Literature DB >> 31815960

Dengue virus reduces AGPAT1 expression to alter phospholipids and enhance infection in Aedes aegypti.

Thomas Vial1,2, Wei-Lian Tan2, Benjamin Wong Wei Xiang2, Dorothée Missé3, Eric Deharo1, Guillaume Marti1, Julien Pompon2,3.   

Abstract

More than half of the world population is at risk of dengue virus (DENV) infection because of the global distribution of its mosquito vectors. DENV is an envelope virus that relies on host lipid membranes for its life-cycle. Here, we characterized how DENV hijacks the mosquito lipidome to identify targets for novel transmission-blocking interventions. To describe metabolic changes throughout the mosquito DENV cycle, we deployed a Liquid chromatography-high resolution mass spectrometry (LC-HRMS) workflow including spectral similarity annotation in cells, midguts and whole mosquitoes at different times post infection. We revealed a major aminophospholipid reconfiguration with an overall early increase, followed by a reduction later in the cycle. We phylogenetically characterized acylglycerolphosphate acyltransferase (AGPAT) enzyme isoforms to identify those that catalyze a rate-limiting step in phospholipid biogenesis, the acylation of lysophosphatidate to phosphatidate. We showed that DENV infection decreased AGPAT1, but did not alter AGPAT2 expression in cells, midguts and mosquitoes. Depletion of either AGPAT1 or AGPAT2 increased aminophospholipids and partially recapitulated DENV-induced reconfiguration before infection in vitro. However, only AGPAT1 depletion promoted infection by maintaining high aminophospholipid concentrations. In mosquitoes, AGPAT1 depletion also partially recapitulated DENV-induced aminophospholipid increase before infection and enhanced infection by maintaining high aminophospholipid concentrations. These results indicate that DENV inhibition of AGPAT1 expression promotes infection by increasing aminophospholipids, as observed in the mosquito's early DENV cycle. Furthermore, in AGPAT1-depleted mosquitoes, we showed that enhanced infection was associated with increased consumption/redirection of aminophospholipids. Our study suggests that DENV regulates aminophospholipids, especially phosphatidylcholine and phosphatidylethanolamine, by inhibiting AGPAT1 expression to increase aminophospholipid availability for virus multiplication.

Entities:  

Mesh:

Substances:

Year:  2019        PMID: 31815960      PMCID: PMC6922471          DOI: 10.1371/journal.ppat.1008199

Source DB:  PubMed          Journal:  PLoS Pathog        ISSN: 1553-7366            Impact factor:   6.823


Introduction

Increased global distribution of dengue virus (DENV) is driven by the expansion of its mosquito vectors, mainly Aedes aegypti [1]. An estimated 400 million infections occur yearly in over 100 countries [2] and cause a range of symptoms from flu-like illness to potentially lethal complication called severe dengue. Without approved antiviral drug, treatment is limited to supportive care. Although dengue vaccine is now licensed in several countries, it has variable efficacy against all dengue serotypes [3], and is only suitable for dengue-seropositive patients [4]. To curb dengue epidemics, containment strategy mainly relies on vector control that includes the use of insecticides [5]. However, insecticide resistance is rapidly developing, compromising the efficacy of the only available intervention [6]. Characterization of viral metabolic requirements in mosquitoes will identify targets for novel chemical-based control strategies [7]. As obligate and intracellular parasites, viruses rely on the host to fulfill their metabolite requirements. Glycolysis, amino acid and lipid pathways provide the energy and structural compounds necessary for multiplication. In human cells, DENV alters energy [8,9], glycolysis [10], nucleic acid [11], mitochondrial [12] and lipid metabolisms [13-15]. As an envelope virus, DENV is particularly dependent on host-derived lipid membranes, with which it interacts for entry, replication, translation, assembly and egress [7,16]. In mosquito cells and midgut, DENV reconfigures the lipid profile as indicated by lipidomics [17,18] and transcriptomics [19], particularly altering the membrane lipids such as phospholipids (PL) and sphingolipids. Chemical inhibition of lipid synthesis confirmed the DENV requirements for lipids in human and mosquito cells [20]. Several mechanisms related to elevated autophagy [13] and recruitment of lipogenesis enzymes to the replication complex [21] have been elucidated in the mammalian host. However, how DENV reconfigures lipids in mosquitoes remains unknown. PL de novo biogenesis is initiated by two types of acyl-transferases that sequentially add two acyls to one glycerol-3-phosphate (G3P) [22,23]. The second addition is catalyzed by 1-acyl-sn-glycerol-3-phosphate O-acyltransferases (AGPAT) that transform lysophospatidate (lysoPA) in phosphatidate (PA) [24]. PAs are then used to produce all PLs, positioning AGPATs as rate-limiting enzymes of PL biogenesis. PLs are produced within the endoplasmic reticulum and subject to swift reconfiguration to meet the cell needs [25,26]. DENV translation, replication and assembly harness the endoplasmic reticulum membranes, suggesting potential alteration of PL biogenesis. Following an infectious blood meal, DENV infects the mosquito midgut, multiplies, and propagates to the whole mosquito body, including salivary glands, from where it is expectorated during subsequent blood feeding [27]. Throughout various infected tissues, the virus modifies its metabolic environment. In this study, we aim to understand how DENV modifies mosquitoes’ metabolome. Using high-resolution mass spectrometry, we explored the metabolic changes throughout the DENV cycle, in Ae. aegypti Aag2 cell line, midguts and whole mosquitoes at different times post infection. Infection-induced metabolic alteration mostly affected PLs and was associated with AGPAT expression regulations. Combining metabolomic profiling with RNAi-mediated AGPAT depletions, we partially recapitulated the infection-induced PL reconfiguration and demonstrated its pro-viral impact. Eventually, PL profiling upon infection both in vitro and in vivo in PL-altered environments indicated that increased PL redirection/consumption favored virus multiplication. Our study reveals how DENV reconfigures the metabolome and identifies PLs as important components in the virus life-cycle.

Results

Mosquito phospholipidome is reconfigured throughout DENV infection

To describe the metabolic changes in Ae. aegypti, we designed an untargeted multidimensional approach that covered the different stages of DENV cycle (Fig 1A). Extracts from Aag2 cells at 6, 12, 24 and 48 h post infection (hpi) represented changes caused by entry, initiation of replication, replication and virion production (S1A and S1B Fig) [28]. Extracts from midguts at 1 and 7 days post oral infection (dpi) represented infection onset and replication peak, respectively (S1C and S1CD Fig) [27]. Extracts from whole mosquitoes at 1, 7 and 14 dpi represented the different dissemination stages in the mosquito body (S1C and S1CD Fig) [27]. The extracts were analyzed using a Liquid Chromatography-High Resolution Mass Spectrometry (LC-HRMS) metabolomic workflow that detects polar and nonpolar metabolites (S2 Fig). We detected 667, 486 and 1121 compounds in the cells, midgut and whole mosquitoes, respectively (Table 1). Comparison of MS spectra with available non-mosquito databases enabled the annotation of 77% of the peaks. To annotate the remaining mosquito-specific metabolites, we deployed MS spectral similarity network (S3 Fig; S1 Table) [29]. Based on the spectral similarity with database-identified features, we identified the class of 20 MS features without homologues in the databases, increasing the identification coverage to 77, 70 and 82% in the cells, midguts and whole mosquitoes, respectively (Table 1). Among all annotated metabolites, we detected 29% of PLs, 21% of non-PL lipids, 8% of amino acids and peptides, 5% of organic acids, 4% of carbohydrates and 33% of other minor classes (fewer than 3 occurrences). The distribution of metabolite classes indicates that the metabolomic workflow had a broad coverage, although slightly biased towards lipids.
Fig 1

Aminophospholipid composition is altered throughout DENV infection in mosquitoes.

(A) Schematic of the multidimensional strategy deployed to profile the mosquito metabolome after DENV infection. Aag2 mosquito cells were infected with DENV at an MOI of 5 and collected at 6, 12, 24 and 48 h post infection (hpi). Mosquitoes were orally infected with 107 pfu/ml of DENV. Midguts and whole mosquitoes were collected at 1, 7 and 14 days post infection (dpi). Metabolic extracts were analyzed by LC-HRMS as in S2 Fig. (B) Venn diagrams show regulated metabolites at the different time points and bars indicate class distribution within tissue levels. Triangles indicate direction of regulation and are color-coded with regards to the time point. Uninfected condition was used as control. (C) Fold changes of annotated and significantly regulated metabolites (|log2 fold change| > 1 and p-value < 0.05) by DENV in cells, midguts and mosquitoes as compared to mock infection. Only metabolites from the general metabolism (i.e., lipid, carbohydrate, amino acid and peptide, nucleotide and nucleoside, sialic acid) are shown. *, indicates metabolite annotations determined by spectral similarity. Carbo., carbohydrate; SA, sialic acid; PL, phospholipid; PE, phosphatidylethanolamine; PC, phosphatidylcholine; PS, phosphatidylserine; PA, phosphatidic acid; PI, phosphatidylinositol; PG, phosphatidylglycerol; LysoPS, lysophosphatidylserine; LysoPC, lysophosphatidylcholine; LysoPE, lysophosphatidylethanolamine; LysoPG, lysophosphatidylglycerol; LysoPI, lysophosphatidylinositol; SM, Sphingomyelin; DAG, Diacylglycerol; MAG, Monoacylglycerol; FAHFA, Fatty Acid ester of Hydroxyl Fatty Acid; NAE, N-acylethanolamine; HEA, Heneicosanoic acid; pep., peptides.

Table 1

Summary of metabolites detected across mosquito tissues.

¶MS Finder (HMDB, ChEBI, LipidMAPS, LipidBlast) score annotation ≥ 5; * p-value < 0.05 as indicated by unpaired t-test and |log2 Fold Change| ≥ 1.

TissueAag2 cellsA. aegypti MidgutA. aegypti Mosquito
Unique peak detected with MS/MS6674861121
Annotated peaks (%)77%70%82%
Metabolites significantly regulated*6 hpi12 hpi24 hpi48 hpi1 dpi7 dpi1 dpi7 dpi14 dpi
Total543498186359119
Annotated (%)83%100%100%89%75%72%73%78%79%

Aminophospholipid composition is altered throughout DENV infection in mosquitoes.

(A) Schematic of the multidimensional strategy deployed to profile the mosquito metabolome after DENV infection. Aag2 mosquito cells were infected with DENV at an MOI of 5 and collected at 6, 12, 24 and 48 h post infection (hpi). Mosquitoes were orally infected with 107 pfu/ml of DENV. Midguts and whole mosquitoes were collected at 1, 7 and 14 days post infection (dpi). Metabolic extracts were analyzed by LC-HRMS as in S2 Fig. (B) Venn diagrams show regulated metabolites at the different time points and bars indicate class distribution within tissue levels. Triangles indicate direction of regulation and are color-coded with regards to the time point. Uninfected condition was used as control. (C) Fold changes of annotated and significantly regulated metabolites (|log2 fold change| > 1 and p-value < 0.05) by DENV in cells, midguts and mosquitoes as compared to mock infection. Only metabolites from the general metabolism (i.e., lipid, carbohydrate, amino acid and peptide, nucleotide and nucleoside, sialic acid) are shown. *, indicates metabolite annotations determined by spectral similarity. Carbo., carbohydrate; SA, sialic acid; PL, phospholipid; PE, phosphatidylethanolamine; PC, phosphatidylcholine; PS, phosphatidylserine; PA, phosphatidic acid; PI, phosphatidylinositol; PG, phosphatidylglycerol; LysoPS, lysophosphatidylserine; LysoPC, lysophosphatidylcholine; LysoPE, lysophosphatidylethanolamine; LysoPG, lysophosphatidylglycerol; LysoPI, lysophosphatidylinositol; SM, Sphingomyelin; DAG, Diacylglycerol; MAG, Monoacylglycerol; FAHFA, Fatty Acid ester of Hydroxyl Fatty Acid; NAE, N-acylethanolamine; HEA, Heneicosanoic acid; pep., peptides.

Summary of metabolites detected across mosquito tissues.

¶MS Finder (HMDB, ChEBI, LipidMAPS, LipidBlast) score annotation ≥ 5; * p-value < 0.05 as indicated by unpaired t-test and |log2 Fold Change| ≥ 1. Infection regulated 67, 24 and 181 unique metabolites in cells, midguts and whole mosquitoes, respectively (Fig 1B; S2 Table). The PL class had the highest number of regulated metabolites in the midgut and mosquito, and the third most regulated in cells. Fatty acyls were also differentially regulated in the three tissue levels, while amino acids and carbohydrates were regulated in cells and mosquitoes. Several classes of PLs were regulated in all three tissues (Fig 1C, S4 Fig). Aminophospholipids (aminoPL) are the major constituents of membranes and are synthesized in the endoplasmic reticulum [30]. AminoPLs include phosphatidylethanolamine (PE), phosphatidylcholine (PC) and phosphatidylserine (PS) [31]. Although infection altered different species of aminoPLs in the different tissue-time combinations, we observed a general increase at the beginning of DENV cycle, followed by a reduction at the end. In cells, the majority of regulated aminoPLs (3 out of 5) were upregulated at 48 hpi. In midguts and mosquitoes a total of 9 aminoPLs were increased at 1 dpi, whereas 15 and 14 were reduced at 7 and 14 dpi, respectively. Phosphatidylglycerols (PG) are another group of PL. Although PGs have a lower abundance than aminoPLs, they are also constituents of membranes and synthesized in the mitochondria [32]. Although only detected in mosquito extracts, PGs responded differently to infection when compared with aminoPLs (Fig 1C). Two shorter PGs decreased at 1 dpi and increased at 14 dpi, and three longer PGs were upregulated at 1 dpi. Lysophopholipids (lysoPL) are produced from fatty acid remodeling of the different PL classes [33]. In cells, one lysoPG was downregulated at 48 hpi (Fig 1C). In mosquitoes, the lysoPCs followed the same trend as aminoPLs, with 6 increasing at 1 dpi and decreasing at 14 dpi. Different types of PL precursors were regulated. PA, the direct precursor of all PLs [24,31], was upregulated at 1 dpi in midgut, similar to aminoPLs. Two diacylglycerols (DAG), intermediates for PE and PC productions, were up and downregulated in mosquitoes at 7 and 14 dpi, respectively. Fatty acyls can be incorporated into a glycerol head to produce PL and were regulated. Fatty acyls with an ethanolamine group can be related to PE either via degradation or as a precursor. Similar to aminoPLs, two acyl-ethanolamine increased at 1 dpi and decreased at 14 dpi in mosquitoes. In accordance with previous studies [34], one sphingomyelin was regulated in mosquitoes and one cholesterol compound was depleted in midgut. Our comprehensive metabolomic profiling revealed that DENV infection profoundly reconfigures the phospholidome. The aminoPLs including PE, PC and PS increased at the beginning of DENV cycle and decreased later on. A large phospholipidome reconfiguration was previously observed in DENV-infected midguts at 3, 7 and 11 dpi [18]. However, in this previous kinetic study, PLs were mostly up-regulated throughout the infection cycle. They reported a decrease in lysoPL abundance, which we observed at 14 dpi in mosquitoes. The authors also noted an increase in sphingolipids, which we saw in mosquitoes but only for one species. Those variations between the studies can stem from methodological differences in extraction and analyses, or from biological differences in mosquito colony and virus strain. Taken together, our results and those of others indicate that DENV infection reconfigures lipid membrane composition.

DENV infection modulates expression of AGPAT1 that is involved in PL biogenesis

To determine how PLs are reorganized upon DENV infection, we first characterized the rate-limiting AGPAT enzymes in Ae. aegypti (Fig 2A). In humans, there are five AGPAT isoforms with different activities depending on four motif sequences [35]. Motifs I and IV bind to acyl-CoA and catalyze lysoPA to PA acylation, while motifs II and III bind to lysoPA. Human AGPAT (hAGPAT) 1 and 2 are localized in the endoplasmic reticulum and have the highest acyltransferase activity and lysoPA affinity [36]. hAGPAT3-5 have lower transferase activity and target different substrates that lysoPA such as lysoPL, participating in PL remodeling [37]. Aedes aegypti also has five AGPAT isoforms: AGPAT1 (AAEL011898), AGPAT2 (AAEL001000), AGPAT3 (AAEL011902), AGPAT4 (AAEL014026) and AGPAT5 (AAEL011901). Based on amino acid similarity, AGPAT1, 2, 3 and 5 cluster with hAGPAT1 and 2, whereas AGPAT4 clusters with hAGPAT3-5 (Fig 2B; S5 Table). Further classification based on functional motifs that are define the biochemical activity [38] establishes AGPAT1, 2, 3 as homologues of hAGPAT1 and 2 (Table 2), suggesting that they all share the acyltransferase activity and lysoPA affinity.
Fig 2

DENV infection decreases AGPAT1 but not AGPAT2 expression.

(A) An overview of phospholipid biogenesis. Sequential additions of two acyl-coA to one G3P produce a LysoPA and a PA. Several AGPATs mediate the second addition. PA forms either DAG or CDP-DAG, each generating a different set of phospholipids. DAG produces aminophospholipids by addition of a Cho or Eth group. Aminophospholipids are also produced by acylation of lysoPL and base group modifications. CDP-DAG produces PI and PG, the latter being transformed in CL by combination with a second PG. Phospholipases cleave off an acyl chain from PL to produce lysoPL. G3P, glycerol-3-phosphate; LysoPA, lysophosphatidate; PA, phosphatidate; AGPAT, acyl-sn-glycerol-3-phosphate acyltransferases; DAG, diacylglycerol; CDP-DAG, cytidine diphosphate diacylglycerol; PC, phosphatidylcholine; LPC, lysophosphatidylcholine; Cho, choline; PE, phosphatidylethanolamine; LPE, lysophosphatidylethanolamine; Eth, ethanolamine; PS, phosphatidylserine; LPS, lysophosphatidylserine; PI, phosphatidylinositol; LPI, lysophosphatidylinositol; PG, phosphatidylglycerol; LPG, lysophosphatidylglycerol; CL, cardiolipin; LCL, lysocardiolipin. (B) Maximum likelihood tree between AGPATs from Ae. aegypti and humans. (C) AGPAT1 and AGPAT2 expressions in DENV-infected cells at 24 and 48 hpi with an MOI of 5. Expressions of AGPAT1 and AGPAT2 (D) in midguts at 1, 7 dpi and (E) in whole mosquitoes at 1, 7 and 14 dpi with DENV at 107 pfu/ml. (C-E) Actin expression was used for normalization. Bars show means ± s.e.m from 4 independent wells or 3 pools of 5 midguts or 5 mosquitoes. *, p-value < 0.05; **, p-value<0.01; as indicated by unpaired t-test.

Table 2

Acyltransferase motif comparison between human and Ae. aegypti AGPAT homologues.

Purple indicates amino acid residues highly conserved across all hAGPATs and yellow in hAGPAT1 and 2 only.

SpecieProteinRefSeqAmino acidsMotif Iacyl-CoA binding and catalysisMotif IILPA bindingMotif IIILPA bindingMotif IVacyl-CoA binding and catalysis
Homo sapienshAGPAT1 (alpha)NP_006402283VSNHQSSLDLLGMAGVIFIDRKRVFPEGTRNHVPIVPIVMSS
Homo sapienshAGPAT2 (beta)NP_006403278VSNHQSILDMMGLGGVFFINRQRIYPEGTRNDVPIVPVVYSS
Homo sapienshAGPAT3 (gamma)NP_064517376ILNHNFEIDFLCGLEIVFCKRKWLYCEGTRFTYHLLPRTKGF
Homo sapienshAGPAT4 (delta)NP_064518378VLNHKFEIDFLCGTEMVFCSRKWIHCEGTRFTHHLLPRTKGF
Homo sapienshAGPAT5 (epsilon)NP_060831364LANHQSTVDWIVAQHGGIYVKRSIFPEGTRYNHVLTPRIKAT
Ae. aegyptiAGPAT1 (AAEL011898)EAT35978273LMNHQSALDLVVLWGTLFINRKNFFPEGTRGDGYIQPVVISK
Ae. aegyptiAGPAT2 (AAEL001000)EAT47921398VANHQSSLDILGMSGLIFIDRKNVFPEGTRRNLPIMPVVYSS
Ae. aegyptiAGPAT3 (AAEL011902)EAT35981308MANHQSSMDILGLAGITFINRKNIYPEGTRFPVPIIPVVFSH
Ae. aegyptiAGPAT4 (AAEL014026)EAT33698387LMNHTYEVDWLVGAEFVFLERSFLNAEGTRFTHHLIPRTKGF
Ae. aegyptiAGPAT5 (AAEL011901)EAT35980280LINHQSAIDIVMLVGVVFIDRKNIFPEGTRHDSIIQSIIVSK

DENV infection decreases AGPAT1 but not AGPAT2 expression.

(A) An overview of phospholipid biogenesis. Sequential additions of two acyl-coA to one G3P produce a LysoPA and a PA. Several AGPATs mediate the second addition. PA forms either DAG or CDP-DAG, each generating a different set of phospholipids. DAG produces aminophospholipids by addition of a Cho or Eth group. Aminophospholipids are also produced by acylation of lysoPL and base group modifications. CDP-DAG produces PI and PG, the latter being transformed in CL by combination with a second PG. Phospholipases cleave off an acyl chain from PL to produce lysoPL. G3P, glycerol-3-phosphate; LysoPA, lysophosphatidate; PA, phosphatidate; AGPAT, acyl-sn-glycerol-3-phosphate acyltransferases; DAG, diacylglycerol; CDP-DAG, cytidine diphosphate diacylglycerol; PC, phosphatidylcholine; LPC, lysophosphatidylcholine; Cho, choline; PE, phosphatidylethanolamine; LPE, lysophosphatidylethanolamine; Eth, ethanolamine; PS, phosphatidylserine; LPS, lysophosphatidylserine; PI, phosphatidylinositol; LPI, lysophosphatidylinositol; PG, phosphatidylglycerol; LPG, lysophosphatidylglycerol; CL, cardiolipin; LCL, lysocardiolipin. (B) Maximum likelihood tree between AGPATs from Ae. aegypti and humans. (C) AGPAT1 and AGPAT2 expressions in DENV-infected cells at 24 and 48 hpi with an MOI of 5. Expressions of AGPAT1 and AGPAT2 (D) in midguts at 1, 7 dpi and (E) in whole mosquitoes at 1, 7 and 14 dpi with DENV at 107 pfu/ml. (C-E) Actin expression was used for normalization. Bars show means ± s.e.m from 4 independent wells or 3 pools of 5 midguts or 5 mosquitoes. *, p-value < 0.05; **, p-value<0.01; as indicated by unpaired t-test.

Acyltransferase motif comparison between human and Ae. aegypti AGPAT homologues.

Purple indicates amino acid residues highly conserved across all hAGPATs and yellow in hAGPAT1 and 2 only. To test whether infection-induced phospholipidome reconfiguration is associated with AGAPT regulation, we quantified AGPAT1 and 2 expressions. Interestingly, we observed that AGPAT1 was downregulated at 24 and 48 hpi in cells, at 1 and 7 dpi in midguts and at 1, 7 and 14 dpi in mosquitoes (Fig 2C–2E). In contrast, AGPAT2 was not significantly regulated in cells, midguts and mosquitoes (Fig 2C–2E). This partially corroborates a transcriptomic study [39] that shows AGPAT1 downregulation and AGPAT2 upregulation at 1, 2 and 7 days post DENV-inoculation in mosquitoes (S5 Fig). To test whether virus replication was required for AGPAT1 down-regulation, we incubated cells with UV-inactivated virus (S6A Fig). AGAPT1 expression did not vary between mock and UV-inactivated DENV at 24 and 48 hpi (S6B Fig), indicating that active infection is required. Altogether, our results and those of others suggest that AGPAT1 down-regulation correlates with DENV phospholipidome reconfiguration.

Depletion of AGPAT1 but not AGPAT2 promotes DENV infection by increasing aminoPL concentrations in cells

Based on the association between the infection-induced phospholipidome reconfiguration and AGPAT1 down-regulation, we hypothesized that AGPAT1 mediates the phospholipidome reconfiguration that promotes DENV infection. First, we described how both AGPAT1 and 2, the latter used as control, regulate PL biogenesis in non-infected mosquito cells. LC-HRMS polar mode detection was used to target phospholipid metabolites (S2 Fig). Depletion of either AGPAT1 or 2 increased the concentrations of aminoPLs (Fig 3A–3C; S6 Table), as previously observed in human cells [40]. Strikingly, PC (34:1), PC (38:5) and G3P were upregulated by both AGPAT1 and 2 depletion. AGPAT2 depletion also increased two other PCs and decreased two forms of sphinganine, a precursor of sphingolipid biosynthesis [41] (Fig 3D; S7A Fig), and six amino acids or nucleoside (arginine, cysteine, methionine, glutamic acid, oxidized glutathione and adenosine) (S6 Table). Of note, depletion of one of the AGPATs did not alter expression of the other (S8 Fig), indicating the enzyme-specificity of the aminoPL alterations. These results confirm the roles of AGPAT1 and 2 in PL biogenesis, and reveal differences between the two enzymes.
Fig 3

AGPAT1 but not AGPAT2 depletion increases DENV multiplication and aminoPL in cells.

Aag2 cells were transfected with either dsRNA against AGPAT1 or 2 (dsAGPAT1 or 2) or with dsRNA control (dsControl). At 24 h post transfection, cells were infected with DENV at MOI of 1 or mock infected. Supernatant was collected at 48 hpi. Expressions of (A) AGPAT1 and (B) AGPAT2 in mock-infected cells at 72 h post transfection. Actin expression was used for normalization. Bars show mean ± s.e.m. (C) Number of phospholipid-related metabolites significantly regulated. (D) Impact of AGPAT1 or 2 depletion on the lipidome of mock-infected cells at 72 h post transfection. *, p-value <0.05 and |log2 fold change| > 1. (E) Impact of AGPAT1 or 2 depletion on DENV production at 48 hpi as determined by plaque forming unit (pfu) assay. Bars show mean ± s.e.m. and each point represents independent wells. (F) Impact of AGPAT1 or 2 depletion on the lipidome of infected cells at 48 hpi. *, p-value < 0.05 and |log2 fold change| > 1. (A, B, D and F) result from three biological replicates. (A, B) ***; p-value < 0.001; ****, p-value < 0.0001, as indicated by unpaired t-test. (E) **, p-value < 0.01, as indicated by Dunnett’s test. PE, phosphatidylethanolamine; PC, phosphatidylcholine; PS, phosphatidylserine; LPE, lysophosphatidylethanolamine.

AGPAT1 but not AGPAT2 depletion increases DENV multiplication and aminoPL in cells.

Aag2 cells were transfected with either dsRNA against AGPAT1 or 2 (dsAGPAT1 or 2) or with dsRNA control (dsControl). At 24 h post transfection, cells were infected with DENV at MOI of 1 or mock infected. Supernatant was collected at 48 hpi. Expressions of (A) AGPAT1 and (B) AGPAT2 in mock-infected cells at 72 h post transfection. Actin expression was used for normalization. Bars show mean ± s.e.m. (C) Number of phospholipid-related metabolites significantly regulated. (D) Impact of AGPAT1 or 2 depletion on the lipidome of mock-infected cells at 72 h post transfection. *, p-value <0.05 and |log2 fold change| > 1. (E) Impact of AGPAT1 or 2 depletion on DENV production at 48 hpi as determined by plaque forming unit (pfu) assay. Bars show mean ± s.e.m. and each point represents independent wells. (F) Impact of AGPAT1 or 2 depletion on the lipidome of infected cells at 48 hpi. *, p-value < 0.05 and |log2 fold change| > 1. (A, B, D and F) result from three biological replicates. (A, B) ***; p-value < 0.001; ****, p-value < 0.0001, as indicated by unpaired t-test. (E) **, p-value < 0.01, as indicated by Dunnett’s test. PE, phosphatidylethanolamine; PC, phosphatidylcholine; PS, phosphatidylserine; LPE, lysophosphatidylethanolamine. To test whether AGPAT-mediated reconfiguration of aminoPLs promotes DENV infection, we quantified infection in cells depleted of either AGPAT1 or 2. While DENV titer was not altered by AGPAT2 depletion, it increased 2.09 ± 0.36 fold (p-value = 0.0012) following AGPAT1 depletion (Fig 3E). Next, we described how DENV infection altered the lipidome in cells depleted of either AGPAT1 or 2. Infection in AGPAT1-depleted cells, but not in AGPAT2-depleted cells, mostly increased aminoPLs as compared to infected wild-type cells (Fig 3C, S7 Table). Specifically, two PEs, two PCs, two PSs, and one lysoPE were upregulated (Fig 3F; S7B Fig). These results indicate that: (i) depletion of AGPAT1 prior infection amplifies the aminoPL increase observed in early mosquito DENV infection (Fig 1C), and (ii) AGPAT1-mediated aminoPL reconfiguration is associated with increased DENV production. Therefore, AGPAT1 downregulation by infection generates a pro-viral environment. To test whether AGPAT1 effect on DENV was related to aminoPLs, we modified the AGPAT1-induced reconfiguration of aminoPLs by media supplementation. In PL biogenesis, PA produces DAG, which is transformed into PE by addition of ethanolamine (Fig 2A). Extracellular source of ethanolamine influences phospholipid metabolism [42], especially PEs that were altered by AGPAT1 depletion (Fig 3F). Therefore, we measured the impact on DENV gRNA of ethanolamine supplementation upon AGPAT1 depletion. Controls were non-depleted cells without supplementation (standard media that does not contain ethanolamine), non-depleted cells with ethanolamine supplementation and AGPAT1-depleted cells without supplementation. While ethanolamine supplementation did not alter gRNA in non-depleted cells, the increase observed upon AGPAT1-depletion was reverted to non-depleted non-supplemented control when ethanolamine was supplemented (S9 Fig). These results confirm the role of AminoPLs in AGPAT1 increase of DENV multiplication and incriminate metabolites downstream of DAG as important for DENV.

AGPAT1 depletion promotes DENV infection by amplifying aminoPL reconfiguration in mosquitoes

To further characterize how AGPAT1-mediated PL alteration increases DENV infection, we depleted AGPAT1 in mosquitoes (Fig 4A). We first described how AGAPT1 regulates PLs in mosquitoes that fed on a non-infectious blood meal (Fig 4B; S10 Fig; S8 Table). As in cells, AGPAT1 mostly regulated aminoPLs and their derivatives (S8 Table). At 2 days post oral feeding, one DAG and one PA, two key precursors of PLs, and one PS were increased. At 7 days post oral feeding, eight lysoPLs (one lysoPI, two lysoPGs, one lysoPS, two lysoPEs and two lysoPCs) were downregulated, similarly to those in DENV-infected wild-type mosquitoes at 14 dpi (Fig 1C). Strikingly, some metabolites were similarly regulated by either AGPAT1-depletion or DENV infection. PS (34:2) was upregulated by either AGPAT1-depletion at 2 days post oral feeding or DENV infection at 1 dpi. LysoPI (20:4), lysoPE (18:1), lysoPC (16:1) and lysoPC (20:4) were reduced by either AGPAT1-depletion at 7 days post oral feeding or DENV infection at 14 dpi. At 7 days post oral feeding in AGPAT1-depleted mosquitoes, one fatty acyl, two acylcarnitines, oleoylcarnitine (18:1) and acetyl-L-carnitine, were decreased. Of note, one of the regulated acylcarnitines (i.e., oleoylcarnitine) was inversely regulated by DENV infection at 14 dpi (Fig 1C). These results show that AGPAT1 depletion partially reproduces the aminoPL reconfiguration caused by DENV infection.
Fig 4

AGPAT1 depletion increases DENV multiplication and consumption of aminoPLs in mosquitoes.

Mosquitoes were injected with either dsRNA against AGPAT1 (dsAGPAT1) or dsRNA control (dsControl). Two days later, mosquitoes were orally fed with non-infectious blood or infectious blood containing DENV at 107 pfu/ml. (A) Validation of AGPAT1 silencing in non-infected mosquitoes at two days post dsRNA injection. Actin expression was used for normalization. Bars show mean ± s.e.m. from 3 pools of 5 mosquitoes each. ****, p-value < 0.0001 as indicated by unpaired t-test. (B) Impact of AGPAT1 depletion on the lipidome of mosquitoes at 2 and 7 days post non-infectious blood feeding (dpb). Impact of AGPAT1 depletion on (C) DENV gRNA copies and (D) viral load measured as pfu/ml at 7 days post oral infection (dpi). Bars indicate mean (C) or geometric means ± 95% CI (D) with each dot representing one mosquito. ***, p-value < 0.001 ****, p-value < 0.0001 as indicated by unpaired t-test (C) or Mann-Whitney test (D). (E) Impact of AGPAT1 depletion on the lipidome of infected mosquitoes at 7 dpi. (F) Impact of infection on the lipidome of AGPAT1-depleted mosquitoes at 7 dpi. (B, E, F) Only regulated metabolites are shown (p-value < 0.05 and |log2 fold change| > 1). PL, phospholipid; FA; fatty acyl; AC, acylcarnitine; DAG, diacylglycerol; PA, phosphatidic acid; PS, phosphatidylserine; LPE, lysophosphatidylethanolamine; LPC, lysophosphatidylcholine; LPS, lysophosphatidylserine; LPG, lysophosphatidylglycerol; LPI, lysophosphatidylinositol; PE, phosphatidylethanolamine; PC, phosphatidylcholine; PI, phosphatidylinositol; GPEtn, glycerophosphoethanolamine.

AGPAT1 depletion increases DENV multiplication and consumption of aminoPLs in mosquitoes.

Mosquitoes were injected with either dsRNA against AGPAT1 (dsAGPAT1) or dsRNA control (dsControl). Two days later, mosquitoes were orally fed with non-infectious blood or infectious blood containing DENV at 107 pfu/ml. (A) Validation of AGPAT1 silencing in non-infected mosquitoes at two days post dsRNA injection. Actin expression was used for normalization. Bars show mean ± s.e.m. from 3 pools of 5 mosquitoes each. ****, p-value < 0.0001 as indicated by unpaired t-test. (B) Impact of AGPAT1 depletion on the lipidome of mosquitoes at 2 and 7 days post non-infectious blood feeding (dpb). Impact of AGPAT1 depletion on (C) DENV gRNA copies and (D) viral load measured as pfu/ml at 7 days post oral infection (dpi). Bars indicate mean (C) or geometric means ± 95% CI (D) with each dot representing one mosquito. ***, p-value < 0.001 ****, p-value < 0.0001 as indicated by unpaired t-test (C) or Mann-Whitney test (D). (E) Impact of AGPAT1 depletion on the lipidome of infected mosquitoes at 7 dpi. (F) Impact of infection on the lipidome of AGPAT1-depleted mosquitoes at 7 dpi. (B, E, F) Only regulated metabolites are shown (p-value < 0.05 and |log2 fold change| > 1). PL, phospholipid; FA; fatty acyl; AC, acylcarnitine; DAG, diacylglycerol; PA, phosphatidic acid; PS, phosphatidylserine; LPE, lysophosphatidylethanolamine; LPC, lysophosphatidylcholine; LPS, lysophosphatidylserine; LPG, lysophosphatidylglycerol; LPI, lysophosphatidylinositol; PE, phosphatidylethanolamine; PC, phosphatidylcholine; PI, phosphatidylinositol; GPEtn, glycerophosphoethanolamine. Next, we found that AGPAT1-depletion increased DENV gRNA (p-value = 0.0004) and titer (p-value < 0.0001) at 7 dpi in whole mosquito (Fig 4C and 4D), confirming that AGPAT1 depletion induces a pro-viral environment in vivo. However, the pro-viral impact of AGPAT1 depletion was not observed on infection rate (S11A Fig) and at 2 dpi on gRNA (S11B Fig). We repeated the experiment using a lower inoculum for oral infection and similarly observed no effect at 2 dpi but a moderate increase of gRNA (p = 0.0421) at 7 dpi (S11CS11E Fig). It is intriguing that AGPAT1 depletion only increased infection at 7 dpi. This may indicate that DENV infection is necessary to amplify AGPAT1-mediated alteration in establishing a pro-viral environment. To characterize the AGPAT1-induced proviral environment, we compared the lipidome of infected mosquitoes that were AGPAT1 depleted or not. AGPAT1-depletion increased aminoPL concentrations at 7 dpi (Fig 4E; S9 Table). Specifically, one PC, four PEs and one glycerophosphoethanolamine were upregulated. By artificially modulating the metabolome, we revealed that AGPAT1 depletion favors DENV by increasing aminoPL concentrations. When profiling metabolic changes throughout mosquito DENV cycle, we observed that aminoPLs were reduced at the end of DENV cycle (Fig 1C). To test whether this reduction occurred when aminoPL concentrations were increased by AGPAT1 depletion (Fig 4E), we examined how DENV modifies the lipidome in AGPAT1-depleted mosquitoes. Control mosquitoes were depleted of AGPAT1 and fed a non-infectious blood meal. At 7 dpi, aminoPLs were drastically decreased by DENV despite AGPAT1-depletion enhancement (Fig 4F; S10 Table). Specifically, three PEs and five PCs were reduced more than 100 folds. These results suggest that, by reproducing infection-induced aminoPL reconfiguration, AGPAT1 depletion amplifies the DENV reconfiguration, thereby promoting infection. Altogether, our results indicate that DENV inhibits AGPAT1 expression to increase the amplitude of aminoPLs consumption/redirection for virus multiplication.

Discussion

By combining observational and manipulative approaches in vitro and in vivo, we deciphered how DENV hijacks the mosquitoes’ metabolome. We deployed metabolomic profiling throughout the mosquito DENV cycle, and revealed an overall increase in aminoPLs, followed by a reduction at the end of the cycle. We next showed that aminoPL reconfiguration is partially mediated by infection-induced AGPAT1 down-regulation, which increases aminoPL concentrations. Because AGPAT1 depletion promotes virus multiplication, our study discovers a mechanism whereby DENV reconfigures the metabolome to its benefit. Furthermore, we show that in an environment richer in aminoPLs (AGPAT1 depletion), infection reduces aminoPL concentrations at a higher and earlier rate than in a wild-type organism, while increasing virus production. This suggests that DENV consumes/redirects aminoPLs, although this is based on correlations between indirect lipidome alteration and virus multiplication. Altogether, we propose a model whereby DENV regulates aminoPL enzymes to increase aminoPL concentrations early during the cycle and consumes/redirects them for its multiplication. We revealed that DENV-induced phospholipidome reconfiguration is partially mediated by lowering AGPAT1 expression. Indeed, AGPAT1 was downregulated upon infection and its depletion partially recapitulated DENV-induced aminoPL reconfiguration both in vitro and in vivo. That we only partially recapitulated the DENV-induced phospholipidome reconfiguration suggests that other enzymes, such as those directly producing and those hydrolyzing aminophospholipids [43], play a role. AGPAT enzymes can influence PL composition at several levels. By catalyzing the second acylation that produces PA (Fig 2A), AGPAT enzymes are responsible for a rate-limiting step in PL biogenesis [35]. However, we did not observe PA reduction upon AGPAT1 depletion and instead reported an alteration of aminoPLs. This pattern was previously observed in hAGPAT-depleted human cells [40] and was attributed to compensation by other AGPAT isoforms. Lack of AGPAT1 may unbalance substrate competition with other isoforms with different lysoPA and acyl affinity [44]. Consequently, this can influence PA structure and subsequent PL composition. In addition, certain AGPAT isoforms can transfer acyls to lysoPL, thus, participating in PL remodeling independently of de novo synthesis [45]. In mosquito cells, AGPAT2 depletion also altered PL profile. However, AGPAT2 expression is not reduced by DENV infection and its depletion does not impact virus multiplication. The correlation between expression of AGPAT isoforms and their impacts on infection indicates a fine regulation of metabolism by DENV, and identifies a new mechanism by which the virus hijacks the host phospholipidome. The expression of AGPATs is regulated either directly through their transcription factors or indirectly by altering the endoplasmic reticulum topology. Sterol regulatory element binding proteins (SREBP) coordinate fatty acid, sterol and phospholipid metabolisms by transcriptionally regulating enzymes, such as acyl transferases [46]. DENV protein interaction with SREBP, as described with other transcription factors [47], could alter AGPAT expressions. In support of this, chemical inhibition of SREBP blocks DENV replication [48]. Alternatively, AGPAT activity is influenced by substrate accessibility, which depends on membrane topology [36]. Several DENV proteins are embedded in the endoplasmic reticulum membrane and modify its topology [49,50]. This can alter endoplasmic reticulum-located AGPAT activity, PL profile and activate acyl-transferase expressions to restore homeostasis [51]. DENV intricately interacts with aminoPL-containing membranes and a change as we report can alter several stages of its life-cycle, such as entry, replication, translation, assembly and egress [7,16]. DENV interacts with the plasma membrane for entry and fusion, and with the endoplasmic reticulum membrane for translation, replication and assembly [28]. These membranes are mostly composed of PE and PC, and PS in lower proportions [52]. Their fluidity and topology are determined by the aminoPL structure and concentration. The cylindrical shape of PCs stabilizes lipid bilayers, whereas the conical shape of PEs induces curvature. Several flavivirus-aminoPL interactions have been described in human cells. PLs present in the DENV envelope are recognized by cellular ligands and mediate entry [53,54]. Replication of flaviviruses induce the invagination of the endoplasmic reticulum by altering PE [55,56] and lysoPC compositions [43]. Alternatively, AGPAT expressions could alter anti-viral immune response [57]. In mammalian cells, AGPAT overexpressions amplify cellular signaling of cytokine [58] that can reduce DENV infection in mosquito cells [59]. Although the precise function of AGPAT1-regulated aminoPLs is unknown and may be multifactorial, previous studies and ours indicate that membrane aminoPL reconfiguration influences DENV multiplication. In conclusion, our study determines the importance of aminoPL reconfiguration for DENV infection. We also reveal the underlying mechanism for viral phospholipidome reconfiguration. The intricate metabolic interactions between DENV and mosquitoes represents a target to control transmission.

Materials and methods

Aedes aegypti mosquitoes and cell line

The Aedes aegypti colony was established in 2010 from Singapore and was reared at 28°C and 60% relative humidity with 12h:12h light:dark cycle. Eggs hatched in milliQ water were fed with a mix of fish food (TetraMin fish flakes), yeast and liver powder (MP Biomedicals). Adults were held in rearing cages (Bioquip) supplemented with water and 10% sucrose solution. Aedes aegypti Aag2 cells [60] were grown in RPMI-1640 medium (Gibco) with 10% filtered fetal bovine serum (FBS) (Hyclone) and 1% Penicillin-Streptomycin (Gibco). For media supplementation, 2 mM of ethanolamine (Sigma) was added to Aag2 growth medium. Cells were maintained in vented culture flasks in a humidified incubator with 5% CO2 at 28°C. BHK-21 (baby hamster kidney) (ATCC CCL-10) cells were grown in the same media and maintained at 37°C with 5% CO2.

Dengue virus

Dengue virus serotype-2 strain ST (DENV) was collected from the Singapore General Hospital in 1997 [61]. DENV was propagated alternatively in Vero (ATCC CCL-81) and C6/36 (ATCC CRL-1660) cells. Virus titer was determined by plaque assay using BHK-21 cells. DENV supernatant was exposed to UV light from biosafety cabinet (Sterilgard III advance, the Baker Company) for 1h at room temperature for inactivation.

Oral infection of mosquitoes

Two- to four-day-old adult female mosquitoes were starved for 24h before oral feeding on a blood meal containing 40% volume of washed erythrocytes from SPF pig’s blood (PWG Genetics, Singapore), 5% of 100 mM ATP (Thermo Fisher Scientific), 5% of human serum (Sigma-Aldrich) and 50% of DENV-2 in RPMI media (Gibco). The virus titer in the blood meal was 2 x 107 pfu/ml and validated by plaque assay. Blood was maintained at 37°C using hemotek membrane feeder system (Discovery Workshops) with sausage casing for 1.5 h. A control group was allowed to feed on the same mix of SPF pig blood meal without virus. Engorged mosquitoes were visually selected and maintained at 28°C with water and 10% sucrose solution.

Cell inoculation

5 x 106 cells were inoculated with DENV at an MOI of 5 in serum-free RPMI media for 1h. The inoculum was then replaced with 2% FBS RPMI media. Mock infection was used as negative control.

Metabolite extraction from mosquitoes, midguts and cells

At 1, 7 and 14 days post-oral feeding, 10 mosquitoes in 500 μl of ice-cold methanol and water ratio of 80:20 (LCMS grade, Thermo Fisher) were homogenized with bead Mill homogenizer (FastPrep-24, MP Biomedicals) and sonicated for 15 min in an ultrasonic bath (J.R. Selecta) at 4°C. Homogenates were centrifuged at 10,000 rpm for 1 min at 4°C to collect 400 μl supernatant. Pellets were further extracted twice by addition of 500 μl of methanol:water (80:20), followed by centrifugation. Supernatants were combined and vacuum-dried (Speed-Vac, Thermo-Scientific) before storage at -20°C. At 1 and 7 days post-oral feeding, 10 midguts were homogenized in 200 μl of the methanol:water (80:20) solution and 120 μl of supernatant was collected three times with the same protocol. At 6, 12, 24 and 48 h post-inoculation, cells were washed with room temperature 0.9% NaCl and collected in 2 ml of ice-cold methanol:water (80:20) by scraping. Cells were homogenized by ultrasound and extracted thrice as detailed above by adding 500 μl of ice-cold methanol:water (80:20). Three biological replicates were conducted per condition.

LC-HRMS metabolism profiling

Dry extracts were normalized at 2 mg/mL in methanol:water 80:20 solution and metabolites were detected using two methods. Compounds from medium range polarity to lipophilic substances were detected using a UPLC-UV-QTOF-MSE instrument (Xevo G2 QTof, Waters) mounted on an electrospray ionization (ESI) source, with a UPLC BEH C18 Acquity column (100 × 2.1 mm i.d., 1.7 μm, Waters) equipped with a guard column. Mobile phase A was of 0.1% formic acid in water, B was 0.1% formic acid in acetonitrile. The flow rate was 400 μl/min and the gradient ran with 98% A for 0.5 min to 20% B over 3.5 min, 98% B for 8 min, held at 98% B for 3 min, and returned in 0.5 min to initial conditions (98% A), finally held for 3.5 min to assure equilibration before the subsequent analysis. Detection was performed at 254 nm by TOF-MS in both electrospray (ESI) negative mode with voltage at 2.5 kV and positive mode with voltage at 3.0 kV. The m/z range was 100–1200 Da with a scan time of 0.1 s. All detected ions were fragmented using MSE scan with an energy collision ramp from 20 to 50 eV. All analyses were acquired using leucine enkephalin as the lock mass at a concentration of 400 pg/μl and flow rate 7 μl/min. The injection volume was 2 μl and samples were kept at 10°C during the whole analysis. Polar metabolites were profiled using a UPLC-LTQ Orbitrap XL instrument (Ultimate 3000, Thermo Fisher Scientific, Hemel Hempstead, UK) set at 15,000 resolution, with a Zic-pHilic column (150 × 2.1 mm i.d., 5 μm, SeQuant, Merck). Mobile phase A was 20 mM ammonium acetate buffered at pH 9 and B was acetonitrile. The flow rate was 250 μl/min and the gradient ran from 90% B for 0.5 min to 40% B over 18 min, held at 40% B for a further 3 min, and then returned in 0.5 min to initial conditions (90% B) finally held for 5 min before subsequent analysis. The m/z range was 100–1500 and ISpray voltage at 4.2 kV (positive mode) and 3.0 kV (negative mode). Each full MS scan was followed by data dependent MS/MS on the two most intense ions using stepped CID fragmentation mode at 35% normalized collision energy, isolation width of 2 u and activation Q set at 0.250.

Data analysis and visualization

Peak detection and alignment were performed using MS-DIAL (ver. 3.12) [62]. Peak annotation was done using MS-finder (ver. 3.04) [63] with HMDB, ChEBI, LipidMAPS and LipidBlast databases, allowing a level 2.2 of metabolite identification [64,65]. Data were normalized by total ion chromatogram (TIC) and features lower than 2-fold average blank were removed. Each LC-HRMS condition was analyzed separately before concatenation. Data were normalized by auto-scaling before selecting regulated metabolites with more than 2-fold intensity change and a p-value < 0.05 with FDR adjustment as indicate by unpaired t-test using MetaboAnalyst (ver. 4.0) [66]. To account for physiological variations between the different time-tissue combinations, the t-tests were done by comparing the same tissue in infected and uninfected conditions within each time. Uninfected condition was used as control. PCA for quality control was performed with MetaboAnalyst (ver. 4.0). MS/MS similarity metabolic networks with cut-off > 60% were generated with MS-Finder for each LC-HRMS mode-tissue combination.

dsRNA-mediated RNAi

Templates for dsRNA against AAEL011898 and AAEL001000 were PCR amplified with primers flanked with a T7 promoter (S3 Table) from mosquito cDNA. dsRNA was synthetized with megaScript T7 transcription kit (Thermo Fisher Scientific), extracted in DEPC-treated water and annealed by slowly cooling down from 95°C. Control dsRNA targeting LacZ was produced [67]. Two- to five-day-old cold-anesthetized female mosquitoes were intrathoracically injected with 69 nl of 3 mg/ml of dsRNA by using Nanoject II injector (Drummond Scientific). Mosquitoes were then maintained at 28°C with water and 10% sucrose solution before oral infection as detailed above. Cells were seeded at 2 x 105 per 24-well plate and transfected after 24h with 1 μg of dsRNA by using TransIT-mRNA Transfection kit (Mirusbio). Infection with DENV was done one day post transfection.

Quantification of DENV genomic RNA

Single mosquitoes or tissues were homogenized in 350μl of TRK lysis buffer (Omega Bio-tek) using a bead Mill homogenizer (FastPrep-24, MP Biomedicals). Total RNA was extracted using E.Z.N.A. Total RNA kit I (Omega Bio-tek) and eluted in 30μl of DEPC-treated water. Genomic RNA (gRNA) was quantified with one-step RT-qPCR using iTaq Universal probe kit (Bio-Rad) and primers and probes targeting the DENV Envelope [68]. The 12.5 μl reaction mix contained 1 μM of forward and reverse primers, 0.125 μM of probe and 4 μl of RNA extract. Quantification was conducted on a CFX96 Touch Real-Time PCR Detection System (Bio-Rad). Thermal profile was 50˚C for 10 min, 95˚C for 1 min and 40 cycles of 95˚C for 10 sec and 60˚C for 15 sec. An absolute standard curve was generated by amplifying fragments containing the qPCR target using a forward primer tagged with T7 promoter; forward: 5’-CAGGATAAGAGGTTCGTCTG-3’ and reverse: 5’-TTGACTCTTGTTTATCCGCT-3’, resulting in a 453bp fragment. The fragment was reverse transcribed using MegaScript T7 transcription kit (Ambion) and purified using E.Z.N. A. Total RNA kit I. The total amount of RNA was quantified using a Nanodrop (Thermo Fisher Scientific) to estimate copy number. Ten times serial dilutions were made and used to generate absolute standard equation for gRNA. In each subsequent RT-qPCR plate, five standards were added to adjust for threshold variation between plates. The infection rate was calculated by dividing the number of samples with detectable gRNA over total number of samples.

Titration

Titration was conducted by plaque assay with BHK-21 cells as described previously [69]. Briefly, 80–90% confluent cells were inoculated with serial 10-fold dilutions of samples for 1h. Cells were then incubated with 1% carboxyl-methyl cellulose (CMC) (Merck) for 5 days, fixed with 4% formaldehyde (Merck) -PBS and stained with 1% crystal violet (Sigma-Aldrich) solution to count plaque forming units (pfu).

Quantification of gene expression

Total RNA from five mosquitoes was extracted using E.Z.N.A. Total RNA kit I, treated with RapidOut DNA Removal kit (Thermo Fisher Scientific) and reverse transcribed with iScript cDNA Synthesis Kit (Bio-Rad). Gene expression was quantified using iTaq Universal SYBR Green Supermix (Bio-Rad) and primers detailed in S4 Table. Actin expression was used for normalization. Quantification was conducted in a CFX96 Touch Real-Time PCR Detection System (Bio-Rad). Thermal profile was 95°C for 1 min and 40 cycles of 95°C for 10 sec and 60°C for 15 sec. Three biological replicates were conducted.

Statistical analysis

Differences in gRNA copies per infected mosquito were tested on values using unpaired t-test or Mann-Whitney test depending on the normal distribution estimated with D’agostino and Pearson normality test. Differences in percentages were tested using χ2 test. Tests were performed with GraphPad PRISM software (ver. 6.01).

AGPAT sequence alignment

Amino acid sequence homology was determined by MEGA X software (ver. 10.0.5), using Maximum Likelihood and bootstrapping. FASTA sequences (S5 Table) were retrieved from ncbi.nlm.nih.gov.

Quantification of DENV infection in Aag2 cells, A. aegypti mosquito and midgut.

(A) DENV gRNA copies in Aag2 cells at 6, 12, 24 and 48h post-infection with DENV at MOI = 5. Points from 4 repeat and standard errors show geometric mean ± 95% CI. (B) Plaque titer (plaque forming unit—pfu) in supernatant from Aag2 cells at 6, 12, 24 and 48h post-infection. Aag2 cells were infected with DENV at MOI = 5 and virus titer was calculated using plaque assay. Each point represents one well. (C) DENV gRNA copies per infected mosquitoes and dissected midguts at 1, 7 and 14 days post-oral infection with 107 pfu/ml. Each point represents one mosquito or midgut. Bars show geometric mean ± 95% CI. (D) Infection rate in whole mosquito and midgut at 1, 7 and 14 days post-oral infection. Bars represent percentages ± s.e. (TIF) Click here for additional data file.

LC-HMRS analytical pipeline.

Liquid Chromatography-High Resolution Mass Spectrometry (LC-HRMS) pipeline used to detect polar and nonpolar metabolites. (TIF) Click here for additional data file.

Spectral similarity network from mosquito MS features.

Example of a molecular spectral network for Ae. aegypti mosquito at 14 days post-infection using MS features detected with the non-polar LC condition and MS negative mode. Line length represents the MS/MS score similarity. Ontology for unknown features was determined based on the proximity with database-identified features. (TIF) Click here for additional data file.

Ion intensity of regulated metabolites in cells, midguts and mosquitoes infected with DENV and mock.

Normalized ion intensity was calculated after total ion chromatography normalization and auto scaling from three biological replicates. Conditions with significantly regulated metabolites (p-value <0.05 and |log2 fold change| >1) were indicated with an asterisk. Only metabolites from the general metabolism (i.e., lipid, carbohydrate, amino acid and peptide, nucleotide and nucleoside, sialic acid) are shown. †, indicates metabolite annotated by spectral similarity. Carbo., carbohydrate; SA, sialic acid; PL, phospholipid; PE, phosphatidylethanolamine; PC, phosphatidylcholine; PS, phosphatidylserine; PA, phosphatidic acid; PI, phosphatidylinositol; PG, phosphatidylglycerol; LysoPS, lysophosphatidylserine; LysoPC, lysophosphatidylcholine; LysoPE, lysophosphatidylethanolamine; LysoPG, lysophosphatidylglycerol; LysoPI, lysophosphatidylinositol; SM, Sphingomyelin; DAG, Diacylglycerol; MAG, Monoacylglycerol; FAHFA, Fatty Acid ester of Hydroxyl Fatty Acid; NAE, N-acylethanolamine; HEA, Heneicosanoic acid; pep., peptides. (TIF) Click here for additional data file.

AGPAT genes are regulated by DENV infection, from Colpitts transcriptomic data.

Ae. aegypti female mosquitoes were inoculated with DENV serotype 2 and collected at 1, 2 and 7 days post inoculation for transcriptomic analysis using microarray. Data from 3 separate infections. AGAPAT 1–5 were found significantly regulated by DENV infection. Data retrieved from (Colpitts et al., 2011, PMID: 21909258). (TIF) Click here for additional data file.

UV-inactivated DENV does not regulate AGPAT1 expression.

Aag2 cells were infected with an MOI of 5 of DENV (DENV-WT), UV-inactivated DENV (DENV-UV) or mock. Cells were analyzed at 24 and 48 hours post-infection (hpi). (A) DENV gRNA copies. Bars show geometric means ± 95% C.I. (B) AGPAT1 expression relative to Actin level. Bars show arithmetic means ± s.e.m. (A-B) Each point represents an independent well. ***, p-value < 0.001 as determined by unpaired t-test. (TIF) Click here for additional data file.

Metabolomic impact of AGPAT1 and AGPAT2 depletion and infection in cells as measured by ion intensity.

Aag2 cells were transfected with dsRNA against AGPAT1 (dsAGPAT1) or AGPAT2 (dsAGPAT2) or a dsRNA control (dsControl). 24h later, cells were infected with DENV at MOI of 1. (A) Ion intensity of regulated metabolites in mock cells at 72h post transfection. (B) Ion intensity of regulated metabolites in infected cells at 24 hpi. Normalized ion intensity was calculated after total ion chromatography normalization and auto scaling from three replicates. Conditions with significantly regulated metabolites (p-value <0.05 and |log2 fold change| >1) were indicated with an asterisk. PE, phosphatidylethanolamine; PC, phosphatidylcholine; PS, phosphatidylserine; LPE, lysophosphatidylethanolamine. (TIF) Click here for additional data file.

AGPAT1 and 2 expression in cells after the other AGPAT depletion.

Aag2 cells were transfected with dsRNA against AGPAT1 or 2 (dsAGPAT1 or 2). Control cells were transfected with dsRNA control (dsControl). Cells were collected 72h post dsRNA. (A) AGPAT1 expression in AGPAT2-depleted cells. (B) AGPAT2 expression in AGPAT1-depleted cells. Bars show mean ± s.e.m from 3 biological replicates. ns, non-significant, as indicated by unpaired t-test. (TIF) Click here for additional data file.

Ethanolamine supplementation partially rescued infection increase upon AGPAT1 depletion.

24h before infection, Aag2 cells were transfected with dsRNA against AGPAT1 (dsAGPAT1) or with dsRNA control (dsControl) and reared in standard growth media or the same media supplemented with 2mM ethanolamine. Cells were infected with DENV at MOI of 1 and gRNA copy was quantified 48h later. Bars show geometric means ± 95% C.I. Each point represents an independent well. *, p-value < 0.05; **, p-value < 0.01 as determined by unpaired t-test. (TIF) Click here for additional data file.

Metabolomic impact of AGPAT1 and AGPAT2 depletion in uninfected mosquitoes as measured by ion intensity.

Two days post dsRNA injection against AGPAT1 (dsAGPAT1) or control (dsControl), mosquitoes were orally infected with DENV at 107 pfu/ml. Metabolomic analyses were performed at 2 and 7 dpi. Normalized ion intensity was calculated after total ion chromatography normalization and auto scaling from three replicates. Conditions with significantly regulated metabolites (p-value <0.05 and |log2 fold change| >1) were indicated with an asterisk. (TIF) Click here for additional data file.

Impact of AGPAT1-depletion in mosquitoes on DENV infection rate and gRNA copies.

Mosquitoes were injected with either dsRNA against AGPAT1 (dsAGPAT1) or dsRNA control (dsControl). Two days post injection, mosquitoes were orally fed with either non-infectious blood or DENV infectious blood. Impact of AGPAT1 depletion on (A) infection rate and (B) DENV gRNA copies at 2 days post oral infection (dpi) with 107 pfu/ml. (C-E) Impact of AGPAT1 depletion on infection rate (C) and DENV gRNA copies at 2 (D) and 7 (E) dpi with 106 pfu/ml. Bars indicate percentage ± s.e. (A, C) or geometric means ± 95% C.I. (B, D, E) with each dot representing one mosquito. *, p-value < 0.05 as indicated by Mann-Whitney test. (TIF) Click here for additional data file.

Identification of mosquito specific metabolites by spectral similarity.

(DOCX) Click here for additional data file.

Metabolites detected from cell, midgut and whole mosquito with differential regulation upon DENV infection.

The three tabs contain compound detected on cell, midgut and mosquito with the following information: ionization mode (positive and negative), phase detection (polar and non-polar), the mass average m/z between replicate, the retention time average Rt in minutes between replicates, the MS/MS spectrum fragmentation and intensity, adducts [M+H]+ and [M-H]-, metabolites of importance in Fig 1C, regulated compound with abundance between DENV-infected and uninfected samples (p-value < 0.05 and |log2 fold change| ≥ 1) and annotation classes with the first 3 ranks of identification by MS-Finder. (XLSX) Click here for additional data file.

Primers for dsRNA.

(DOCX) Click here for additional data file.

Primers for Real-Time qPCR.

(DOCX) Click here for additional data file.

AGPAT FASTA protein sequences.

(DOCX) Click here for additional data file.

Metabolites detected from uninfected cell, after AGPAT1 or AGPAT2 depletion.

The table contains compound detected on cell with the following information: ionization mode (positive and negative), the mass average m/z between replicate, the retention time average Rt in minutes between replicates, the MS/MS spectrum fragmentation and intensity, adducts [M+H]+ and [M-H]-, metabolites of importance in Fig 3C, regulated compound with abundance between dsAGPAT1 or 2 and dsControl samples (p-value < 0.05, |log2 fold change| ≥ 1) and annotation classes with the first 3 ranks of identification by MS-Finder. (XLSX) Click here for additional data file.

Metabolites detected from DENV-infected cell at 48 hpi, after AGPAT1 or AGPAT2 depletion.

The table contains compound detected on cell with the following information: ionization mode (positive and negative), the mass average m/z between replicate, the retention time average Rt in minutes between replicates, the MS/MS spectrum fragmentation and intensity, adducts [M+H]+ and [M-H]-, metabolites of importance in Fig 3E, regulated compound with abundance between dsAGPAT1 or 2 and dsControl samples (p-value < 0.05, |log2 fold change| ≥ 1) and annotation classes with the first 3 ranks of identification by MS-Finder. (XLSX) Click here for additional data file.

Metabolites detected from uninfected mosquito after AGPAT1 depletion.

The two tabs contain compound detected on cell after 2 or 7 days post blood feeding with the following information: ionization mode (positive and negative), the mass average m/z between replicate, the retention time average Rt in minutes between replicates, the MS/MS spectrum fragmentation and intensity, adducts [M+H]+ and [M-H]-, metabolites of importance in Fig 4B, regulated compound with abundance between dsAGPAT1 and dsControl samples (p-value < 0.05, |log2 fold change| ≥ 1) and annotation classes with the first 3 ranks of identification by MS-Finder. (XLSX) Click here for additional data file.

Metabolites detected from DENV-infected mosquito after dsAGPAT1 depletion or dsControl.

The table contains compound detected on cell with the following information: ionization mode (positive and negative), the mass average m/z between replicate, the retention time average Rt in minutes between replicates, the MS/MS spectrum fragmentation and intensity, adducts [M+H]+ and [M-H]-, metabolites of importance in Fig 4E, regulated compound with abundance between dsAGPAT1 and dsControl samples (p-value < 0.05, |log2 fold change| ≥ 1) and annotation classes with the first 3 ranks of identification by MS-Finder. (XLSX) Click here for additional data file.

Metabolites detected from DENV-infected or uninfected mosquito after AGPAT1 depletion.

The table contains compound detected on cell with the following information: ionization mode (positive and negative), the mass average m/z between replicate, the retention time average Rt in minutes between replicates, the MS/MS spectrum fragmentation and intensity, adducts [M+H]+ and [M-H]-, metabolites of importance in Fig 4F, regulated compound in dsAGPAT1 condition only, regulated compound with abundance between DENV-infected and Mock samples in dsControl or dsAGPAT1 condition (p-value < 0.05, |log2 fold change| ≥ 1) and annotation classes with the first 3 ranks of identification by MS-Finder. (XLSX) Click here for additional data file. 16 Jul 2019 Dear Dr Pompon, Thank you very much for submitting your manuscript "Dengue virus inhibits AGPAT1 to alter phospholipids and enhance infection in Aedes aegypti" (PPATHOGENS-D-19-00992) for review by PLOS Pathogens. Your manuscript was fully evaluated at the editorial level and by independent peer reviewers. The reviewers appreciated the attention to an important problem, but raised some substantial concerns about the manuscript as it currently stands. These issues must be addressed before we would be willing to consider a revised version of your study. We cannot, of course, promise publication at that time. We therefore ask you to modify the manuscript according to the review recommendations before we can consider your manuscript for acceptance. Your revisions should address the specific points made by each reviewer. In addition, when you are ready to resubmit, please be prepared to provide the following: (1) A letter containing a detailed list of your responses to the review comments and a description of the changes you have made in the manuscript. Please note while forming your response, if your article is accepted, you may have the opportunity to make the peer review history publicly available. The record will include editor decision letters (with reviews) and your responses to reviewer comments. If eligible, we will contact you to opt in or out. (2) Two versions of the manuscript: one with either highlights or tracked changes denoting where the text has been changed; the other a clean version (uploaded as the manuscript file). While revising your submission, please upload your figure files to the Preflight Analysis and Conversion Engine (PACE) digital diagnostic tool, https://pacev2.apexcovantage.com. PACE helps ensure that figures meet PLOS requirements. To use PACE, you must first register as a user. Then, login and navigate to the UPLOAD tab, where you will find detailed instructions on how to use the tool. If you encounter any issues or have any questions when using PACE, please email us at figures@plos.org. Additionally, to enhance the reproducibility of your results, PLOS recommends that you deposit your laboratory protocols in protocols.io, where a protocol can be assigned its own identifier (DOI) such that it can be cited independently in the future. For instructions see http://journals.plos.org/plospathogens/s/submission-guidelines#loc-materials-and-methods We hope to receive your revised manuscript within 60 days. If you anticipate any delay in its return, we ask that you let us know the expected resubmission date by replying to this email. Revised manuscripts received beyond 60 days may require evaluation and peer review similar to that applied to newly submitted manuscripts. There is additional documentation related to this decision letter. To access the file(s), please click the link below. You may also login to the system and click the 'View Attachments' link in the Action column. [LINK] We are sorry that we cannot be more positive about your manuscript at this stage, but if you have any concerns or questions, please do not hesitate to contact us. Sincerely, Glenn Randall Associate Editor PLOS Pathogens Ana Fernandez-Sesma Section Editor PLOS Pathogens Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Grant McFadden Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-2556-3526 *********************** In particular, please note the need to establish causative and not correlative links, in addition to providing much more mechanistic detail as to how DENV modulates AGPAT1. Reviewer's Responses to Questions Part I - Summary Please use this section to discuss strengths/weaknesses of study, novelty/significance, general execution and scholarship. Reviewer #1: The authors perform metabolomic analysis on dengue infected cells and mosquitoes, which broadly agrees with previously published metabolomic studies on dengue infection of mosquitoes. They find that dengue infection induces substantial changes to various aminophospholipid species. Further, they find the dengue infection substantially reduces the expression of AGPAT, a key enzyme in phospholipid synthesis. siRNA-mediated targeting of AGPAT moderately increases viral replication in cell culture and in mosquitoes. Further, they find that siRNA-mediated depletion of AGPAT phenocopies aspects of the metabolic changes induced by dengue infection. The identification of AGPAT1 as a restriction factor whose downregulation could be contributing to dengue-induced metabolic remodeling has implications for the field’s understanding of dengue-induced metabolic remodeling, but as indicated below the authors over-interpret a number of correlations implying causality, which, when coupled to a lack of mechanistic details of how dengue targets AGPAT1 or how AGPAT1 contributes to dengue infection limit the impact of the current work. Reviewer #2: This study aims to understand how dengue virus (DENV) modulates mosquito metabolome to enhance virus production. Using high-resolution mass spectrometry, the authors identified changes in aminophospholipid (aminoPL) concentrations during the course of DENV infection in vitro and in vivo. They showed that the expression of 1-Acylglycerol-3-Phosphate O-Acyltransferase 1 (AGPAT1), a rate-limiting enzyme of phospholipid biogenesis, is decreased during DENV infection, whereas AGPAT1 knockdown leads to a modest increase in DENV production late in infection. This is a significant, but highly descriptive study. There is little mechanism as to how DENV utilizes a select group of phospholipids (PL) to enhance virus production. The study does not address how DENV infection causes AGPTA1 inhibition or the relationship between AGPAT1 inhibition and an increase in aminoPL concentration. It is unclear how in aminoPLs contribute to DENV infectivity in mosquitoes. Finally, if AGPTA1 plays a crucial role in DENV infectivity, its silencing should lead to a marked increase in DENV load. However, this is not the case in the current study. Reviewer #3: In the manuscript entitled “Dengue virus inhibits AGPAT1 to alter phospholipids and enhance infection in Aedes aegypti,” Vial et al study the metabolome of Aedes Aegypti mosquitos over time after dengue infection. While other metabolomics studies of the mosquito midgut following Dengue infection have been published (Chotiwan, PLoS Pathogens 2018), this one is more comprehensive including Aedes Aegypti cells, midguts, and whole mosquitos. Furthermore, this study goes beyond the previous one by examining the role of a host lipid synthesis enzyme in this process. The strengths of this manuscript include the provision of a comprehensive database reflecting metabolic changes during dengue infection of mosquitos and the uncovering of a novel pathogenesis mechanism for Dengue in which a mosquito gene that inhibits viral replication is downregulated by the virus during infection. Weaknesses include the presentation of the findings and statistical analysis of the data. ********** Part II – Major Issues: Key Experiments Required for Acceptance Please use this section to detail the key new experiments or modifications of existing experiments that should be absolutely required to validate study conclusions. Generally, there should be no more than 3 such required experiments or major modifications for a "Major Revision" recommendation. If more than 3 experiments are necessary to validate the study conclusions, then you are encouraged to recommend "Reject". Reviewer #1: Throughout the manuscript, the authors conclude that inhibition of AGPAT1 promotes infection by increasing aminophospholipids. While their data show a correlation between aminophospholipids levels, and dengue infection, a causal link between aminophospholipid levels and infection is never established. Are downstream aminophospholipid producing enzymes important for dengue infection? Does supplementation with specific aminophospholipids impact infection, e.g. in vitro? The authors claim, e.g. in the title, that dengue inhibits AGPAT1, this suggests inhibition of the protein. What the authors actually show is that AGPAT1 expression levels are down-regulated. What mediates this down regulation? Is live virus necessary for AGPAT1 down-regulation? Does UV-inactivated virus down-regulate AGPAT1 expression? Does AGPAT1 downregulation impact the phospholipid constituents of the virion? Or is the mosquito’s innate immune response to viral infection affected? In vitro, what aspects of the viral life cycle are impacted? Reviewer #2: Fig. 1 addresses the impact of DENV infection on Ae. Aegypti metabolome. In Fig. 1B, the Venn diagrams and related triangles need to be explained. In addition, there are no controls for the heat maps in Fig. 1C, making it hard to judge the data. Fig. 2C-E show a decrease in AGPTA1 mRNA levels, during the course of DENV infection. These data need to be validated with AGPTA1 protein expression during DENV infection. Fig. 3 addresses the impact of AGPAT silencing on aminoPL levels and DENV replication in mosquito cells. First, it will be helpful to show the control PL samples for the heat maps in Fig. 3C and 3E. It is hard to compare the PL heat maps, from mock and DENV-infected cells, when they show different PL species. In Fig. 3D, it is also hard to interpret the DENV infection data based on the heat maps in Fig. 3C and 3E.There is only a modest increase in DENV production after AGPAT1 knockdown. Fig. 4 addresses the impact of AGPAT1 silencing on DENV replication and aminoPL consumption in mosquitoes. Please, show the heat map for control siRNA-treated mosquitoes in Fig. 4B. In Fig. 4CD, contrary to the authors assertion, AGPAT1 knockdown in mosquitoes shows no significant impact on DENV infectivity at day 2 or 7 postinfection. The DENV infection rate at day 7 (Fig. 4C) is clearly not impacted by AGPAT1 knockdown. There might be a slight increase in DENV genome replication at day 7, but is there a significant change in DENV load in these mosquitoes? Reviewer #3: 1) Figure 2: AGPAT1 expression is decreased in cells and whole mosquitos. Given that the virus disseminates from the midgut and that the decrease in AGPAT1 expression does not explain the observed increase in aminophospholipids in the midgut early in infection, the authors should also measure AGPAT1 and 2 expression in the mosquito midgut. 2) Figure 3D: the control should have as many data points as the test samples. ********** Part III – Minor Issues: Editorial and Data Presentation Modifications Please use this section for editorial suggestions as well as relatively minor modifications of existing data that would enhance clarity. Reviewer #1: A thorough metabolomics analysis of dengue infection in mosquitoes was previously published in Plos Pathogens in early 2018 (PMID: 29447265), which has somewhat similar findings. Similarities and potential differences should be addressed in the discussion. In the abstract, the authors claim the dengue infection increases AGPAT1, when all their data indicates that dengue markedly reduces it. This is likely just a typo, but should clearly be fixed as it is a central conclusion. In Figure 1, its unclear which of the metabolites are significant. The figures would be easier to interpret with an added scheme to enable readers to quickly assess significance of specific changes. In Figure 3C and 3E, the data should not be shown as a heat map. They should be plotted so that fold changes and data variance/errors can be easily assessed. Reviewer #2: The manuscript needs editing. Reviewer #3: 1) Abstract: While the abstract length is limited, it is critical to spell out AGPAT and its function in one sentence so readers are not left in the dark. An indication of which aminophospholipids the study is focused on might also be helpful. 2) Line 22: Is this a typographical error? Figure 2 shows that Dengue infection decreases expression of AGPAT1 rather than the opposite. 3) Line 39, sentence beginning with “however:” This sentence is confusing and should be rewritten. 4) Line 147: “PL were the most regulated.” This is a vague statement. Do the authors mean that the largest changes in abundance were seen for these metabolites over the course of the infection? 5) Lines 151-189: In this section, the authors describe in detail the changes in different types of lipids without adding any insight into processes that are at work. These changes are already apparent in Figure 1 and could also be gleaned from supplementary datasets. I would suggest shortening this section and only describing in prose changes that provide insight into the possible underlying mechanisms. 6) Lines 194-5: Please describe what “the reaction” is. 7) Lines 208-9 and Figure 2: Upregulation of AGPAT2 is not convincing and not significant. I would recommend leaving this statement out. 8) Figure 2: AGPAT1 expression is decreased in cells and whole mosquitos. Given that the virus disseminates from the midgut and that the decrease in AGPAT1 expression does not explain the observed increase in aminophospholipids in the midgut early in infection, the authors should also measure AGPAT1 and 2 expression in the mosquito midgut. 9) Figure 3D: The increase in PFU is quite small, suggesting that this may be a minor contributor. More importantly: An unpaired t-test is used to assess statistical significance. A multiple comparisons test such as an ANOVA would be a more appropriate statistical test to apply here. 10) Methods: The authors state that they used an unpaired t-test to analyze the metabolomics data. The authors should specify which condition was used as the “control.” In addition, for metabolomics time courses such as that shown in Figure 1C, a multiple comparisons test should be used to assess statistical significance rather than an unpaired t test. 11) Methods: Please specify when replicates are experimental and when they are technical replicates rather than describing as “repeats.” ********** PLOS authors have the option to publish the peer review history of their article (what does this mean?). If published, this will include your full peer review and any attached files. If you choose “no”, your identity will remain anonymous but your review may still be made public. Do you want your identity to be public for this peer review? For information about this choice, including consent withdrawal, please see our Privacy Policy. Reviewer #1: No Reviewer #2: No Reviewer #3: No Submitted filename: Konan REVIEW-Vial et al PPAT-D-19-00992-070319.docx Click here for additional data file. 12 Oct 2019 Submitted filename: PPATHOGENS-D-19-00992 answer to reviewerscomments.docx Click here for additional data file. 24 Oct 2019 Dear Dr Pompon, Thank you very much for submitting your manuscript "Dengue virus reduces AGPAT1 expression to alter phospholipids and enhance infection in Aedes aegypti" (PPATHOGENS-D-19-00992R1) for review by PLOS Pathogens. The editors have reviewed your revision and would like you  to experimentally address some of the points made by Reviewer #1. In particular, is the issue of whether phopsphatidic acid (or its downstream products) is inhibitory to DENV replication in vitro (Aag cells) both in wild type infection and the silencing experiments. We view this as important for two reasons. (i) It further controls the silencing experiment for off-target effects and directly implicates the lipid pathway. (ii) It asks the important question as to what happens when DENV can't downregulate phosphatidic acid. Silencing AGPAT1 likely produces a minor 2-fold phenotype on DENV replication because DENV infection is already decreasing its expression level.  This experiment can be done via simple media addition of PA over a range of concentrations or over-expression of AGPAT1 if necessary. qRT-PCR and titering would give some insight into life cycle stage (controlling for cell viability). This should be a relatively simple experiment. An additional in vivo experiment is unnecessary, as it is difficult to adequately control. These issues must be addressed before we would be willing to consider a revised version of your study. We cannot, of course, promise publication at that time. We therefore ask you to modify the manuscript according to the review recommendations before we can consider your manuscript for acceptance. Your revisions should address the specific points made by each reviewer. In addition, when you are ready to resubmit, please be prepared to provide the following: (1) A letter containing a detailed list of your responses to the review comments and a description of the changes you have made in the manuscript. Please note while forming your response, if your article is accepted, you may have the opportunity to make the peer review history publicly available. The record will include editor decision letters (with reviews) and your responses to reviewer comments. If eligible, we will contact you to opt in or out. (2) Two versions of the manuscript: one with either highlights or tracked changes denoting where the text has been changed; the other a clean version (uploaded as the manuscript file). While revising your submission, please upload your figure files to the Preflight Analysis and Conversion Engine (PACE) digital diagnostic tool, https://pacev2.apexcovantage.com. PACE helps ensure that figures meet PLOS requirements. To use PACE, you must first register as a user. Then, login and navigate to the UPLOAD tab, where you will find detailed instructions on how to use the tool. If you encounter any issues or have any questions when using PACE, please email us at figures@plos.org. Additionally, to enhance the reproducibility of your results, PLOS recommends that you deposit your laboratory protocols in protocols.io, where a protocol can be assigned its own identifier (DOI) such that it can be cited independently in the future. For instructions see http://journals.plos.org/plospathogens/s/submission-guidelines#loc-materials-and-methods We hope to receive your revised manuscript within 60 days. If you anticipate any delay in its return, we ask that you let us know the expected resubmission date by replying to this email. Revised manuscripts received beyond 60 days may require evaluation and peer review similar to that applied to newly submitted manuscripts. [LINK] We are sorry that we cannot be more positive about your manuscript at this stage, but if you have any concerns or questions, please do not hesitate to contact us. Sincerely, Glenn Randall Associate Editor PLOS Pathogens Ana Fernandez-Sesma Section Editor PLOS Pathogens Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Grant McFadden Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-2556-3526 *********************** 1 Nov 2019 Submitted filename: PPATHOGENS-D-19-00992R1 answer to reviewers comments.docx Click here for additional data file. 7 Nov 2019 Dear Dr Pompon, We are pleased to inform that your manuscript, "Dengue virus reduces AGPAT1 expression to alter phospholipids and enhance infection in Aedes aegypti", has been editorially accepted for publication at PLOS Pathogens. Before your manuscript can be formally accepted and sent to production, you will need to complete our formatting changes, which you will receive by email within a week. Please note that your manuscript will not be scheduled for publication until you have made the required changes. IMPORTANT NOTES (1) Please note, once your paper is accepted, an uncorrected proof of your manuscript will be published online ahead of the final version, unless you’ve already opted out via the online submission form. If, for any reason, you do not want an earlier version of your manuscript published online or are unsure if you have already indicated as such, please let the journal staff know immediately at plospathogens@plos.org. (2) Copyediting and Proofreading: The corresponding author will receive a typeset proof for review, to ensure errors have not been introduced during production. Please review the PDF proof of your manuscript carefully, as this is the last chance to correct any errors. Please note that major changes, or those which affect the scientific understanding of the work, will likely cause delays to the publication date of your manuscript. (3) Appropriate Figure Files: Please remove all name and figure # text from your figure files. Please also take this time to check that your figures are of high resolution, which will improve the readbility of your figures and help expedite your manuscript's publication. Please note that figures must have been originally created at 300dpi or higher. Do not manually increase the resolution of your files. For instructions on how to properly obtain high quality images, please review our Figure Guidelines, with examples at: http://journals.plos.org/plospathogens/s/figures. While revising your submission, please upload your figure files to the Preflight Analysis and Conversion Engine (PACE) digital diagnostic tool, https://pacev2.apexcovantage.com. PACE helps ensure that figures meet PLOS requirements. To use PACE, you must first register as a user. Then, login and navigate to the UPLOAD tab, where you will find detailed instructions on how to use the tool. If you encounter any issues or have any questions when using PACE, please email us at figures@plos.org. (4) Striking Image: Please upload a striking still image to accompany your article if one is available (you can include a new image or an existing one from within your manuscript). Should your paper be accepted, this image will be considered for our monthly issue image and may also appear on our website to feature your article. Please upload this as a separate file, selecting "striking image" as the file type upon upload. Please also include a separate "Other" file with a caption, including credits and any potential copyright information. Please do not include the caption in the main article file. If your image is from someone other than yourself, please ensure that the artist has read and agreed to the terms and conditions of the Creative Commons Attribution License at http://journals.plos.org/plospathogens/s/content-license. Please note that PLOS cannot publish copyrighted images. (5) Press Release or Related Media: If your institution or institutions have a press office, please notify them about your upcoming paper at this point, to enable them to help maximize its impact. If they will be preparing press materials for this manuscript, please inform our press team in advance at plospathogens@plos.org as soon as possible. We ask that you contact us within one week to plan ahead of our fast Production schedule. If you need to know your paper's publication date for related media purposes, you must coordinate with our press team, and your manuscript will remain under a strict press embargo until the publication date and time. This means an early version of your manuscript will not be published ahead of your final version. (6)  PLOS requires an ORCID iD for all corresponding authors on papers submitted after December 6th, 2016. Please ensure that you have an ORCID iD and that it is validated in Editorial Manager.  To do this, go to ‘Update my Information’ (in the upper left-hand corner of the main menu), and click on the Fetch/Validate link next to the ORCID field.  This will take you to the ORCID site and allow you to create a new iD or authenticate a pre-existing iD in Editorial Manager (7) Update your Profile Information: Now that your manuscript has been provisionally accepted, please log into Editorial Manager and update your profile, if needed. Go to https://www.editorialmanager.com/ppathogens, log in, and click on the "Update My Information" link at the top of the page. Please update your user information to ensure an efficient production and billing process. (8) LaTeX users only: Our staff will ask you to upload a TEX file in addition to the PDF before the paper can be sent to typesetting, so please carefully review our Latex Guidelines http://journals.plos.org/plospathogens/s/latex in the meantime. (9) If you have associated protocols in protocols.io, please ensure that you make them public before publication to guarantee immediate access to the methodological details. Thank you again for supporting Open Access publishing; we are looking forward to publishing your work in PLOS Pathogens. Best regards, Glenn Randall Associate Editor PLOS Pathogens Ana Fernandez-Sesma Section Editor PLOS Pathogens Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Grant McFadden Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-2556-3526 *********************************************************** Reviewer Comments (if any, and for reference): 2 Dec 2019 Dear Dr Pompon, We are delighted to inform you that your manuscript, "Dengue virus reduces AGPAT1 expression to alter phospholipids and enhance infection in Aedes aegypti," has been formally accepted for publication in PLOS Pathogens. We have now passed your article onto the PLOS Production Department who will complete the rest of the pre-publication process. All authors will receive a confirmation email upon publication. The corresponding author will soon be receiving a typeset proof for review, to ensure errors have not been introduced during production. Please review the PDF proof of your manuscript carefully, as this is the last chance to correct any scientific or type-setting errors. Please note that major changes, or those which affect the scientific understanding of the work, will likely cause delays to the publication date of your manuscript. Note: Proofs for Front Matter articles (Pearls, Reviews, Opinions, etc...) are generated on a different schedule and may not be made available as quickly. Soon after your final files are uploaded, the early version of your manuscript, if you opted to have an early version of your article, will be published online. The date of the early version will be your article's publication date. The final article will be published to the same URL, and all versions of the paper will be accessible to readers. Thank you again for supporting open-access publishing; we are looking forward to publishing your work in PLOS Pathogens. Best regards, Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Grant McFadden Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-2556-3526
  67 in total

Review 1.  Enzymes of triacylglycerol synthesis and their regulation.

Authors:  Rosalind A Coleman; Douglas P Lee
Journal:  Prog Lipid Res       Date:  2004-03       Impact factor: 16.195

Review 2.  Sphingolipid and glycosphingolipid metabolic pathways in the era of sphingolipidomics.

Authors:  Alfred H Merrill
Journal:  Chem Rev       Date:  2011-09-26       Impact factor: 60.622

3.  Lipid map of the mammalian cell.

Authors:  Gerrit van Meer; Anton I P M de Kroon
Journal:  J Cell Sci       Date:  2011-01-01       Impact factor: 5.285

4.  Dengue virus-induced autophagy regulates lipid metabolism.

Authors:  Nicholas S Heaton; Glenn Randall
Journal:  Cell Host Microbe       Date:  2010-11-18       Impact factor: 21.023

Review 5.  Acyltransferases and transacylases that determine the fatty acid composition of glycerolipids and the metabolism of bioactive lipid mediators in mammalian cells and model organisms.

Authors:  Atsushi Yamashita; Yasuhiro Hayashi; Yoko Nemoto-Sasaki; Makoto Ito; Saori Oka; Takashi Tanikawa; Keizo Waku; Takayuki Sugiura
Journal:  Prog Lipid Res       Date:  2013-10-11       Impact factor: 16.195

6.  RNA virus replication depends on enrichment of phosphatidylethanolamine at replication sites in subcellular membranes.

Authors:  Kai Xu; Peter D Nagy
Journal:  Proc Natl Acad Sci U S A       Date:  2015-03-25       Impact factor: 11.205

Review 7.  Lipids and flaviviruses, present and future perspectives for the control of dengue, Zika, and West Nile viruses.

Authors:  Miguel A Martín-Acebes; Ángela Vázquez-Calvo; Juan-Carlos Saiz
Journal:  Prog Lipid Res       Date:  2016-10-01       Impact factor: 16.195

Review 8.  Membrane lipids: where they are and how they behave.

Authors:  Gerrit van Meer; Dennis R Voelker; Gerald W Feigenson
Journal:  Nat Rev Mol Cell Biol       Date:  2008-02       Impact factor: 94.444

9.  Clinical efficacy and safety of a novel tetravalent dengue vaccine in healthy children in Asia: a phase 3, randomised, observer-masked, placebo-controlled trial.

Authors:  Maria Rosario Capeding; Ngoc Huu Tran; Sri Rezeki S Hadinegoro; Hussain Imam H J Muhammad Ismail; Tawee Chotpitayasunondh; Mary Noreen Chua; Chan Quang Luong; Kusnandi Rusmil; Dewa Nyoman Wirawan; Revathy Nallusamy; Punnee Pitisuttithum; Usa Thisyakorn; In-Kyu Yoon; Diane van der Vliet; Edith Langevin; Thelma Laot; Yanee Hutagalung; Carina Frago; Mark Boaz; T Anh Wartel; Nadia G Tornieporth; Melanie Saville; Alain Bouckenooghe
Journal:  Lancet       Date:  2014-07-10       Impact factor: 79.321

Review 10.  Biochemistry, physiology, and genetics of GPAT, AGPAT, and lipin enzymes in triglyceride synthesis.

Authors:  Kazuharu Takeuchi; Karen Reue
Journal:  Am J Physiol Endocrinol Metab       Date:  2009-03-31       Impact factor: 4.310

View more
  6 in total

1.  Mosquito metabolomics reveal that dengue virus replication requires phospholipid reconfiguration via the remodeling cycle.

Authors:  Thomas Vial; Wei-Lian Tan; Eric Deharo; Dorothée Missé; Guillaume Marti; Julien Pompon
Journal:  Proc Natl Acad Sci U S A       Date:  2020-10-21       Impact factor: 11.205

Review 2.  Unraveling mosquito metabolism with mass spectrometry-based metabolomics.

Authors:  Thomas D Horvath; Shai Dagan; Patricia Y Scaraffia
Journal:  Trends Parasitol       Date:  2021-04-22

3.  Revisiting dengue virus-mosquito interactions: molecular insights into viral fitness.

Authors:  Tanamas Siriphanitchakorn; R Manjunatha Kini; Eng Eong Ooi; Milly M Choy
Journal:  J Gen Virol       Date:  2021-11       Impact factor: 3.891

Review 4.  Lipid Interactions Between Flaviviruses and Mosquito Vectors.

Authors:  Thomas Vial; Guillaume Marti; Dorothée Missé; Julien Pompon
Journal:  Front Physiol       Date:  2021-11-05       Impact factor: 4.566

Review 5.  Lipid hijacking: a unifying theme in vector-borne diseases.

Authors:  Anya J O'Neal; L Rainer Butler; Agustin Rolandelli; Stacey D Gilk; Joao Hf Pedra
Journal:  Elife       Date:  2020-10-29       Impact factor: 8.140

Review 6.  Lipids in Pathophysiology and Development of the Membrane Lipid Therapy: New Bioactive Lipids.

Authors:  Manuel Torres; Sebastià Parets; Javier Fernández-Díaz; Roberto Beteta-Göbel; Raquel Rodríguez-Lorca; Ramón Román; Victoria Lladó; Catalina A Rosselló; Paula Fernández-García; Pablo V Escribá
Journal:  Membranes (Basel)       Date:  2021-11-24
  6 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.