from alpha virus structural proteins binding to individual class II alleles as predicted by ProPred II server. Alleles that exhibited binding to more than 3 peptides are represented out of the 51 alleles studied.

Number of conserved regions from alpha virus structural proteins binding to individual class II alleles as predicted by ProPred II server. Alleles that exhibited binding to more than 3 peptides are represented out of the 51 alleles studied. Since the quality of immune response elicited by the mimic peptide in humans should be similar to the one elicited by the viral peptide for an efficient autoimmune response to occur, the structure of the HLA DRII-peptide complex was analyzed. Molecular docking analysis was performed to assess the structural similarity in the binding patterns of the viral peptide and its homologous region in the human protein. The ability of one of the potential conserved regions, FPLANVTCM (viral derived) and its corresponding homologous region KPLANVTLM (human derived) to bind to a class II HLA allele was assessed by docking the peptides in the binding groove of HLA-DRB1, an allele known to predispose individuals to rheumatoid arthritis[19]. The peptides were docked using GalaxyPepDock server and the docked peptides are shown in Fig. 4. The root mean square deviation between the docked peptides shown in Fig. 4 is 0.86 Å.
Figure 4

A Structural representation of the peptide-MHC complex generated by docking of the peptide FPLANVTCM from the alpha virus structural polyproteins (cyan) and the peptide KPLANVTLM from the alpha 1-B glycoprotein of human (red) into the binding groove of HLA-DRB1. Both the peptides exhibit similar fit and interactions with the amino acids (yellow) in the binding pocket of HLA.

A Structural representation of the peptide-MHC complex generated by docking of the peptide FPLANVTCM from the alpha virus structural polyproteins (cyan) and the peptide KPLANVTLM from the alpha 1-B glycoprotein of human (red) into the binding groove of HLA-DRB1. Both the peptides exhibit similar fit and interactions with the amino acids (yellow) in the binding pocket of HLA. The docked p-MHC complexes were analyzed for the hydrogen bonding interactions between the peptides and HLA-DRB1. The binding interactions between the viral and human peptide with HLA-DRB1 were visualized using LigPlot+. Post docking analysis of the peptides revealed significant interactions with HLA-DRB1. In viral peptide-HLA-DRB1 complex, ten hydrogen bonds within a distance of 3.5 Å suggested the stability of the peptide in the binding groove of the pocket. Similarly, a set of eleven hydrogen bonds were formed between human peptide and HLA-DRB1 within a distance of 3.5 Å. Furthermore, it can be seen in Fig. 5 that the amino acids in the conserved regions of both the peptides form identical hydrogen bonds with the amino acids (Ser51, Asn260, Lys249, Trp235, Asn67, Tyr 208) present in the binding pocket of HLA-DRB1.
Figure 5

Analysis of molecular interactions of viral peptide docked onto HLA-DRB1 (top) and its homologous region in the human protein docked onto HLA-DRB1 (bottom).

Analysis of molecular interactions of viral peptide docked onto HLA-DRB1 (top) and its homologous region in the human protein docked onto HLA-DRB1 (bottom).

Potential mimics could also act as B cell epitopes

To further strengthen the case of alpha viral induced molecular mimicry, we have analyzed the 24 conserved regions for the presence of both linear and structural B cell epitopes which in turn is a measure of their ability to act as stimulators of B cells and generate an autoimmune reaction against its homologous region in the human protein leading to polyarthralgia. Linear B cell epitope prediction was performed using three different prediction algorithms namely Bepipred linear epitope prediction, Emini surface accessibility scale and Kolaskar and Tongaonkar antigenicity scale. Prediction results are summarized in Table 3.
Table 3

Analysis of conserved regions of alpha viruses sharing homology with human peptides (refer Table 1) for their ability to act as B cell epitopes.

Conserved regionBepipredESAKT
FIPTQTFY×××
KPGRRERMCMKIENDCIFEVK
NADLAKLAFKRSSKYDLECAQIPVH××
MKSDASKFTHEKPEGYYNWHHGAVQ×
YSGGRFTIPTGAGKPGDSGRPIFDN××
KGRVVAIVLGGANEGARTALSVVTW×
PPCIPCCYEKEPEETLRMLEDNV
PGYYQLL××
DGTLKIQVSLQIG××
TSAPCTITGTMGHFILARCPKG×
KWQYNSPLVPR
RKGKIHIPFPLANVTCMVPKA×
PTVTYGK××
EGLEVTWGNN××
AYEHVTVIPNTVGVPYKTLVNRPGY×
CGTAEC×××
PDYSCKVFTGVYPFMWGGAYCFCD××
KFIVGPMSSAWTPFDNKIVVYKGDV××
YNMDYPPFGAGRPGQFGDIQSRTPE×
SKDVYANTQLVLQRPAAGTVHVPYS
QAPSGFKYWLKE×
APFGCQIATNPVRAMNCAVGNMPIS×
DIPDAAFTRVVDAP
FSTALAS×

The algorithms used for prediction are Bepipred, Emini Surface Accessibility Area (ESA), Kolaskar and Tongaonkar (KT). Tick (✓) indicates that it is a predicted potential B cell epitope and cross (×) indicates that it is not a potential B cell epitope.

Analysis of conserved regions of alpha viruses sharing homology with human peptides (refer Table 1) for their ability to act as B cell epitopes. The algorithms used for prediction are Bepipred, Emini Surface Accessibility Area (ESA), Kolaskar and Tongaonkar (KT). Tick (✓) indicates that it is a predicted potential B cell epitope and cross (×) indicates that it is not a potential B cell epitope. Out of the 24 conserved regions analyzed, 5 regions were predicted to be plausible B cell epitopes by all the three algorithms. 6 regions were predicted to be plausible B cell epitopes by at least 2 of the 3 algorithms tested. 12 regions were predicted to be B cell epitopes by only one of the algorithm. Only one out of the 24 conserved regions was not predicted as B cell epitope by all the three algorithms. Interestingly, 9 out of the 24 conserved regions shared homology with human proteins which were experimentally proven to have antibodies developed against them in patients diagnosed with rheumatoid arthritis (highlighted in bold in Table 1). To further validate if the potential mimics could act as plausible B cell epitopes also at a conformational level, CHIKV structural polyprotein was used as a model to locate conformational B cell epitopes using Ellipro server from IEDB. As shown in Fig. 6, the parts of the peptides MKSDASKFTHEKPEGYYNWHHGAVQ and YSGGRFTIPTGAGKPGDSGRPIFDN (labelled A in Fig. 6) present on the Capsid protein, the part of the peptide RKGKIHIPFPLANVTCMVPKA (labelled B), PTVTYGK (labelled C) and EGLEVTWGNN (labelled D) present on the p62 protein are exposed to the surface and predicted to be potential conformational B cell epitopes.
Figure 6

Epitopes predicted based on the 3D structure of the Chikungunya virus structural polyprotein (PDB ID: 3J2W) using ElliPro. The predicted peptides are shown in sphere representation and are colored yellow.

Epitopes predicted based on the 3D structure of the Chikungunya virus structural polyprotein (PDB ID: 3J2W) using ElliPro. The predicted peptides are shown in sphere representation and are colored yellow.

Discussion

Viral infection as one of the etiological agents for autoimmune diseases is being discussed for a long time. Several mechanisms have been proposed to explain this phenomenon including molecular mimicry, bystander activation and viral persistence[20] individually or in multiple combinations to account for the immunopathology observed at the site of infection and/or sites of autoimmune disease and normally the infections precede the occurrence of inflammation in the target organ[21]. Triggered immune response as result of infection is critical for viral clearance. However, in some instances, immune regulatory mechanisms may aberrate, leading to the breakdown of self-tolerance, resulting in immune-mediated attack directed against both viral and self-antigens as it happens in the case of molecular mimicry or shared homology between viral and host epitopes[22,23]. Human infections caused by the alphaviruses group share a common feature of the clinical picture of arthralgia and chronic arthritis that closely resembles rheumatoid arthritis[7,24,25]. Further, more severe and delayed recovery of alpha viral disease in patients with pre-existing arthritic conditions has been reported[26]. Though the cellular components and inflammatory scenario involved in such conditions have been looked at[27], knowledge about the actual cause of such persistent symptoms characterized by articular disease and myalgia remains sparse. Though one of the speculations regarding the basis for this rheumatic like manifestations is the possible induction of autoimmunity as a side effect of adaptive immune responses, caused by cross-reactivity between viral and host antigens[24,28], there are no systematic studies towards proving this hypothesis. In the present work, through an in silico analysis we have identified the presence of conserved regions in the structural polyprotein of alphaviruses. A high sequence identity (71%) suggests that the origin of commonality in the clinical features may lie in the amino acid sequence of the structural polyprotein of the viruses. On comparative analysis of these regions of consensus with the human proteome, we have identified proteins that share stretches of homologous regions with the structural polyprotein. Further, very interestingly we found that presence of auto antibodies specific to some of these proteins in rheumatoid arthritis (Table 1). Serum and synovial fluid from RA patients have been shown to contain auto antibodies specific to some of the proteins that we identified in our analysis. These proteins are highlighted in table-1. The underlined region of the peptide SKDVYANTQLVLQRPAAGTVHVPYS has been experimentally tested in mice to induce polyarthralgia. The mouse injected with this peptide recapitulated the pathology seen chikungunya infection[29]. These reports give further credibility to our findings and strengthen our current premise. Our results further show that these regions are immuno-dominant stressing their ability for induction of potential auto-immune reaction. Based on the amino acid sequence analysis, twenty-four of the conserved regions (Table 2) bound to HLA class II alleles, suggesting the possibility of calling in for T helper cell responses. Three conserved regions were predicted to be potential B cell epitopes by all the algorithms tested. Since majority of the antigenic epitopes have been shown to have high surface accessibility, we hypothesized that identical amino acids would give rise to similar structural features too. Therefore, we validated the antigenicity of chosen conserved regions at structural level. The root mean square deviation between the peptides is 0.86 Å which suggests that the two peptides bind to class II MHC in a similar orientation (Fig. 4). Docking the conserved region (FPLANVTCM) from the structural polyprotein and its homologous sequence in the human proteome revealed similar interactions with HLA-DRB1 (Fig. 5). Plausible B cell epitope prediction analysis based on the structure of CHIKV structural polyprotein concurred with some of the conserved regions we identified. Thus, validation at both the amino acid and structural level affirmed the antigenic potential of conserved regions in the structural polyprotein. In addition, through the revelation of presence of significant conserved regions in the alphaviral proteins, we surmise that antibodies for differential diagnosis of alpha virus infections should be directed towards the non-conserved regions of the structural proteins for higher specificity. In summary (Fig. 7), our results computationally tease out a possible mechanism mediated through molecular mimicry leading to development of autoimmunity during alpha virus infections which could culminate in arthritis like conditions in infected individuals.
Figure 7

Highly conserved peptide sequences present in the structural polyprotein of alphaviruses are antigenic and could act as a trigger for autoimmune reactions explaining one of the possible origins for polyarthritis post-arthritogenic alphaviral infections.

Highly conserved peptide sequences present in the structural polyprotein of alphaviruses are antigenic and could act as a trigger for autoimmune reactions explaining one of the possible origins for polyarthritis post-arthritogenic alphaviral infections.

Methods

Viral protein sequences

We carried out the bioinformatic analysis using protein sequences available for the clinical isolates of alphaviruses known to cause polyarthralgia[30-33] and used as protype strains in the literature[29]. Structural polyproteins of the six arthritogenic alphaviruses: Chikungunya virus (strain S2-African prototype)(UniProt ID: Q8JUX5), the Ross river virus (strain NB5092) (UniProt ID: P13890), the Semliki forest virus (UniProt ID: P03315), the Mayaro virus (strain Brazil) (UniProt ID: Q8QZ72), the O’nyong-nyong virus (strain SG650) (UniProt ID: O90369) and the Barmah forest virus (UniProt ID: P89946) were investigated for the presence of conserved regions. Amino acid sequences of these proteins were retrieved from the UniProt database[34].

Multiple sequence alignment

Conserved regions within the structural polyproteins were identified by multiple sequence alignment using MUSCLE alignment algorithm[35] in MEGA 7.0[36]. A stretch of amino acids was scored as conserved region if it is present in at least four out of the six alpha viruses.

Homology search

BLASTp program (https://blast.ncbi.nlm.nih.gov/Blast.cgi)[37] was employed to expound the existence of sequence homology between the conserved regions identified in the alpha viruses and the human proteome. The search set was limited to Homo sapiens (taxid: 9606) in the UniProtKB/Swiss-Prot database. Default BLASTp algorithm parameters were used and the results were limited only to the top 100 hits. The homologous proteins list obtained from the BLAST search was manually curated using the Open Targets Platform server[38] to identify if a given protein has been reported to be involved in the pathogenesis of rheumatoid arthritis. The Open Targets Platform server is a repository of human proteins and their involvement in diseases at various levels. These proteins bearing the homologous sequences to conserved regions within the structural polyproteins were chosen for further investigation.

Prediction of potential T cell epitopes

The shortlisted conserved regions in the structural polyprotein were explored for their ability to act as T cell epitopes. Peptides from these regions were subjected to HLA II binding analysis using ProPred II analysis tool[39]. The server uses quantitative matrices for predicting binding of nonamers to HLA class II. Quantitative matrices are chosen for predictive binding because they provide a linear model and are easy to implement. Nonameric peptides generated from the conserved regions, which were predicted as potential binders for HLA class II alleles were selected for further analysis. A frequency distribution of the ability of these peptides to bind to multiple HLA class II alleles was generated. Peptide-MHC docking was performed using GalaxyPepDock[40] server to evaluate the similarity in binding patterns among a conserved region in the alphavirus structural polyprotein and its corresponding homologous region in the human protein. GalaxyPepDock works by identifying templates from experimentally resolved structure databases to predict the protein structure, followed by an energy-based optimization to provide structural flexibility. Default parameters available with the tool have been used and the back-end data containing the parameters used for docking are not available. Crystal structure of HLA-DRB1 complexed with Type II collagen peptide (PDB ID: 6BIN) was retrieved from Protein Data Bank database[41]. The resident peptide in the crystal structure was stripped off using PyMol to make the binding groove of HLA-DRB1 available for docking the viral peptide and its human homologue.

Prediction of potential linear B cell epitopes

Shortlisted conserved regions from the structural polyprotein were explored for their ability to act as B cell epitopes. Full length amino acid sequence of structural polyprotein of Chikungunya virus (strain S27-African prototype) (UniProt ID: Q8JUX5) was subjected to linear B cell epitope prediction analysis available at Immune epitope database (IEDB)[42]. The analysis was performed using three different prediction algorithms namely, Bipipred, Emini surface accessibility and Kolaskar and Tongaonkar with default algorithm parameters. Further, to validate if the conserved regions act as potential linear B cell epitopes at the structural level, we employed ElliPro server[43] to predict the regions on the structural polyprotein of the Chikungunya virus (PDB ID: 3J2W). ElliPro accepts a PDB structure as input and uses three different algorithms based on protrusion index of the residues, protein shape approximation and neighboring residues clustering to predict linear antibody-based epitopes. Default parameters of the ElliPro program were used for prediction analysis. Supplementary information
  39 in total

1.  Characterization of Ross River virus tropism and virus-induced inflammation in a mouse model of viral arthritis and myositis.

Authors:  Thomas E Morrison; Alan C Whitmore; Reed S Shabman; Brett A Lidbury; Suresh Mahalingam; Mark T Heise
Journal:  J Virol       Date:  2006-01       Impact factor: 5.103

Review 2.  The molecular and cellular aspects of arthritis due to alphavirus infections: lesson learned from Ross River virus.

Authors:  Nestor E Rulli; Julian Melton; Anja Wilmes; Gary Ewart; Suresh Mahalingam
Journal:  Ann N Y Acad Sci       Date:  2007-04       Impact factor: 5.691

3.  A mouse model of chikungunya virus-induced musculoskeletal inflammatory disease: evidence of arthritis, tenosynovitis, myositis, and persistence.

Authors:  Thomas E Morrison; Lauren Oko; Stephanie A Montgomery; Alan C Whitmore; Alina R Lotstein; Bronwyn M Gunn; Susan A Elmore; Mark T Heise
Journal:  Am J Pathol       Date:  2010-12-23       Impact factor: 4.307

4.  Chikungunya virus and arthritic disease.

Authors:  Felicity Burt; Weiqiang Chen; Suresh Mahalingam
Journal:  Lancet Infect Dis       Date:  2014-09       Impact factor: 25.071

5.  Infection with Mayaro virus in a French traveller returning from the Amazon region, Brazil, January, 2010.

Authors:  M C Receveur; M Grandadam; T Pistone; D Malvy
Journal:  Euro Surveill       Date:  2010-05-06

6.  Chikungunya virus arthritis in adult wild-type mice.

Authors:  Joy Gardner; Itaru Anraku; Thuy T Le; Thibaut Larcher; Lee Major; Pierre Roques; Wayne A Schroder; Stephen Higgs; Andreas Suhrbier
Journal:  J Virol       Date:  2010-06-02       Impact factor: 5.103

7.  Arthritis and arthralgia three years after Sindbis virus infection: clinical follow-up of a cohort of 49 patients.

Authors:  Satu Kurkela; Tapani Helve; Antti Vaheri; Olli Vapalahti
Journal:  Scand J Infect Dis       Date:  2008

Review 8.  Alphaviruses: an emerging cause of arthritis?

Authors:  Auli Toivanen
Journal:  Curr Opin Rheumatol       Date:  2008-07       Impact factor: 5.006

Review 9.  Arthritogenic alphaviruses--an overview.

Authors:  Andreas Suhrbier; Marie-Christine Jaffar-Bandjee; Philippe Gasque
Journal:  Nat Rev Rheumatol       Date:  2012-05-08       Impact factor: 20.543

10.  New World and Old World Alphaviruses Have Evolved to Exploit Different Components of Stress Granules, FXR and G3BP Proteins, for Assembly of Viral Replication Complexes.

Authors:  Dal Young Kim; Josephine M Reynaud; Aliaksandra Rasalouskaya; Ivan Akhrymuk; James A Mobley; Ilya Frolov; Elena I Frolova
Journal:  PLoS Pathog       Date:  2016-08-10       Impact factor: 6.823

View more
  9 in total

1.  Immunopathogenesis of alphaviruses.

Authors:  Victoria K Baxter; Mark T Heise
Journal:  Adv Virus Res       Date:  2020-07-08       Impact factor: 9.937

2.  Serum autoantibodyome reveals that healthy individuals share common autoantibodies.

Authors:  Mahasish Shome; Yunro Chung; Ramani Chavan; Jin G Park; Ji Qiu; Joshua LaBaer
Journal:  Cell Rep       Date:  2022-05-31       Impact factor: 9.995

3.  Human Coronary Plaque T Cells Are Clonal and Cross-React to Virus and Self.

Authors:  Roshni Roy Chowdhury; Jessica D'Addabbo; Xianxi Huang; Stefan Veizades; Koki Sasagawa; David M Louis; Paul Cheng; Jan Sokol; Annie Jensen; Alexandria Tso; Vishnu Shankar; Ben Shogo Wendel; Isaac Bakerman; Grace Liang; Tiffany Koyano; Robyn Fong; Allison N Nau; Herra Ahmad; Jayakrishnan Gopakumar; Robert Wirka; Andrew S Lee; Jack Boyd; Y Joseph Woo; Thomas Quertermous; Gunsagar Singh Gulati; Siddhartha Jaiswal; Yueh-Hsiu Chien; Charles Kwok Fai Chan; Mark M Davis; Patricia K Nguyen
Journal:  Circ Res       Date:  2022-04-18       Impact factor: 23.213

Review 4.  Reactive Arthritis Update: Spotlight on New and Rare Infectious Agents Implicated as Pathogens.

Authors:  Henning Zeidler; Alan P Hudson
Journal:  Curr Rheumatol Rep       Date:  2021-07-01       Impact factor: 4.592

5.  Does SARS-CoV-2 Trigger Stress-InducedAutoimmunity by Molecular Mimicry? A Hypothesis.

Authors:  Francesco Cappello; Antonella Marino Gammazza; Francesco Dieli; Alberto Jl Macario
Journal:  J Clin Med       Date:  2020-06-29       Impact factor: 4.241

Review 6.  Emerging Concepts in Immune Thrombotic Thrombocytopenic Purpura.

Authors:  Aicha Laghmouchi; Nuno A G Graça; Jan Voorberg
Journal:  Front Immunol       Date:  2021-11-11       Impact factor: 7.561

7.  ImitateDB: A database for domain and motif mimicry incorporating host and pathogen protein interactions.

Authors:  Sonali Tayal; Venugopal Bhatia; Tanya Mehrotra; Sonika Bhatnagar
Journal:  Amino Acids       Date:  2022-04-30       Impact factor: 3.789

Review 8.  Cellular and molecular mechanisms breaking immune tolerance in inborn errors of immunity.

Authors:  Georgios Sogkas; Faranaz Atschekzei; Ignatius Ryan Adriawan; Natalia Dubrowinskaja; Torsten Witte; Reinhold Ernst Schmidt
Journal:  Cell Mol Immunol       Date:  2021-04-01       Impact factor: 11.530

9.  Single-cell analysis of arthritogenic alphavirus-infected human synovial fibroblasts links low abundance of viral RNA to induction of innate immunity and arthralgia-associated gene expression.

Authors:  Fabian Pott; Dylan Postmus; Richard J P Brown; Emanuel Wyler; Elena Neumann; Markus Landthaler; Christine Goffinet
Journal:  Emerg Microbes Infect       Date:  2021-12       Impact factor: 7.163

  9 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.