Literature DB >> 31955622

Select targeting of intracellular Toll-interleukin-1 receptor resistance domains for protection against influenza-induced disease.

Kari Ann Shirey1, Wendy Lai1, Lindsey J Brown2, Jorge C G Blanco3, Robert Beadenkopf2, Yajing Wang2,4, Stefanie N Vogel1, Greg A Snyder1,2.   

Abstract

Entities:  

Keywords:  Innate immunity; Toll-like receptor; influenza

Mesh:

Substances:

Year:  2020        PMID: 31955622      PMCID: PMC6974880          DOI: 10.1177/1753425919846281

Source DB:  PubMed          Journal:  Innate Immun        ISSN: 1753-4259            Impact factor:   2.680


× No keyword cloud information.

Introduction

The ability of TLRs and related molecules to dimerize and to associate with intracellular adapters or co-receptors (e.g., IL-1 accessory protein) is dependent on TIR domain interactions.[1],[2] A review of TIR domain structures and decoy TIR peptide sequences shown to inhibit TLR signaling revealed that approximately half contained cysteine (Cys) residue(s) that might be integral for this interaction.[3] Based on these initial observations, we hypothesized that intercellular TIR Cys modification and/or interaction may have a greater functional importance than currently appreciated. An in-depth bioinformatics examination of human TIR domain structures and their reported biological interfaces, coupled with functionally characterized TIR mutants and inhibitory peptides, identified a highly conserved region involving the receptor TIR domains and Cys residues. Accordingly, we sought to identify inhibitory compounds shown to target specific TIR Cys residues and assess their ability to inhibit TLR-specific functions and specifically, those that target a highly conserved C helix Cys-containing region within TIR domains. In this study, we confirm that TAK-242 (resatorvid), a small molecule TLR4 antagonist that blocks signaling by binding to C747 of the intracellular TIR domain of TLR4, blocks both LPS-induced signaling, as well as protects mice in a lethal model of influenza.

Materials and methods

Reagents

Sterile TAK-242 was purchased from Millipore-Sigma (CAS 243984-11-4). HEK293-Blue™ null, TLR4 and MD2-CD14 cells and reagents were purchased (InvivoGen, San Diego, CA) and used as described. DMEM Media and supplements were purchased from GIBCO-Life-technologies. Mutant plasmid Cys747Ala TLR4 was engineered by quick-change mutagenesis using WT hTLR4 as a template.[4] Fugene transfection reagent was purchased from Promega and used as directed.

Molecular visualization and modeling

The crystal structures and reported biological interfaces for TLR1, TLR2, TLR6, TLR10, TIRAP, MyD88, TRIF, and TRAM were examined using Chimera and Pymol programs.[5],[6] TLR4 TIR, dimer, and ternary complex with TIRAP and MyD88, were modeled based on the reported crystal structures for TLR10 and TLR6 TIR domain, TIRAP, and MyD88, similar to previously described approaches.[7-10] Briefly, a least-squares comparison of the TLR4 dimer was performed using reported biological interfaces for TIR 1, 2, 6, 10, TIRAP, and MyD88 aligned to chain B of TLR10 and TLR6. Figures were produced using Pymol.[6]

Sequence alignments

A sequence alignment of TLR and adapter TIR domains was performed using the corresponding TIR domains of TLR1-13, TIRAP, and MyD88 using Clustal W.[11] This sequence alignment was used to plot functionally characterized Cys TIR mutants, inhibitory peptides and reported interfaces.

Mice

Mice (6- to 8-wk-old, WT C57BL/6J) were purchased from The Jackson Laboratory (Bar Harbor, ME). All animal experiments were conducted with institutional IACUC approval from University of Maryland, Baltimore.

Virus

Mouse-adapted H1N1 influenza A/PR/8/34 virus (“PR8”) (ATCC, Manassas, VA) was grown in the allantoic fluid of 10-day-old embryonated chicken eggs as described,[12] and was kindly provided by Donna Farber (Columbia University).

Virus challenge and treatment

For survival experiments, C57BL/6J WT mice were infected with mouse-adapted influenza virus, strain A/PR/8/34 (PR8; ∼7500 TCID50, intranasally (i.n.), 25 μL/nares). This dose was found previously to kill ∼90% of PR8-infected mice.[13] Two days after infection, mice received either vehicle or TAK-242 (100 μg/mouse in 100 μL, i.p.) once daily for five consecutive days (days 2–6). Mice were monitored daily for survival, mass loss, and clinical signs of illness (e.g., lethargy, piloerection, ruffled fur, hunched posture, rapid shallow breathing, audible crackling) for 14 days. A clinical score ranging from 0 (no symptoms) to 5 (moribund) was ascribed to each mouse daily.[13] In some experiments, mice were euthanized at day 7 post-infection to harvest lungs for analysis of gene expression and to assess lung pathology.

Histology

Lungs were inflated and perfused and fixed with 4% paraformaldehyde. Fixed sections (8 μm) of paraffin-embedded lungs were stained with hematoxylin and eosin (H&E). Slides were randomized, read blindly, and examined for tissue damage and inflammatory cellular infiltration.[13]

Quantitative real-time PCR

Total RNA isolation and quantitative real-time PCR (qRT-PCR) were performed as previously described.[14] Levels of mRNA for specific genes are reported as relative gene expression normalized to mock-infected lungs.

Cell culture and NF-κB activation

HEK293 reporter cells (HEK-BluehTLR4, HEK-Blue™ null, and HEK- Blue™ CD14-MD2 cells InvivoGen, San Diego, CA) were maintained and sub-cultured according to manufacturer’s instructions using DMEM media containing 4.5 g/L Glc, 10% (v/v) FBS, 50 U/mL penicillin, 50 μg/mL streptomycin, 100 μg/mL Normocin™, 2 mM L-glutamine, at 37°C in 5% CO2 and supplemented with appropriate selection antibiotic for each cell type.

SEAP inhibition assay in HEK-Blue™ TLR4 and null cells TLR4-treated cells

The growth media of HEK293-Blue™ cultured cells in a vented T-75 flask at log phase growth 50–80% was removed by pipette and the cells gently rinsed using 10 mL of pre-warmed 1× PBS. Cells were detached by gentle pipetting 2–5 mL of 1× PBS. Re-suspended cells were counted and cell suspension of 1.0 × 105 cells/mL made using prepared HEK-Blue™ Detection media, and immediately added 180 μL to 96-well tissue culture plate wells. Cells were then treated with 20 μL of detection media alone and or in combination with LPS of Escherichia coli K-12 W3110 strain (final concentration 10 ng/mL), TAK-242 [0–50 μΜ] dissolved in DMSO, or vehicle alone (DMSO 0–0.2% final concentration) in triplicate. Tissue culture plates (96-well) were returned for incubation at 37°C in 5% CO2. After 16 h, plate absorbance was measured at 640 nm using a Versa Max Microplate Reader (Molecular Devices Inc., Sunnyvale, CA, USA). Absorbance readings were graphed and statistics performed using Graph Pad PRISM. All samples performed in triplicate and are representative of at least three separate experiments. Purified LPS from E. coli K-12 W3110 strain, was a gift from Robert Ernst.

Statistics

Statistical differences between two groups were determined using an unpaired, two-tailed Student’s t test with significance set at P < 0.05. For comparisons between ≥ 3 groups, analysis was done by one-way ANOVA followed by a Tukey’s multiple comparison test with significance determined at P < 0.05. For survival studies, a Log-Rank (Mantel-Cox) test was used.

Results

Bioinformatic analysis of TIR domain reveals a highly conserved C helix motif among bacterial and mammalian TIR proteins

Previous reviews of reported biological interfaces for TIR crystal structures revealed several modified cysteines among receptor and adapter TIR proteins.[3],[7],[8],[10],[15-18] These include several unique Cys modifications and interactions at suspected TIR–TIR interfaces and functionally important regions in the reported structures of TIR1, TIR2, TIR6, and TIR10, as well as in TIR domain-containing adapters MyD88 and the MyD88 adapter like (Mal) or TIR adapter protein (TIRAP).[3],[8],[10],[15],[16],[18],[19] A review of TIR-derived inhibitor peptides at the time also identified a preponderance of functionally characterized inhibitory “decoy peptides” that contain one or more Cys residues as part of their functional sequence (Table 1).[3] In contrast, scrambled control antennapedia coupled decoy peptides (RQIKIWFQNRRMKWKK-SLHGRGDPMEAFII) that were biologically inert did not contain cysteines as part of their functional sequence.[20-23] To explore the potential role of intracellular TIR Cys in TIR domain function further, we performed a sequence alignment of the available TLR TIR domains and compared this alignment with reported X-ray and NMR structures. This sequence alignment showed several highly conserved Cys residues among various receptor and adapter TIR proteins (Supplemental Figure S1). An in-depth examination of human TIR domain structures and their reported biological interfaces, coupled with functionally characterized TIR mutants and inhibitory peptides, identified a highly conserved region involving the receptor TIR domains and cysteines (Figure 1). Based on this preliminary survey of TIR domain sequences, structures, and inhibitory peptides, we queried whether this region centered around a specific Cys may be playing a larger role in mediating TIR signaling than previously appreciated. A conserved Cys located on the C helix of multiple receptor TIR domains is observed at several reported biological interfaces (Figure 1a). This conserved C helix Cys is located within the WXXXE motif identified among NAD-consuming bacterial TIRs.[8],[24],[25] Residues located within this motif are important for substrate binding and enzymatic function in NAD-consuming bacterial TIRs.[8],[10],[24],[26],[27] Additionally, several functionally characterized TIR mutants and inhibitory decoy peptides also contain a highly conserved sequence motif, which includes a Cys (Table 1 and Figure 1c). Based on the observation of this highly conserved sequence motif involving NAD active site residues and C-helix containing Cys residue in multiple receptor TIR proteins, as well as functionally characterized inhibitory decoy peptides, we sought to identify compounds reported to bind TIR cysteines selectively.
Table 1.

Summary of Cys-containing inhibitory and decoy TIR peptides.

DesignationRegionSequence / FormulaEffect
BB loopBBhydrocinnamoyl-1-valyl-MyD88-IL1-1RI
BB loopBBRDVLPGTMyD88-MyD88
MyD88-I[a]BBRDVLPGTCVNSMyD88
Decoy peptide[a]BBIVFAEMPCGRLHLQTLR4 inhibition
Decoy peptide[a]BBVSDRDVLPGTCVWSTLR4 inhibition
Decoy peptideBBRDVLPGTIL-1 inhibition
Decoy peptideBBLHKRDFVPGKWllDTLR2,TLR4 inhibition
Decoy peptideBBLHYRDFIPGVAIAATLR2, TLR4 inhibition
A46 peptideHelix 1KYSFKLILAEYTLR4 inhibition
Decoy peptideCC'LDEDEHGLHTKYSEFIR inhibition IL17/IL25
TLR4 DP[a]TMAGC KKYSRG ESIYDTLR4 but not TLR2
TLR4 DP[a]AB, βBEEGVPRFHLCTLR4 but not TLR2
TLR4 DPβB,BB, αBLHYRDFIPGVAIAATLR4 but not TLR2
TLR4 DPαDLRQQVELYRLLSRTLR4 but not TLR2
TLR4 DPαEHIFWRRLKNALLDTLR4 but not TLR2
MAL DP[a]αA,AB, βBEGSQASLRCFTLR4, TLR2/1
MAL DP[a]αB,BCELQALSRSHCRTLR4
MAL DP[a]CC, C-HELIXPGFLRDPW CKYQMLTLR4, TLR2/1
MALDPDD, αD,DEAAYPPELRFMYYVDTLR4
MAL DPαEGG FYQVKEAVIHYTLR4
2Rl PRE TIR[a]PRE-TIRRKPKKAPCRDVCYD
2R2A HELIXEQDSHWVENLMVQQ
2R3[a]AB LOOPENSDPPFKLC
2R3-4[a]B STRANDPPFKLCLHKRDF
2RSB HELIXNllDSIEKSHKT
2R6[a]C HELIXENFVRSEWCKYEL
2R7[a]CD LOOPFSHFRLFDENNDAA
2R8D STRANDLLEPIERKAI
2R9[a]DD LOOPPQRFKLRKIMNT

aCysteine containing peptide.

Figure 1.

Conserved cysteines at TIR–TIR interfaces and C helix. (a) Structures of cytoplasmic TLR1, 2 and 6, and TIR adapter protein TIR domains. Inset boxes show conserved C helix (light grey) and Cys side chains. (b) Structures of MAL/TIRAP and MyD88. Inset box for MAL/TIRAP illustrates C91, which has been shown to require glutathionylation for signaling, as well as unique disulfide bond interactions between C89 and C134, which results in an extended AB loop, a collapsed BB loop, and a noncanonical TIR fold.[8],[9],[18] Inset box for MyD88 illustrates unique crystal packing interactions involving Cys203 and Cys280 and the human mutation Arg to Cys at position 196 (R196C) in patients with deficient MyD88 signaling and a susceptibility to pyogenic infections.[45] (c) Sequence alignment of TLRs and TIRAP C helix. Amino acids W, C, and E are conserved within the WxxxE motif observed in bacterial and NADase TIR proteins. TAK-242 binds C747 found on the C helix of TLR4 TIR domain.[30]

Summary of Cys-containing inhibitory and decoy TIR peptides. aCysteine containing peptide. Conserved cysteines at TIR–TIR interfaces and C helix. (a) Structures of cytoplasmic TLR1, 2 and 6, and TIR adapter protein TIR domains. Inset boxes show conserved C helix (light grey) and Cys side chains. (b) Structures of MAL/TIRAP and MyD88. Inset box for MAL/TIRAP illustrates C91, which has been shown to require glutathionylation for signaling, as well as unique disulfide bond interactions between C89 and C134, which results in an extended AB loop, a collapsed BB loop, and a noncanonical TIR fold.[8],[9],[18] Inset box for MyD88 illustrates unique crystal packing interactions involving Cys203 and Cys280 and the human mutation Arg to Cys at position 196 (R196C) in patients with deficient MyD88 signaling and a susceptibility to pyogenic infections.[45] (c) Sequence alignment of TLRs and TIRAP C helix. Amino acids W, C, and E are conserved within the WxxxE motif observed in bacterial and NADase TIR proteins. TAK-242 binds C747 found on the C helix of TLR4 TIR domain.[30]

TAK-242 blocks LPS activation of HEK-TLR4 cells, but not HEK-TLR4 Cys747Ala mutant cells

To confirm TLR4 specificity of TAK-242, we compared NF-κB activation stimulated by LPS in the absence or presence of TAK-242 in stably transfected secreted embryonic alkaline phosphatase (SEAP) HEK-293 reporter cell lines, e.g., HEK293-TLR4 (“TLR4”), and in HEK293 cells that do not express TLR4 (“HEK293-null” and “HEK293-CD14-MD2”). TAK-242 abrogated LPS-mediated NF-κB activation in HEK-TLR4 and had no effect on vehicle-treated cells (Supplemental Figure S2). HEK-null, HEK-CD14-MD2 cells (stably expressing MD2 and CD14 coreceptors, but lacking TLR4), or HEK-CD14-MD2 cells transiently transfected with mutant TLR4 (C747S) failed to respond to LPS stimulation when compared with HEK293-CD14-MD2 cells transiently transfected with wildtype (WT) TLR4, further supporting the importance of this residue (Supplemental Figure S3).

Targeting Cys-747 of TLR4 TIR domain protects against lethal influenza infection

TLR4 antagonists that block the extracellular co-receptor, MD-2, e.g., Eritoran[13],[28] and FP7,[29] or bind the extracellular domain of TLR4, e.g., anti-TLR4 Ab,[28] have been shown to be protective against lethal mouse influenza infection. To date, all of the TLR4-specific antagonists used to blunt influenza-induced disease have targeted the extracellular domain of TLR4.[13],[29] The small molecule inhibitor TAK-242 (resatorvid) antagonizes TLR4 by binding to the intracellular TIR domain of TLR4 and has been shown to be specific for intracellular Cys TLR4-C747 (Figures 1 and 2).[27-33] Therefore, we sought to determine if specific targeting of the TLR4 TIR Cys-747 with TAK-242 would also protect mice against lethal influenza infection.
Figure 2.

TLR4 Signaling schematic. Ligand-induced TLR4 signaling leads to NF-κB and IRF-3 activation and inflammation. Overview of TLR4 signaling. Extracellular TLR4 antagonist Eritoran acts by blocking LPS binding to MD-2, while TAK-242 targets cytoplasmic TLR4 TIR domain. Shown is a surface representation of cytoplasmic TLR4 receptor and adapter TIR interactions. TAK-242 is represented as ball and stick (green), highlighted surfaces (red, magenta, and orange) depict inhibitory peptides and blue circle indicates location of Cys 747 at predicted interface found on helix C of the TIR domain of TLR4.

TLR4 Signaling schematic. Ligand-induced TLR4 signaling leads to NF-κB and IRF-3 activation and inflammation. Overview of TLR4 signaling. Extracellular TLR4 antagonist Eritoran acts by blocking LPS binding to MD-2, while TAK-242 targets cytoplasmic TLR4 TIR domain. Shown is a surface representation of cytoplasmic TLR4 receptor and adapter TIR interactions. TAK-242 is represented as ball and stick (green), highlighted surfaces (red, magenta, and orange) depict inhibitory peptides and blue circle indicates location of Cys 747 at predicted interface found on helix C of the TIR domain of TLR4. Briefly, C57BL/6J mice were infected i.n. with a dose of influenza A/PR/8/34 (“PR8”) previously determined to kill ∼90% of mice (∼LD90).[13] Two days later, TAK-242 was administered once daily for 5 consecutive days (100 μg/mouse; i.p.; days 2-6) (Figure 3a). Each mouse was monitored daily for survival and clinical symptoms (e.g., lethargy, piloerection, ruffled fur, hunched posture, etc.)[13] for 14 days. TAK-242-treated mice were significantly (P < 0.006) protected from PR8-induced lethality, while 80% of mice administered vehicle succumbed to infection (Figure 3b, left panel). Clinical scores were also more severe (Figure 3b, right panel) in vehicle-treated mice than in mice treated with TAK-242. To examine the effect TAK-242 has on influenza-induced lung pathology, groups of mice were infected with PR8 and treated with vehicle or TAK-242 as in Figure 3a, and were euthanized 7 days post-infection. Extensive lung damage was observed in mice infected with PR8 and treated with vehicle (Figure 3c, left panel), while lung sections from mice infected with PR8 and treated with TAK-242 exhibited less inflammatory infiltrates and lung damage (Figure 3c, right panel). Influenza infection potently induces expression of inflammatory genes that contribute to the overall inflammatory response.[34],[35] To assess whether TAK-242 could mitigate PR8-induced gene expression, lung homogenates from the same samples used for histopathology were also used to measured gene expression. TAK-242-treated mice had significantly lower gene expression of NF-κB- and IRF-3-dependent genes (IL-1β, TNF-α, and IFN-β, RANTES, respectively) compared with vehicle-treated mice (Figure 3d). Taken together, our observations that TAK-242 treatment blocks TLR4-mediated, influenza-induced acute lung injury support the central hypothesis that targeting TIR Cys interactions may be a viable therapeutic approach for influenza.
Figure 3.

TAK-242 therapy improves survival in a mouse model of influenza. (a) Basic protocol for in vivo survival assay of mice infected with PR8. WT mice infected with PR8 (∼7500 TCID50; i.n.) on day “0”. Mice received TAK-242 (100 µg/mouse i.p.) or vehicle (saline and 0.001% DMSO) once daily for 5 days (days 2–6). (b) Survival was monitored daily for 2 wk. TAK-242 reduces influenza-induced lethality in mice. WT C57BL/6 mice (6–8 wk old) were infected on day 0 with PR8 (7500 TCID50) and treated with vehicle (saline and 0.001% DMSO) or TAK-242 (100 µg/mouse i.p.) starting on day 2 daily for 5 consecutive days. (b) Survival and clinical score (i.e., 0 (no symptoms) to 5 (moribund), including mass loss, piloerection, lethargy, and lung “crackling,”) were assessed daily for 2 wk. Data shown are combined results of two assays (n = 5 mice/treatment group/experiment). (c and d) Mice were treated as in (a) and euthanized on day 7 post-infection for lung extraction. Lungs were stained for histopathology (c). Photomicrographs of representative sections were taken at 40X. (d) Total RNA was extracted to measure gene expression by qRT-PCR. Data shown are mean ± SEM. n = 5 mice/treatment group/experiment. *P < 0.05.

TAK-242 therapy improves survival in a mouse model of influenza. (a) Basic protocol for in vivo survival assay of mice infected with PR8. WT mice infected with PR8 (∼7500 TCID50; i.n.) on day “0”. Mice received TAK-242 (100 µg/mouse i.p.) or vehicle (saline and 0.001% DMSO) once daily for 5 days (days 2–6). (b) Survival was monitored daily for 2 wk. TAK-242 reduces influenza-induced lethality in mice. WT C57BL/6 mice (6–8 wk old) were infected on day 0 with PR8 (7500 TCID50) and treated with vehicle (saline and 0.001% DMSO) or TAK-242 (100 µg/mouse i.p.) starting on day 2 daily for 5 consecutive days. (b) Survival and clinical score (i.e., 0 (no symptoms) to 5 (moribund), including mass loss, piloerection, lethargy, and lung “crackling,”) were assessed daily for 2 wk. Data shown are combined results of two assays (n = 5 mice/treatment group/experiment). (c and d) Mice were treated as in (a) and euthanized on day 7 post-infection for lung extraction. Lungs were stained for histopathology (c). Photomicrographs of representative sections were taken at 40X. (d) Total RNA was extracted to measure gene expression by qRT-PCR. Data shown are mean ± SEM. n = 5 mice/treatment group/experiment. *P < 0.05.

Discussion

Conserved C helix Cys interactions have been identified in several reported crystal structures of mammalian TIR proteins including TIR1, TIR2, and TIR6. Based on observed Cys interactions, modifications, sequence conservation, as well as Cys inclusion in multiple inhibitory TIR decoy peptides, we sought to test whether specific targeting of intracellular TIR cysteines would have a functional effect on TLR4 signaling. After an extensive literature search, we identified TAK-242, a small molecule inhibitor previously characterized to interact selectively with intracellular Cys 747 found on the C helix of the cytoplasmic TIR domain of TLR4. The novelty of this report stems not from using TAK-242 to antagonize TLR4 signaling, but rather, in the bioinformatics and structural analyses showing proof of principle for targeting intracellular TIR domains via Cys (an environment typically thought to be reducing) as an effective, if not more efficient, therapeutic approach. Approaches targeting intracellular TIR domain signaling have several advantages over extracellular approaches, including multiplicity of receptor pathways affected (e.g., Toll-like, Interleukin-1 and 18 receptors and TIR domain containing adaptor molecules) and no requirement for a priori knowledge of activating ligand, resulting in decoupling of receptor-ligand activation signals. Thus, approaches targeting intracellular TIR domains may be effective against previously unidentified, multiple and high concentrations of activating ligands. However, at present, our understanding and targeting of intracellular TIR signaling remains poorly underdeveloped in comparison to approaches targeting extracellular TLRs. Over the past 5 yr, Shirey and colleagues have demonstrated that multiple TLR4 antagonists mitigate influenza-induced morbidity and mortality.[13],[28],[29] Specifically, when Eritoran and FP7, lipid A analog antagonists that act by binding to the TLR4 co-receptor MD-2, and anti-TLR4 Abs that bind to the extracellular domain of TLR4, were administered therapeutically to mice infected with PR8, lethality and lung pathology were ameliorated, and accompanied by a decrease in cytokine production.[13],[29] Since influenza does not express known TLR4 PAMPs, it was hypothesized that a host-derived TLR4 agonist released upon influenza-induced tissue damage might underlie this apparent TLR4 dependency. Eritoran and the monosaccharide lipid A analog, FP7, blocked influenza-induced release of High Mobility Group Box-1 (HMGB1), a host-derived, TLR4-activating DAMP in mice and in cotton rats.[28],[29],[36] To test the hypothesis that HMGB1 was the primary TLR4 DAMP induced by influenza infection, P5779, a small molecule inhibitor of HMGB1 that acts by preventing binding of HMGB1 to MD-2,[37] was shown to be as effective as Eritoran in mitigating influenza-induced disease.[28] Therefore, TAK-242 was tested to provide proof of concept for the hypothesis that specific targeting of the intracellular TLR4 Cys-747 would mimic the action of extracellular TLR4 antagonists. Our data show that TAK-242 protected against lethal PR8-induced influenza infection and lung injury similar to extracellular TLR4 antagonists such as Eritoran.[13] The ability to modulate TLR signaling selectively has been highly sought after for vaccine development, and for controlling inflammation, autoimmunity, and cancer. Most studies have focused on targeting extracellular TLR domains using identified naturally occurring and synthetic ectodomain agonists and antagonists. Conversely, select targeting of intracellular TIR domains has focused primarily on developing inhibitory peptides and peptidomimetics based on peptide dissection of TIR domains and resulting functional characterization in signaling assays, resulting in the identification of several BB loops and TIR-derived “decoy” peptides that inhibit TLR4 signaling.[3],[22] However, TIR-based inhibitory peptides and peptidomimetics have encountered typical peptide challenges, including the need for high effective concentrations and the requirement for adding specific sequences to increase permeability across the cell membrane, as well for stability and solubility.[22] Importantly, many of the functionally characterized decoy peptides contain a Cys as part of their functional sequence. Under reducing conditions, decoy peptides do not bind respective TIR targets.[3],[10],[20-22] However, in vitro binding experiments may not fully recapitulate conditions within the cell or this may indicate potential localized redox environment or modification as has been reported.[18],[38] Reports to identify and develop TIR-specific small molecule inhibitory compounds from peptidomimetics, in silico compound library screening, or chemical synthesis have been met with limited success, including recently developed MyD88 small molecule inhibitors.[39-44] Thus, the use of TAK-242 to block influenza-induced disease supports the hypothesis that specifically targeting the highly conserved C helix intracellular Cys-747 of the cytoplasmic TLR4-TIR domain may represent an important new approach for influenza therapy. Bioinformatics analysis of reported bacterial and mammalian TIR structures show that the highly conserved TLR4-C747 targeted by TAK-242 is contained within the functionally important WXC747XXE motif identified in bacterial TIR-domain-containing proteins (Supplemental Figure S4). This motif contains a catalytic glutamic acid (E) at the carboxy-terminus that is essential for enzymatic function of NAD+ consuming bacterial and human TIR proteins (e.g., SARM). Bacterial and mammalian TIR domain-containing proteins have homology with a family of nucleotidases, which also contain a similar highly conserved catalytic glutamic acid (E) that is essential for enzymatic function.[27] It remains to be seen if mammalian TIR domain-containing proteins other than SARM utilize the conserved WxxxE motif for enzymatic function or binding of NAD+ and NAD-like compounds. Additionally, it is unknown if recently identified TLR signaling inhibitors using methyl-piperidinio-pyrazole and scaffold analogs target this region containing the highly conserved C helix Cys and WxxxE motif.[44] Finally, it remains to be determined if other compounds like TAK-242 also target the conserved WxcxxE motif. Explicit targeting of the WxxxE motif and, potentially, conserved cryptic dinucleotide binding pocket in the TIR family members, may be an effective therapeutic approach. To our knowledge, targeting within conserved human receptor and bacterial TIR WXC747-Tak-242XXE motifs, conserved active site E, and potential NADase-like pockets have not been explicitly identified or correlated for potential small molecule development. Recent reports showing that TIR protein family members (bacterial and human) are an ancient family of NAD-consuming enzymes with NADase activity that retain a highly conserved active site glutamic acid residue located with the WxxxE motif. Click here for additional data file. Supplemental material, INI846281 Supplemental Material for Select targeting of intracellular Toll-interleukin-1 receptor resistance domains for protection against influenza-induced disease by Kari Ann Shirey, Wendy Lai, Lindsey J Brown, Jorge C G Blanco, Robert Beadenkopf, Yajing Wang, Stefanie N Vogel, Greg A Snyder, in Innate Immunity
  44 in total

1.  A novel cyclohexene derivative, ethyl (6R)-6-[N-(2-Chloro-4-fluorophenyl)sulfamoyl]cyclohex-1-ene-1-carboxylate (TAK-242), selectively inhibits toll-like receptor 4-mediated cytokine production through suppression of intracellular signaling.

Authors:  Masayuki Ii; Naoko Matsunaga; Kaoru Hazeki; Kazuyo Nakamura; Katsunori Takashima; Tsukasa Seya; Osamu Hazeki; Tomoyuki Kitazaki; Yuji Iizawa
Journal:  Mol Pharmacol       Date:  2005-12-22       Impact factor: 4.436

Review 2.  Pathogen recognition and innate immunity.

Authors:  Shizuo Akira; Satoshi Uematsu; Osamu Takeuchi
Journal:  Cell       Date:  2006-02-24       Impact factor: 41.582

3.  Analysis of binding site for the novel small-molecule TLR4 signal transduction inhibitor TAK-242 and its therapeutic effect on mouse sepsis model.

Authors:  K Takashima; N Matsunaga; M Yoshimatsu; K Hazeki; T Kaisho; M Uekata; O Hazeki; S Akira; Y Iizawa; M Ii
Journal:  Br J Pharmacol       Date:  2009-06-25       Impact factor: 8.739

4.  The SARM1 Toll/Interleukin-1 Receptor Domain Possesses Intrinsic NAD+ Cleavage Activity that Promotes Pathological Axonal Degeneration.

Authors:  Kow Essuman; Daniel W Summers; Yo Sasaki; Xianrong Mao; Aaron DiAntonio; Jeffrey Milbrandt
Journal:  Neuron       Date:  2017-03-22       Impact factor: 17.173

5.  Crystal structure of TIR domain of TLR6 reveals novel dimeric interface of TIR-TIR interaction for toll-like receptor signaling pathway.

Authors:  Tae-Ho Jang; Hyun Ho Park
Journal:  J Mol Biol       Date:  2014-07-31       Impact factor: 5.469

6.  Susceptibilities of antiviral-resistant influenza viruses to novel neuraminidase inhibitors.

Authors:  Vasiliy P Mishin; Frederick G Hayden; Larisa V Gubareva
Journal:  Antimicrob Agents Chemother       Date:  2005-11       Impact factor: 5.191

7.  A Decoy Peptide that Disrupts TIRAP Recruitment to TLRs Is Protective in a Murine Model of Influenza.

Authors:  Wenji Piao; Kari Ann Shirey; Lisa W Ru; Wendy Lai; Henryk Szmacinski; Greg A Snyder; Eric J Sundberg; Joseph R Lakowicz; Stefanie N Vogel; Vladimir Y Toshchakov
Journal:  Cell Rep       Date:  2015-06-18       Impact factor: 9.423

8.  The crystal structure of the human toll-like receptor 10 cytoplasmic domain reveals a putative signaling dimer.

Authors:  Tomas Nyman; Pål Stenmark; Susanne Flodin; Ida Johansson; Martin Hammarström; Pär Nordlund
Journal:  J Biol Chem       Date:  2008-03-10       Impact factor: 5.157

9.  Identification of Toll-like receptor signaling inhibitors based on selective activation of hierarchically acting signaling proteins.

Authors:  Sirish K Ippagunta; Julie A Pollock; Naina Sharma; Wenwei Lin; Taosheng Chen; Kazuki Tawaratsumida; Anthony A High; Jaeki Min; Yizhe Chen; R Kiplin Guy; Vanessa Redecke; John A Katzenellenbogen; Hans Häcker
Journal:  Sci Signal       Date:  2018-08-14       Impact factor: 8.192

10.  Novel strategies for targeting innate immune responses to influenza.

Authors:  K A Shirey; W Lai; M C Patel; L M Pletneva; C Pang; E Kurt-Jones; M Lipsky; T Roger; T Calandra; K J Tracey; Y Al-Abed; A G Bowie; A Fasano; C A Dinarello; F Gusovsky; J C G Blanco; S N Vogel
Journal:  Mucosal Immunol       Date:  2016-01-27       Impact factor: 7.313

View more
  4 in total

Review 1.  The Structure Basis of Phytochemicals as Metabolic Signals for Combating Obesity.

Authors:  Xiaoping Li; Liufeng Zheng; Bing Zhang; Ze-Yuan Deng; Ting Luo
Journal:  Front Nutr       Date:  2022-06-13

2.  Human and Bacterial Toll-Interleukin Receptor Domains Exhibit Distinct Dynamic Features and Functions.

Authors:  Eunjeong Lee; Jasmina S Redzic; Travis Nemkov; Anthony J Saviola; Monika Dzieciatkowska; Kirk C Hansen; Angelo D'Alessandro; Charles Dinarello; Elan Z Eisenmesser
Journal:  Molecules       Date:  2022-07-14       Impact factor: 4.927

3.  A mouse model of human TLR4 D299G/T399I SNPs reveals mechanisms of altered LPS and pathogen responses.

Authors:  Katharina Richard; Kurt H Piepenbrink; Kari Ann Shirey; Archana Gopalakrishnan; Shreeram Nallar; Daniel J Prantner; Darren J Perkins; Wendy Lai; Alexandra Vlk; Vladimir Y Toshchakov; Chiguang Feng; Rachel Fanaroff; Andrei E Medvedev; Jorge C G Blanco; Stefanie N Vogel
Journal:  J Exp Med       Date:  2021-02-01       Impact factor: 14.307

Review 4.  Targeting TLR4 Signaling to Blunt Viral-Mediated Acute Lung Injury.

Authors:  Kari Ann Shirey; Jorge C G Blanco; Stefanie N Vogel
Journal:  Front Immunol       Date:  2021-07-02       Impact factor: 7.561

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.