Literature DB >> 31387908

Transposon Mutagenesis in Chlamydia trachomatis Identifies CT339 as a ComEC Homolog Important for DNA Uptake and Lateral Gene Transfer.

Scott D LaBrie1, Zoë E Dimond1, Kelly S Harrison1, Srishti Baid1, Jason Wickstrum1, Robert J Suchland2, P Scott Hefty3.   

Abstract

Transposon mutagenesis is a widely applied and powerful genetic tool for the discovery of genes associated with selected phenotypes. Chlamydia trachomatis is a clinically significant, obligate intracellular bacterium for which many conventional genetic tools and capabilities have been developed only recently. This report describes the successful development and application of a Himar transposon mutagenesis system for generating single-insertion mutant clones of C. trachomatis This system was used to generate a pool of 105 transposon mutant clones that included insertions in genes encoding flavin adenine dinucleotide (FAD)-dependent monooxygenase (C. trachomatis 148 [ct148]), deubiquitinase (ct868), and competence-associated (ct339) proteins. A subset of Tn mutant clones was evaluated for growth differences under cell culture conditions, revealing that most phenocopied the parental strain; however, some strains displayed subtle and yet significant differences in infectious progeny production and inclusion sizes. Bacterial burden studies in mice also supported the idea that a FAD-dependent monooxygenase (ct148) and a deubiquitinase (ct868) were important for these infections. The ct339 gene encodes a hypothetical protein with limited sequence similarity to the DNA-uptake protein ComEC. A transposon insertion in ct339 rendered the mutant incapable of DNA acquisition during recombination experiments. This observation, along with in situ structural analysis, supports the idea that this protein is playing a role in the fundamental process of lateral gene transfer similar to that of ComEC. In all, the development of the Himar transposon system for Chlamydia provides an effective genetic tool for further discovery of genes that are important for basic biology and pathogenesis aspects.IMPORTANCE Chlamydia trachomatis infections have an immense impact on public health; however, understanding the basic biology and pathogenesis of this organism has been stalled by the limited repertoire of genetic tools. This report describes the successful adaptation of an important tool that has been lacking in Chlamydia studies: transposon mutagenesis. This advance enabled the generation of 105 insertional mutants, demonstrating that numerous gene products are not essential for in vitro growth. Mammalian infections using these mutants revealed that several gene products are important for infections in vivo Moreover, this tool enabled the investigation and discovery of a gene critical for lateral gene transfer; a process fundamental to the evolution of bacteria and likely for Chlamydia as well. The development of transposon mutagenesis for Chlamydia has broad impact for the field and for the discovery of genes associated with selected phenotypes, providing an additional avenue for the discovery of molecular mechanisms used for pathogenesis and for a more thorough understanding of this important pathogen.
Copyright © 2019 LaBrie et al.

Entities:  

Keywords:  Chlamydia trachomatis; genetic competence; mutagenesis; transposons

Mesh:

Substances:

Year:  2019        PMID: 31387908      PMCID: PMC6686042          DOI: 10.1128/mBio.01343-19

Source DB:  PubMed          Journal:  mBio            Impact factor:   7.867


INTRODUCTION

Transposon (Tn) mutagenesis is among the more effective strategies for discovering specific genetic components associated with a given phenotype. This genetic tool has been successfully applied for a better understanding of many basic biological processes as well as for the discovery of gene products associated with host infection and pathogenesis in diverse bacterial species (1, 2). Over a decade of optimization of naturally occurring transposon systems such as Sleeping Beauty and Tc1/mariner has resulted in a repertoire of successful genetic insertion systems. One of the more widely applied transposons is the hyperactive form of the Himar1 mariner system (3). This variant has resulted in robust transposition efficiencies and has revolutionized the study of genotype-phenotype correlation (4). The Himar system has many benefits that have allowed applications in phylogenetically diverse bacteria (5–11), most importantly, the simplified “cut-and-paste” mechanism that requires a single transposase for recognition of inverted repeat sequences on flanking ends of DNA. This allows direct transposition of DNA to DNA, without the requirement of additional cofactors. Additionally, the Himar hyperactive transposase has minimal target DNA specificity, inserting between T/A nucleobases (7, 12) and allowing relatively nonspecific insertion across an entire genome (13–15). These advantages have proven beneficial for the study of pathogenesis in a diverse set of bacteria, including obligate intracellular organisms such as Coxiella and Ehrlichia. Research in Coxiella has demonstrated the use of Himar1 Tn mutagenesis to identify genes critical for cellular growth and division in vitro (9, 10), whereas Tn studies in Ehrlichia revealed genes important for mammalian infection (8). Thus far, a transposon mutagenesis system has not been comprehensively described for the globally prevalent and obligate Chlamydia intracellular pathogens. Chlamydia trachomatis is the most commonly reported cause of sexually transmitted bacterial infection in the United States and worldwide. C. trachomatis infections result in a range of health issues that include pelvic inflammatory disease, sterility, blindness, and pneumonia (16, 17). C. trachomatis contains a single, circular chromosome of ∼1.04 Mb and a plasmid of ∼7,500 bp (18, 19). Lateral gene transfer has likely played a critical factor in shaping chlamydial genomes. Moreover, lateral gene transfer occurs readily between strains, and genetic exchange between C. trachomatis genomes allows the interchange of polymorphic loci, such as the immunodominant major outer membrane porin gene (ompA), often resulting in enhanced tissue tropism and fitness against host defenses (20–26). Despite this key role, the components that participate in and the process involved in lateral gene transfer and DNA uptake are virtually unknown in Chlamydia. Similarly, many aspects of basic C. trachomatis biology and pathogenesis are poorly understood. This has been largely due to the limitations of the genetic tools that have been available for Chlamydia. There has been a recent surge of introductions of molecular tools and methods developed for genetic manipulation in Chlamydia that has been enabled by the discovery of a transformation method and effective selectable antibiotic markers (27–32). TargetTron (29) and allele-specific recombination (33, 34) are two reverse genetic tools that have been developed for targeted gene disruption and have enormous potential for functional and phenotypic studies for candidate genes. However, only chemical mutagenesis has been developed for random and unbiased strategies (35–37). This method has been effectively employed to introduce multiple-base mutations, including nonsense mutations, allowing an association of gene products with noteworthy alterations to physiological pathways (36). While chemical mutagenesis is effective, it has certain limitations, including those represented by the acquisition of multiple mutations and the challenge of correlating a phenotype to a specific genetic disruption. Furthermore, identifying the mutations requires whole-genome sequencing (WGS) and revertant or compensatory mutations may be acquired during continued passaging. Thus, the development of a random single-insertion system, such as a Himar1 transposon containing a selectable marker, allows straightforward generation of stable, single-site mutations and simplified identification of insertion sites. Here, the development and application of a single-plasmid Himar1 Tn system for C. trachomatis are described. An initial subset of Tn insertion mutant strains was evaluated for potentially contrasting in vitro (tissue culture) and in vivo (mouse genital tract infection model) growth features. One of the transposon insertions occurred in a gene (ct339) that exhibits sequence similarity to that encoding an inner membrane DNA uptake protein termed ComEC. This mutant was investigated for the ability to perform lateral gene transfer and transformation-based DNA uptake.

RESULTS

Generation and genomic characterization of Tn insertion mutant clones using pCMA.

A plasmid termed pCMA (plasmid Mariner) (see Fig. S1 in the supplemental material) was designed to encode the widely utilized C9 Himar1 transposase (3). To reduce acquisition of deleterious mutations associated with plasmid propagation in Eschericha coli, the chlamydial ct559 promoter and ribosomal binding site were cloned upstream of the C9 transposase. The ct559 promoter has been characterized previously (38) and exhibited transcriptional activity in Chlamydia but limited activity in E. coli. The bla gene was cloned with flanking inverted repeats for recognition and transposition by the Himar1 transposase. Finally, the plasmid contains only the colE1 origin of replication for plasmid propagation in E. coli, which is nonfunctional in Chlamydia, resulting in a nonreplicative (suicide) vector upon transformation into Chlamydia. Plasmid map of pCMA. The C9 hyperactive variant of the Himar1 transposon was cloned downstream of the Chlamydia ct559 promoter. β-Lactamase (bla) and the corresponding promoter were cloned from chlamydial shuttle vector pGFP::SW2 (29). This antibiotic marker is flanked by Himar1 inverted repeats to generate the transposon. Download FIG S1, PDF file, 0.1 MB. The pCMA plasmid was used in a C. trachomatis transformation procedure with β-lactams for selection (39). This procedure typically requires three passages (i.e., infection-growth-lysis-reinfection) under conditions of antibiotic selection to ensure that the resulting organisms encoding β-lactamase (bla) are indeed able to form infectious progeny in the presence of β-lactams. In order to decrease the potential for normally growing mutants to outcompete fitness-compromised mutant clones in a mixed infection, as well as to evaluate transformation and transposon efficiency, transformation reactions (DNA and elementary bodies [EBs]) were mixed and incubated before being split into individual wells of a 12-well plate. Each well was passaged twice with selection, and after the second passage, cultures were allowed to continue growing, with daily monitoring of C. trachomatis growth. Within 2 days of cultivation, C. trachomatis growth was observed in approximately 4 of the 12 wells, although certain samples took longer than 2 days. A total of 23 transformations were performed with 105 resistant growth cultures and a range of 0 to 9 wells with resistant growth for each transformation. These observations suggest that the transformation efficiency in C. trachomatis is very low and/or that the genome may be less tolerant of transposon insertions. This efficiency was mirrored in five independent transformations performed with pGFP::SW2 which resulted in an average of 4.8 wells (range, 4 to 8) with resistant growth (data not shown), supporting the idea that transformation efficiency likely represents the limitation rather than transposon expression or function. To identify the site(s) of transposon insertion and other potential mutations, whole-genome sequencing was applied to the 105 mutant strains as well as to the parental L2 strain (LGV 434/Bu Hefty; CP019386.1). All mutant strains contained a single transposon insertion in an expected insertion site (T/A). The absence of mixed Tn insertion strains supports the idea that clonal isolates were obtained following the distribution of transformation sample into individual 12 wells and multiple passaging with selection. In total, 81 unique Tn insertion mutants were generated within coding regions (Fig. 1) (Table 1), with seven genes (ct054, ct153, ct170, ct333, ct392, ct414, and ct550) incurring transposon insertions in multiple sites of the coding region. While all of the studies were performed using C. trachomatis LGV 434/Bu, C. trachomatis serovar D gene nomenclature is utilized due to recognition and field familiarity. The gene ct333 (uvrA) had 5 Tn insertions throughout the relatively large coding region (5,361 bp). Predominantly, Tn insertions resulted in the truncation of a protein-coding region with the addition of a short protein extension provided by the Tn insertion, depending on the insertion site and reading frame. Most of these insertions were found to have occurred within the first 60% of the coding region, providing higher confidence that the Tn insertion is disruptive to the normal protein function. Four of the insertions (ct015::Tn, ct054::Tn, ct088::Tn, and ct107::Tn; Table 1) extended the normal protein sequence, which may have little effect on protein function. Sixteen of the Tn insertions occurred in hypothetical proteins, while the rest occurred in a variety of genes with contributions to diverse biological functions. For example, five Tn insertions (ct298, ct333, ct470, ct586, and ct575) were involved in DNA repair mechanisms, four (ct054, ct248, ct489, and ct592) were were involved in central metabolism, and four (ct404, ct540, ct829, and ct830) encoded methyl modification enzymes. Two polymorphic membrane protein-coding regions (ct871 [pmpG] and ct414 [pmpC]) incurred insertions, as did both deubiquitinases (ct867 [cdu2] and ct868 [cdu1]). Of note, 16 of the Tn insertions occurred in genes that also incurred nonsense mutations following chemical mutagenesis (36), for a total of 54 new gene disruptions generated.
FIG 1

Map of transposon insertions in C. trachomatis chromosome and plasmid. (A) Sites of transposon insertions within coding regions (red) and noncoding regions (blue) throughout the C. trachomatis L2 434/Bu chromosome. (B) Sites of transposon insertions within the coding regions (red) and noncoding regions (blue) throughout the C. trachomatis L2 434/Bu plasmid. ori, origin of replication.

TABLE 1

C. trachomatis coding region transposon insertion mutants

ctl gene (ctc )::Tn blaGene namePredicted functionGenomic position of TN insertiona Gene insert site/total gene length (bp)Modified protein sequenced Sequence modification [truncated/normal length] (bp)d
ctl0027 (ct658 )sfhBPseudouridine synthase33827544/1,008QVKKLX[Y182X; 182/335]
ctl0063 (ct694 )Hypothetical7620017/969SIRPTNRLDDKSPVX[G8R; 16/322]
ctl0065 (ct696 )e Hypothetical795221,039/1,179MRVLLX[M347X; 346/392]
ctl0101 (ct732 )e ribH (ribE )6,7-Dimethyl-8-ribityllumazine synthase12447044/474KDVRVTGWMISPRSDAQWNENSRX[A16T; 34/157)
ctl0105 (ct736 )Hypothetical phosphatidyl ethanolamine-binding proteins129068191/453WIHWITGWMISPRSDAQWNENSRX[V65T; 83/150]
ctl0125murFUDP-N-acetylmuramoyl-tripeptide- d -alanyl- d -alanine ligase1694741,328/1,353ELETLTGWMISPRSDAQWNENSRX[L404T; 462/450]
ctl0175 (ct806 )h ptrPeriplasmic Zn-dependent peptidase2239991,236/2,871INSLEYNRLDDKSPVX[S422X; 422/957]
ctl0184 (ct813 )h Inclusion membrane protein235508355/795QFRIVTGWMISPRSLVAQR-35AA-YFXf [M120T; 171/264]
ctl0185 (ct814 )e Hypothetical membrane-associated protein23625674/300FGGFLTGWMISPRSDAQWNENSRX[A26T; 44/99]
ctl0191 (ct819 )yccA -BAX inhibitor242990121/717TSLGLX[Y41X; 41/238]
ctl0201 (ctr829 )trmBtRNA [guanine-N(7)-]-methyltransferase25870268/675IANHVTGWMISPRSDAQWNENSRX[F24T; 42/224]
ctl0202 (ct830 )Putative SAM-dependent methyltransferase25944017/585MLTGITGWMISPRSDAQWNENSRX[D7T; 16/194]
ctl0238bHypothetical298245184/306PYQYDX[Y62X; 62/101]
ctl0246 (ct867 )cdu2Deubiquitinase and deneddylase302887877/1,020QFLAWX[Y293X; 293/339]
ctl0247 (ct868 )cdu1Deubiquitinase304303889/1,206DSLYNX[N297X; 297/401]
ctl0250 (ct871 )pmpGPolymorphic outer membrane protein312316786/3,039HPTCYFNRRSSSKFFQKYCGRVX[G738F; 755/1,012]
ctl0270 (ct015 )Phosphate-responsive ATPase, PhoH-like protein3383861,277/1,305ERSELTGWMISPRSDAQWNENSRX[A427T; 445/434]
ctl0291 (ct036 )h Hypothetical, putative Inc363864620/1,158LQQHLTGWMISPRSDAQWNENSRX[D208T; 226/385]
ctl0298 (ct042 )h Putative glycosyl hydrolase369458681/2,001PSRRYNRLDDKSPVX[T228N; 237/666]
ctl0310 (ct054 )h sucA2-Oxoglutarate dehydrogenase E1 component3853562,122/2,712ARIERX[Y708X; 708/903]
ctl0310 (ct054 )h sucA2-Oxoglutarate dehydrogenase E1 component3859322,699/2,712TLFSITGWMISPRSDAQWNENSRX[G901T; 919/903]
ctl0314 (ct058 )Putative membrane-spanning protein390466401/1,092GWNCITGWMISPRSDAQWNENSRX[E135T; 153/363]
ctl0339 (ct084 )Phopholipase D superfamily419045827/1,086TPYQLTGWMISPRSDAQWNENSRX[H277T; 295/361]
ctl0343 (ct088 )ssc1Type III secretion chaperone423934413/441ELPDLTGWMISPRSDAQWNENSRX[H139T; 157/146]
ctl0361 (ct106 )h tRNA pseudouridine synthase A445244626/825HQIRLTGWMISPRSDAQWNENSRX[H210T; 228/274]
ctl0362 (ct107 )A/G-specific adenine glycosylase4470041,089/1,107LEKDGNRLDDKSPVX[K364N; 373/368]
ctl0367 (ct112 )pepFOligoendopeptidase F4509741,767/1,825TSSAPNRLDDKSPVX[M590N; 599/608]
ctl0394 (ct139 )h oppAOligopeptide transport system binding protein479190336/1,281AWEHTNRLDDKSPVX[K113N; 122/427]
ctl0398 (ct143 )Hypothetical482984708/843TSLYSNRLDDKSPVX[I237N; 246/280]
ctl0401 (ct146 )ligANAD-dependent DNA ligase4871891,164/1,992GINLANRLDDKSPVX[K389N; 398/663]
ctl0403 (ct148 )mphAFAD-dependent monooxygenase493563487/1,524TPKWIX[I163X; 163/507]
ctl0408 (ct153 )macPMembrane attack complex499954611/2,433PPGTKLTGWMISPRSDAQWNENSRX[T223X; 223/811]
ctl0408 (ct153 )macPMembrane attack complex50048284/2,433SIDSDNRLDDKSPVX[R29N; 38/811]
ctl0413 (ct157 )Phosphatidylcholine-hydrolyzing phospholipase D504003956/1,206KESAHNRLDDKSPVX[T320N; 329/401]
ctl0417a (ct159 )Hypothetical506473118/282MQGAYX[Y39X; 39/93]
ctl0423 (ct170 )trpBTryptophan synthase, beta subunit512551512/1,179VNQALTGWMISPRSLVAQR-35AA-YFXf [Q172T; 223/392]
ctl0423 (ct170 )trpBTryptophan synthase, beta subunit512763723/1,179FFHHFNRLDDKSPVX[I242N; 251/392]
ctl0496 (ct244 )h Hypothetical591198596/1,197VPVLITGWMISPRSDAQWNENSRX[A200T; 218/398]
ctl0500 (ct248 )glgPAlpha-1,4 glucan phosphorylase596937845/2,445EGQELTGWMISPRSDAQWNENSRX[R283T; 301/814]
ctl0550 (ct298 )h radADNA repair protein650265429/1,365ISSNITGWMISPRSDAQWNENSRX[I144T; 162/454]
ctl0578 (ct326 )Hypothetical685322670/1,545FFVTVTGWMISPRSDAQWNENSRX[S168T; 186/515]
ctl0587 (ct333 )h uvrAUvrABC system protein A6961231,850/5,361VSIPLTGWMISPRSDAQWNENSRX[G618T; 636/1,786]
ctl0587 (ct333 )h uvrAUvrABC system protein A6970442,771/5,361ELPYLTGWMISPRSDAQWNENSRX[P925T; 943/1,786]
ctl0587 (ct333 )h uvrAUvrABC system protein A6978743,601/5,361LNHESX[Y1201X; 1,201/1,786]
ctl0587 (ct333 )h uvrAUvrABC system protein A6980913,818/5,361ESLCLTGWMISPRSDAQWNENSRX[G1274T; 1,292/1,786]
ctl0587 (ct333 )h uvrAUvrABC system protein A6994395,165/5,361LDEIANRLDDKSPVX[T1723N; 1,732/1,786]
ctl0593 (ct339 )h comECCompetence DNA uptake7059371,466/1,530ILVYITGWMISPRSDAQWNENSRX[G490T; 508/509]
ctl0604 (ct350 )Putative lipoprotein718288179/1701IQPVTRNSRIVFTTKLSLX[R61T; 79/566]
ctl0611A (ct357 )h Hypothetical728274212/333DFSVLTGWMISPRSDAQWNENSRX[R61T; 90/110]
ctl0625 (ct371 )Putative outer membrane protein742559454/786KANLPLTGWMISPRSDAQWNENSRX[Y152L; 171/261]
ctl0626 (ct372 )h aaxAPorin743881837/1,329KWSNLNRLDDKSPVX[T280N; 289/442]
ctl0639 (ct383 )Putative inner membrane protein755828572/732ERYTLTGWMISPRSDAQWNENSRX[L192T; 210/243]
ctl0641 (ct385 )Histidine triad motif hydrolase757770198/336EAGKINRLDDKSP-35AA-SCXg [I67N; 112/111]
ctl0648 (ct392 )h Hypothetical765648762/1,131DGPLSINRLDDKSPVX[S300X; 300/377]
ctl0648 (ct392 )h Hypothetical76640011/1,131MSSITGWMISPRSDAQWNENSRX[Q5T; 23/376]
ctl0661 (ct404 )N6-adenine-specific DNA methylase781874690/828HTPGHNRLDDKSPVX[T231N; 240/275]
ctl0671 (ct414 )h pmpCPolymorphic outer membrane protein7999091,559/5,325TNSDITGWMISPRSDAQWNENSRX[D521T; 539/1,774]
ctl0671 (ct414 )h pmpCPolymorphic outer membrane protein8025924,241/5,326APQKGYNRLDDKSPVFGSSENLRKTALQGGFF[Q1460X; 1,460/1,775]
ctl0671 (ct414 )h pmpCPolymorphic outer membrane protein8025934,242/5,326PQKGYNRLDDKSPVX[S1455N; 1,424/1,774]
ctl0678 (ct421 )Hypothetical804491686/702TSPFITGWMISPRSDAQWNENSRX[L444T; 462/450]
ctl0707 (ct447 )recJSingle-stranded DNA-specific exonuclease8363801,311/1,755DFAAGLNRLDDKSPVX[M438L; 447/584]
ctl0708a (ct448 )Bifunctional preprotein translocase subunit secDF8380064,005/4,203LQKTLTGWMISPRSDAQWNENSRX[G1337T; 1,355/1,400]
ctl0730 (ct470 )recODNA repair protein863604492/732ESSTIX[Y165X; 165/244]
ctl0750 (ct489 )glgCGlucose-1-phosphate adenyltransferase884304469/1,326RSIVDX[Y157X; 157/441]
ctl0802 (ct540 )Putative tRNA [cytidine(34)-2-O]-methyltransferase925001418/456VGIVMX[Y140X; 140/151]
ctl0812 (ct550 )Hypothetical93848342/426FRRSINRLDDKSPVX[T15N; 24/141]
ctl0818 (ct555 )e ATP-dependent helicase9464083,260/3,600FIGSLTGWMISPRSDAQWNENSRX[L1088T; 1,106/1,199]
ctl0837 (ct574 )e pepPAminopeptidase P family protein96516387/1,071KDEDINRLDDKSPVX[S30N; 39/356]
ctl0838 (ct575 )e ,h mutLDNA mismatch repair endonuclease966365626/1,731KQGFITGWMISPRSDAQWNENSRX[E210T; 228/576]
ctl0849 (ct586 )uvrBExcinuclease ABC subunit B979090848/2,007EGRPVTGWMISPRSDAQWNENSRX[E284T; 302/668]
ctl0853 (ct590 )h Hypothetical9864132,164/2,865DKSAIX[I722X; 722/955]
ctl0853 (ct590 )h Hypothetical988197380/2865RVQDLTGWMISPRSDAQWNENSRX[I128T; 145/954
ctl0855 (ct592 )sdhASuccinate dehydrogenase flavoprotein990457875/1,881PWYFLTGWMISPRSDAQWNENSRX[E293T; 311/626]
ctl0856 (ct593 )e sdhCSuccinate dehydrogenase992076114/862HLLTNNRLDDKSPVX[I39N; 48/287]
ctl0858 (ct594 )tatDHydrolase992950178/792DWMFYNRLDDKSPVX[H61N; 69/261]
ctl0867 (ct604 )groEL2Molecular chaperone GroEL1002459431/1,602LEHTVX[Y144V; 144/533
ctl_r03 /0423S rRNA136240 OR 158284404/2,868
ctl0425 (ct172 )Pseudogene514407
CDS7 (pgp5 )pgp5Plasmid hypothetical protein229b 165/795SGLGANRLDDKSPVX[S52N; 61/264]
CDS6 (pgp4 )pgp4Plasmid hypothetical protein460b 270/309ALIMLNRLDDKSPVX[I91N; 100/102]
CDS5 (pgp3 )pgp3Plasmid virulence protein1262b 331/795ALIMLNRLDDKSPVX[I91N; 100/102]
CDS3 (pgp1 )pgp1Plasmid helicase2715b 1,354/1,356IKKVWX[X451X; 451/451]
CDS4 (pgp2 )pgp2Plasmid hypothetical protein2715b 5/1,065MVTGWMISPRSDAQWNENSRX[N6M; 21/354]

Position generated using C. trachomatis LGV 434/Bu (NC_010287).

Position generated using C. trachomatis LGV 434/Bu plasmid (NC_021051.1).

C. trachomatis serovar D (NC_000117) gene nomenclature.

Himar insertion delineated by underscore; first amino acid shift delineated by bold highlighting and shown in square brackets; stop codon delineated by X. Data were calculated as follows: (protein length after insertion)/(wild-type protein length).

Slow-growing mutants (mutants that required six or more passages to achieve visibly infectious stocks).

Complete C-terminal sequence, QFRIVTGWMISPRSLVAQRTFEKPPCKAVFSFSEQEITRRPKRSQEDHLVNQIKYFX.

Complete C-terminal sequence, EAGKINRLDDKSPVFGSSENLRKTALQGGFFVFRARDYAQTKTISRRSSCX.

Denotes coding regions that were shared as nonsense mutants as reported previously by Kokes et al. (36).

Map of transposon insertions in C. trachomatis chromosome and plasmid. (A) Sites of transposon insertions within coding regions (red) and noncoding regions (blue) throughout the C. trachomatis L2 434/Bu chromosome. (B) Sites of transposon insertions within the coding regions (red) and noncoding regions (blue) throughout the C. trachomatis L2 434/Bu plasmid. ori, origin of replication. C. trachomatis coding region transposon insertion mutants Position generated using C. trachomatis LGV 434/Bu (NC_010287). Position generated using C. trachomatis LGV 434/Bu plasmid (NC_021051.1). C. trachomatis serovar D (NC_000117) gene nomenclature. Himar insertion delineated by underscore; first amino acid shift delineated by bold highlighting and shown in square brackets; stop codon delineated by X. Data were calculated as follows: (protein length after insertion)/(wild-type protein length). Slow-growing mutants (mutants that required six or more passages to achieve visibly infectious stocks). Complete C-terminal sequence, QFRIVTGWMISPRSLVAQRTFEKPPCKAVFSFSEQEITRRPKRSQEDHLVNQIKYFX. Complete C-terminal sequence, EAGKINRLDDKSPVFGSSENLRKTALQGGFFVFRARDYAQTKTISRRSSCX. Denotes coding regions that were shared as nonsense mutants as reported previously by Kokes et al. (36). Twenty-three mutant strains had Tn insertions within an intergenic region (Table 2). Many of these insertions occurred between genes with divergent coding directions as well as between those with shared coding directions, both of which could result in disruptions to gene expression. Insertions upstream of eight (ct690, ct792, ct793, ct182, ct328, ct343, ct387, and ct472) of the diverging genes occurred within 80 nucleotides (nt) of start codons. On the basis of the determinations of transcriptional start sites located on average 50 nt upstream of start codons (40) and promoters covering at least an additional 50 nt, these Tn insertions likely disrupt transcription initiation and gene expression. For insertions between genes with shared coding directions, three (ct343, ct373, and ct423) have transcriptional start sites reported upstream of or near (within 40 nt) the insertion potentially disrupting gene expression. Three Tn insertions also occurred between genes with convergent coding directions. While the possibility of disruption of gene expression (effecting termination or noncoding RNAs [ncRNAs]) cannot be ruled out, it is less likely that these flanking genes are affected by these Tn insertions.
TABLE 2

C. trachomatis intergenic region transposon insertion mutants

Flanking CTL genes (CTc )::Tn blaFlanking gene orientationGenomic position of TN insertiona Gene insert site/total gene length (bp)Potential gene function disruption
ctl0024 /0025 (ct655 /656 )Converging32332
ctl0059 /0060 (ct690 /691 )Diverging7250550/110 nt upstream of dppD /phoUdppD (oligopeptide ABC transporter ATP-binding protein) and phoU (phosphate transport)
ctl0070 /0071 (ct701 /702 )Converging87381
ctl0111 /0112 (ct742 /743 )Shared direction14263298 nt upstream of trmA (CTL0111)trmA ; 23S rRNA (uracil-5-)-methyltransferase
ctl0160 /0162 (ct792 /793 )Diverging20801357/12 nt upstream of mutS /hypotheticalmutS ; DNA mismatch repair protein
ctl0322 /0323 (ct076 /077 )Diverging401583176/484 upstream of hypothetical/troA
ctl0339 /0340 (ct084 /085 )Shared direction41988413 nt upstream of CTL0339CTL0339 ; Phopholipase D
ctl0408 /0411 (ct154 )Shared direction501211646 nt upstream of CTL0408
ctl0417 /0418 (ct161 /162 )Shared direction50810856 nt upstream of hypothetical (CTL0417)
ctl0433 /0434 (ct181 /182 )Diverging522045287/80 nt upstream of hypothetical/kdsBkdsB ; CMP-2-keto-3-deoxyoctulosonic acid synthetase
ctl0482 /0483 (ct230 /231 )Shared direction576139134 nt upstream of yocR (CTL0483)d yocR ; Sodium-dependent transporter
ctl0581 /0582 (ct327 /328 )Diverging687877161/34 nt of trpC /tpiAtrpC (phosphoribosylanthranilate isomerase) and tpiA (triosephosphate isomerase)
ctl0596 /0597 (ct342 /343 )eShared direction709636110 nt upstream of rpsUd rpsU ; S21 ribosomal protein
ctl0597 /0598 (ct343 /344 )Diverging71036913/297 nt upstream of tsaB /lontsaB ; tRNA threonylcarbamoyladenosine modification protein
ctl0614 /0615 (ct360 /361 )Shared direction73055067 nt upstream of hypothetical
ctl0633 /0634 (ct378 /379 )Shared direction75082353 nt upstream pgid
ctl0639 /0640 (ct383 /384 )Converging755990
ctl0642 /0643 (ct386 /387 )Diverging759051218/69 nt upstream of hypothetical proteins
ctl0647 /0648 (ct391 /392 )Converging765276
ctl0682 /0683 (ct423 /424 )Shared direction81193425 nt upstream of rsbV (CTL0683)rsbV ; anti-sigma factor antagonist
ctl0731 /0733 (ct471 /472 )Diverging864902460/18 upstream of hypothetical proteins
CDS1 /2 (pgp7 /8 )Converging5189b
CDS1 /2 (pgp7 /8 )Converging5232b

Position generated using C. trachomatis LGV 434/Bu (NC_010287).

Position generated using C. trachomatis LGV 434/Bu plasmid (NC_021051.1).

C. trachomatis serovar D (NC_000117) gene nomenclature.

Transcription start site reported (40) upstream of coding region.

Slow-growing mutants (mutants that required six or more passages to achieve visibly infectious stocks).

C. trachomatis intergenic region transposon insertion mutants Position generated using C. trachomatis LGV 434/Bu (NC_010287). Position generated using C. trachomatis LGV 434/Bu plasmid (NC_021051.1). C. trachomatis serovar D (NC_000117) gene nomenclature. Transcription start site reported (40) upstream of coding region. Slow-growing mutants (mutants that required six or more passages to achieve visibly infectious stocks). Tn insertions also occurred within the chlamydial plasmid. Four (pgp1, pgp2, pgp4, and pgp5) of the coding regions incurred an insertion, although the Tn insertion in pgp1 was at the second to last codon and may have little effect on the protein generated. Two Tn insertions were also found in the intergenic region of the convergent pgp7 and pgp8 genes. Two prior studies have investigated the requirement of individual genes for plasmid maintenance (41, 42). Both studies supported the idea that products of the pgp1, pgp4, and pgp5 genes are not required; however, the presence of almost all of the pgp2 coding region was found to be required for plasmid maintenance. As such, it was unexpected for a Tn insertion in pgp2 which results in a severely truncated coding region to be identified. This may indicate that there is a product (e.g., ncRNA) within the coding region, instead of the expected Pgp2 protein product, that is key for plasmid replication. In support of this, the pgp2::Tn mutant strain was grown without antibiotics for two passages and the plasmid was found to still be present by PCR analysis (data not shown).

In vitro growth characteristics of transposon mutants.

While most of the transposon mutant clones did not exhibit noticeably slow growth or poor production of infectious progeny during initial selection and tissue culture propagation, more-subtle growth rates or morphologic differences may be associated with certain mutants. To discover potential defects in infection, growth, or developmental cycle processes associated with transposon mutant clones, temporal analyses of infectious progeny production and bacterial morphologies and quantitative assessment of inclusion sizes were performed for a subset of 16 Tn mutants (Fig. 2; see also Fig. 3 and Fig. S2 and S3). In addition to the parental strain, a clone with a Tn insertion between converging genes (ct383/4::Tn) was also evaluated.
FIG 2

Progeny production of Tn mutants from 18 to 42 hpi. L929 cells were infected with the WT (parental) strain or a Tn insertion mutant clone (gene with Tn insertion is indicated) in triplicate. Quantities of inclusion-forming units (IFU) were determined from lysates at 18, 24, 30, 36, and 42 hpi. Mutants showed progeny production patterns similar to those of the WT parental L2 clone (A), those with significantly decreased progeny production at multiple time points (B), or those with significantly enhanced progeny production at one or more time points (C). Data are shown as means and SD of results from triplicate wells. Statistical significance was calculated using Student’s two-tailed unpaired t test with a P value of <0.05. Progeny production was significantly reduced at 24, 30, and 42 hpi (indicated with a superscript “a”) or at 24, 30, 36, and 42 hpi (indicated with a superscript “b”). Progeny production was significantly increased at 30 and 42 hpi (indicated with a superscript “c”) or 24 and 30 hpi (indicated with a superscript “d”) or 24, 30, and 42 hpi (indicated with a superscript “e”).

FIG 3

Inclusion sizes of Tn mutant strains. Inclusion size was measured at 24, 36, and 42 h postinfection for each Tn mutant and parental strain (WT). Mutant strains are displayed as stacked bars showing inclusions larger than the WT inclusions (checked), equal to the WT inclusions in size (solid), or smaller than the WT inclusions (striped). Triplicate samples were evaluated, with 250 to 1,000 inclusion areas measured per sample. **, P < 0.005; *, P < 0.05 (unpaired Student's t test).

Progeny production of Tn mutants from 18 to 42 hpi. L929 cells were infected with the WT (parental) strain or a Tn insertion mutant clone (gene with Tn insertion is indicated) in triplicate. Quantities of inclusion-forming units (IFU) were determined from lysates at 18, 24, 30, 36, and 42 hpi. Mutants showed progeny production patterns similar to those of the WT parental L2 clone (A), those with significantly decreased progeny production at multiple time points (B), or those with significantly enhanced progeny production at one or more time points (C). Data are shown as means and SD of results from triplicate wells. Statistical significance was calculated using Student’s two-tailed unpaired t test with a P value of <0.05. Progeny production was significantly reduced at 24, 30, and 42 hpi (indicated with a superscript “a”) or at 24, 30, 36, and 42 hpi (indicated with a superscript “b”). Progeny production was significantly increased at 30 and 42 hpi (indicated with a superscript “c”) or 24 and 30 hpi (indicated with a superscript “d”) or 24, 30, and 42 hpi (indicated with a superscript “e”). Inclusion sizes of Tn mutant strains. Inclusion size was measured at 24, 36, and 42 h postinfection for each Tn mutant and parental strain (WT). Mutant strains are displayed as stacked bars showing inclusions larger than the WT inclusions (checked), equal to the WT inclusions in size (solid), or smaller than the WT inclusions (striped). Triplicate samples were evaluated, with 250 to 1,000 inclusion areas measured per sample. **, P < 0.005; *, P < 0.05 (unpaired Student's t test). Confocal microscopy of Tn mutants at 24, 36, and 42 hpi. L929 cells were infected with WT and mutant C. trachomatis at 24, 36, or 42 hpi. Samples were stained with DAPI (blue), and a C. trachomatis culture confirmation test was performed for major outer membrane protein (MOMP) (green) and host cytosol (red). Images were captured at ×150 magnification, with a single z plane displayed. Bar, 10 μm (consistent within time points). Download FIG S2, PDF file, 1.7 MB. Postinfection titers of inocula for infectious progeny assay. The titers of the inocula used for the progeny production assay were measured to reflect the specific dose used to infect the 24-well plates. L929 cells were infected with inocula in a 96-well plate and incubated at 37°C and 5% CO2. At 24 h postinfection, cells were washed, fixed with methanol, washed, and stained with DAPI (nucleic acid) and a Chlamydia trachomatis culture confirmation test was performed to view inclusions (anti-MOMP) and to stain the host cytosol. Titers of samples were determined to measure the levels of inclusion-forming units (IFU) per milliliter. Download FIG S4, PDF file, 0.2 MB. Analyses of the production levels of infectious progeny (EB) of parental (wild-type [WT]) and individual Tn mutant clones were performed on lysates in 6-h increments between 18 and 42 h postinfection (hpi) (Fig. 2). Progeny production levels reflect bacterial replication as well as ability to convert into the infectious EB form. Defects in either of these can be detected with this approach, enabling a more focused analysis of candidate mutant strains. Three distinct growth phenotypes were observed among Tn mutants; normal, decreased, and increased progeny production relative to the parent strain. Almost half (7 of 16) of the Tn mutants displayed EB production levels and timing similar to those seen with the WT, as did the clone with a Tn insertion between two converging genes (ct383/4::Tn) (Fig. 2A). However, four mutants (ct036::Tn, ct350::Tn, ct590::Tn, and ct732::Tn) displayed significant deficiencies in progeny production at two or more time points (Fig. 2B). At 24 hpi, strain ct590::Tn (hypothetical) displayed progeny production levels that were almost 2 log-fold lower whereas ct036::Tn and ct732::Tn (ribH) mutants displayed progeny production levels that were about 1 log-fold lower. An interesting observation was the enhanced progeny production of four mutant clones (ct153::Tn, ct148::Tn, ct339::Tn, and ct550::Tn), which was most notable at 24 hpi. Clones ct153::Tn and ct148::Tn maintained this enhanced level at 30 hpi, with all of the mutant clones matching the parental clone at 36 and 42 hpi (Fig. 2C). Of the Tn mutants evaluated, ct696::Tn displayed the most contrasting and slowest growth phenotype, with propagation requiring up to 5 days before passage was successful and with undiluted cell lysate and levels of inclusion-forming units (IFU) below 10/ml (data not shown). Overall, progeny production analysis revealed that defects were observed for many of the Tn insertion clones, albeit most of the data were within a log-fold difference range. Confocal microscopy of ct696::Tn mutant. L929 mouse fibroblasts were infected with either C. trachomatis parental or ct696::Tn mutant cells. Infections were fixed at 24 hpi and subjected to immunofluorescence staining. Images were acquired at ×150 magnification with deconvolution for enhanced image resolution. (A) WT C. trachomatis inclusion showing normal RB division (white arrow). (B) ct696::Tn showing normal RB division (white arrow). (C) Dispersed localizations of ct696::Tn within the cytosol. (D) Aggregating form of ct696::Tn. Coccoid RBs (blue arrow) that are external to the aggregation (yellow arrow) are shown. Blue, DAPI (nucleus); red, Evans blue (cytoplasm); green, OmpA (C. trachomatis organisms). Bar, 1 μm. Download FIG S3, PDF file, 0.3 MB. Defects in the temporal expansion of an inclusion could suggest that a gene product plays a role in many aspects of chlamydial growth, and so, the area of inclusions was calculated at 24, 36, and 42 hpi. The data shown in Fig. 3 highlight that the inclusions for 5 Tn mutants (ct015::Tn, ct383/4::Tn, ct392::Tn, ct404::Tn, and ct868::Tn) were significantly smaller than that for the parental strain at 24 hpi. Only mutant ct015::Tn maintained smaller inclusion sizes at 36 and 42 hpi, with ct392::Tn, ct404::Tn, and ct590::Tn displaying smaller inclusions at 42 hpi. Two Tn mutants (ct339::Tn and ct550::Tn) had inclusions larger than the parental inclusions at 24 hpi, with the ct550::Tn inclusions maintaining a larger size than the parental inclusions at 36 hpi. Interestingly, ct550::Tn was the only mutant to display a correlation between progeny production and inclusion size (Fig. 2C; see also Fig. 3), both of which showed increases relative to the parental data. To discover if any abnormal morphologic phenotypes (bacterial or inclusion) are associated with this subset of transposon mutant clones, confocal microscopy was applied to immunostained parental and transposon mutants at 24, 36, and 42 hpi (Fig. S2). Almost all of the Tn mutants displayed inclusions that were localized near the nucleus as well as general shapes of the inclusion and reticulate bodies (RBs) that were similar to those seen with the parental strain. Notable exceptions included mutant ct048::Tn, which contained larger but fewer RBs within the inclusion at 42 hpi. Similarly to the growth assessments, the ct696::Tn inclusions and bacterial morphologies were among those that were the most highly contrasting. The inclusions were ill defined, and the few reticulate bodies present were dispersed in the cytoplasm (Fig. S3). In all, cell culture growth and phenotype assessments revealed that many Tn mutant strains displayed defects that represented significant differences from the parental strain. However, these defects were relatively subtle, with peak EB titers fluctuating by approximately with 1 log fold, and inclusion sizes were often within 10% to 15% of sizes seen with the parental strain, although the inclusions seen with the ct015::Tn mutant were over 30% smaller than the parental inclusions. The extreme exception to these trends was mutant ct696::Tn, with gross defects in EB production and in bacterial and inclusion morphologies. Moreover, there was little correlation between EB production titers and inclusion sizes, with the exception of the hypothetical ct550 encoding gene, which displayed more and larger inclusions.

In vivo assessment of infectivity.

While the majority of the Tn mutants analyzed showed minimal morphologic or growth differences under in vitro cell culture conditions, some gene products may be of greater significance under the more physiologically relevant, diverse, and challenging conditions associated with mammalian infection. In order to assess this, a mouse model of C. trachomatis infection was implemented. Unfortunately, C. trachomatis L2 administered vaginally in mouse infections is readily cleared, rarely and unreliably ascends to the upper genital tract, and is not associated with the development of pathology (43, 44). As such, the transcervical model was used to deliver infectious doses directly into uterine horns of the upper genital tract (45). Previous experiments have shown that transcervical C. trachomatis infection of uterine horns typically peaked between 3 and 6 days postinfection and that the bacteria cleared (nearly 3 log-fold) after ∼9 days postinfection (45). Therefore, to discover potential deficiencies in infection and replication in the upper genital tract, mice were infected with individual Tn mutants and harvested on day 5, within the period of the peak of C. trachomatis L2 infection. Twelve Tn mutants that were evaluated for growth and morphology, including the parental strain and ct383/4::Tn clones, were used to infect mice and assess bacterial burden (Fig. 4). Most of the Tn mutants displayed infection levels similar to those seen with the parental C. trachomatis strain; however, two Tn mutant clones showed statistically significant decreases in levels of detectable organisms in the uterine horns compared to parental L2 (P < 0.05; Fig. 4). Disruptions in a FAD-dependent monooxygenase (FDM) (ct148) and the cdu1 deubiquitinase (ct868) were followed by a nearly 0.5 log-fold to 1 log-fold decrease in the levels of detectable organisms compared to the WT. Mutant ct148::Tn showed a striking deficiency with respect to detectable organisms, with 4 of 10 infected animals showing infection levels falling 2-log below the median of infection for WT-infected animals. Interestingly, mutant ct148::Tn displayed a slightly enhanced level of production of infectious progeny in vitro (Fig. 2C) relative to the parental strain. Conversely, mutant ct868::Tn showed no decreased growth rates in vitro, suggesting that cdu1 is dispensable for optimal growth in cell culture but that the absence of the corresponding gene product is important for growth in vivo. Importantly, the bacterial burdens seen with ct868::Tn infections were very similar to the levels previously reported from a study performed with this mutant strain (46), providing additional confidence in the reproducibility of these observations. While the results were not statistically significant, two additional mutants exhibited a noticeable decrease in bacterial burden, namely, mutants ct036::Tn (hypothetical) and ct153::Tn (membrane attack complex/perforin [MACPF]). Mutant ct036::Tn was among the clones that displayed lower levels of progeny production whereas mutant ct153:Tn produced more infectious progeny than the parental clones.
FIG 4

In vivo infections using Tn mutants with a transcervical mouse infection model. Groups of 10 female C57BL/6 mice were infected transcervically with 5 × 105 IFU of either parental (WT) C. trachomatis or Tn mutants as indicated. Five days postinfection, genital tracts were harvested and DNA was purified from uterine horns. Bacterial burdens were calculated as levels of Chlamydia genomes relative to host genomes, and ratios are shown as box-and-whisker scatter plots representing data from 10 mice. *, P < 0.05 (unpaired Student's t test).

In vivo infections using Tn mutants with a transcervical mouse infection model. Groups of 10 female C57BL/6 mice were infected transcervically with 5 × 105 IFU of either parental (WT) C. trachomatis or Tn mutants as indicated. Five days postinfection, genital tracts were harvested and DNA was purified from uterine horns. Bacterial burdens were calculated as levels of Chlamydia genomes relative to host genomes, and ratios are shown as box-and-whisker scatter plots representing data from 10 mice. *, P < 0.05 (unpaired Student's t test). Clearly, further temporal and spatial analyses in mice, detailed molecular and cellular studies, and genetic complementation are required for a more complete understanding of the role and function of gene products with demonstrated deficiencies in mice. However, these comparative in vitro and in vivo observations highlight that certain gene products may exhibit a more pronounced fitness defect in mice, prompting a focus on these gene products.

In silico analyses of CT339 support functional identification of CT339 as DNA uptake protein ComEC.

Chlamydia bacteria have been demonstrated to acquire and integrate DNA within or between certain Chlamydia species (24, 25, 47–49). Given the expected importance of lateral gene transfer in the evolution and adaptation of Chlamydia, as well as the paucity of identifiable gene candidates that may play a role in this fundamental process, the Tn insertion in ct339 was of particular interest for a more in-depth analysis among the members of the subset of Tn mutants. CT339 shares similarity with multiple competence-associated protein families and conserved domains, including ComEC (E values ranging from 2.33e−03 to 4.40e−24). In both Gram-negative and Gram-positive bacteria, ComEC plays a key role as an inner membrane protein, transporting single-stranded DNA (ssDNA) into the cytosol of the bacterial cell during natural DNA acquisition (50, 51). To further investigate the hypothesis that ct339 encodes a ComEC homolog, in silico analyses were performed. ComEC is an integral membrane protein that typically has 9 to 12 transmembrane helices and a conserved metal-binding motif, HΦxxΦSGΦH (“Φ” indicates hydrophobic residues; Fig. S5A) (50). Topology modeling of CT339 using five hydropathy programs resulted in a range of 8 (SPLIT) to 11 (MEMSAT) predicted transmembrane segments, which is similar to the proposed 9 to 12 transmembrane regions of ComEC (50). As previously described for ComEC (50), HMMTOP prediction identified a large N-terminal loop within CT339 spanning residues 94 to 256 with a potentially stabilizing disulfide bond formed by C148-C167, as well as the competence domain containing the conserved metal-binding motif HΦxxΦSGΦH. For all five hydropathy programs, an extracellular N-terminal domain and intracellular C-terminal domain were predicted, similar to those of ComEC (50). In contrast to the predicted topology of ComEC, none of the predictive transmembrane helices for CT339 display an amphipathic character and no segments are predicted to be buried parallel to the membrane surface (Fig. S5B) (50). On the basis of these in silico data, a transmembrane topology model was designed (Fig. S5C) supporting the structural homology between CT339 and ComEC, specifically within conserved competence domains and the N-terminal loop. Using this model, the Tn insertion site was identified within the last transmembrane segment, eliminating G490 through the carboxyl end of the protein, L509. It has been proposed that ComEC from Bacillus exists as a homodimer within the bacterial membrane and forms a pore for DNA uptake (50). Consequently, disruption of either the N-terminal loop or the C-terminal loop, as is observed with ct339::Tn insertion, may prevent proper folding and formation of this pore, therefore abolishing the ability to acquire DNA. CT339 has a predicted metal binding motif and topology similar to ComEC. (A) Multiple-sequence alignment of 10 competence proteins identified as containing the multidomain ComEC from the Conserved Domain Database. COG0658 was used to identify 10 bacterial species with similar competence domains with an E value of <6e−3. Hashtags indicate conserved histidine metal-binding motifs. Conserved hydrophobic residues are highlighted in orange. (B and C) Hydropathy plots of (B) ComEC from Bacillus subtilis and (C) CT339 from Chlamydia. Both predicted competence proteins display a large extracellular N-terminal loop stabilized by two cysteines (highlighted in yellow) and an extended C-terminal loop. The competence domain identified by analysis of data from the Conserved Domain Database is highlighted in blue, and the transposon insertion site is highlighted in green. Download FIG S5, PDF file, 0.2 MB.

Requirement of CT339 for DNA uptake via lateral gene transfer.

As previously mentioned, the transposon insertion in ct339 provided an opportunity to experimentally evaluate the importance of this gene product in lateral gene transfer and to support the in silico prediction of CT339 as a functional homolog to ComEC. Lateral gene transfer, including the transfer of specific antibiotic resistance genes, has been demonstrated to occur readily during coinfections with C. trachomatis strains (intraspecies) that encode different OmpA serotypes (25, 47). To evaluate the importance of CT339 in lateral gene transfer, intraspecies coinfections with different parental OmpA serovar strains (L1 or L2) encoding different antibiotic markers (L1 tetr or L2 bla) under conditions of dual antibiotic selection were performed (Fig. 5A). Each L2 strain used had either an intact (ct383/4::Tn bla) or a disrupted (ct339::Tn bla) ct339 gene. The relative levels of genetic transfer, particularly of the antibiotic marker, of the OmpA serovar strains were assessed by determining the quantity of progeny generated that exhibited each parental OmpA serotype (e.g., L1 versus L2).
FIG 5

Graphic depiction of intraspecies recombination to evaluate functional role of CT339 in lateral gene transfer. (A) Parental C. trachomatis with L1 ompA (blue circle, blue tick) encoding tetr (red tick) crossed with C. trachomatis with L2 ompA (gray circle, gray tick) containing either ct383/4::Tn bla (green tick) or ct339::Tn bla (green tick) to enable lateral gene transfer of resistance markers and selection of dual resistance chimeric clones (blue and gray circles). (B) Similar experiment using parental C. trachomatis with F ompA (yellow circle, yellow tick) encoding tetr (red tick) crossed with C. trachomatis with L2 ompA (gray circle, gray tick) containing either ct383/4::Tn bla (green tick) or ct339::Tn bla (green tick). Serovar-specific antibodies revealed the relative distributions of resulting dually resistant chimera organisms (yellow and gray circles). Quantitative evaluations of resulting chimeras are provided in Table 3. The resulting mix of L1 (blue) and L2 (gray) or of F (yellow) and L2 (gray) reflects the almost equal amounts of resulting OmpA serovar seen when the control ct383/4::Tn was used. In contrast, virtually all of the resulting organisms contained a L1 (blue) or F (yellow) ompA when ct339::Tn was used, indicating that the tetr gene, near ompA, was unable to be transferred into the L2 ct339::Tn mutant (gray). (C) Recombinants resulting from the experiment represented in panel A containing L1 ompA (blue circle, blue tick) encoding tetr (red tick) and the ct339::Tn bla (green tick) were crossed with the L2 ct339::Tn bla mutants. All resulting progeny contained the L1 ompA (blue tick).

Graphic depiction of intraspecies recombination to evaluate functional role of CT339 in lateral gene transfer. (A) Parental C. trachomatis with L1 ompA (blue circle, blue tick) encoding tetr (red tick) crossed with C. trachomatis with L2 ompA (gray circle, gray tick) containing either ct383/4::Tn bla (green tick) or ct339::Tn bla (green tick) to enable lateral gene transfer of resistance markers and selection of dual resistance chimeric clones (blue and gray circles). (B) Similar experiment using parental C. trachomatis with F ompA (yellow circle, yellow tick) encoding tetr (red tick) crossed with C. trachomatis with L2 ompA (gray circle, gray tick) containing either ct383/4::Tn bla (green tick) or ct339::Tn bla (green tick). Serovar-specific antibodies revealed the relative distributions of resulting dually resistant chimera organisms (yellow and gray circles). Quantitative evaluations of resulting chimeras are provided in Table 3. The resulting mix of L1 (blue) and L2 (gray) or of F (yellow) and L2 (gray) reflects the almost equal amounts of resulting OmpA serovar seen when the control ct383/4::Tn was used. In contrast, virtually all of the resulting organisms contained a L1 (blue) or F (yellow) ompA when ct339::Tn was used, indicating that the tetr gene, near ompA, was unable to be transferred into the L2 ct339::Tn mutant (gray). (C) Recombinants resulting from the experiment represented in panel A containing L1 ompA (blue circle, blue tick) encoding tetr (red tick) and the ct339::Tn bla (green tick) were crossed with the L2 ct339::Tn bla mutants. All resulting progeny contained the L1 ompA (blue tick).
TABLE 3

Frequency of C. trachomatis serotype (OmpA) following coinfection and dual antibiotic selection

C. trachomatis genotypeC. tractomatis serotype and frequency (%)
L1::tetr × L2 ct383/4::Tn blaL1 OmpA; 8.67 (±0.58) × 105L2 OmpA; 6.33 (±0.58) × 105L2 OmpA progeny; 42.2 (±1.99)
L1::tetr × L2 ct339::Tn blaL1 OmpA; 5.17 (±0.43) × 105L2 OmpA; 7.00 (±1.00) × 103L2 OmpA progeny; 1.12 (±0.40)
F::tetr × L2 ct383/4::Tn blaF OmpA; 4.33 (±1.15) × 105L2 OmpA; 3.33 (±0.58) × 105L2 OmpA progeny; 44.0 (±6.26)
F::tetr × L2 ct339::Tn blaF OmpA; 1.33 (±0.61) × 104L2 OmpA; 5.33 × 100 (±1.53)L2 OmpA progeny; 0.05 (±0.01)
Intraspecies coinfections and dual antibiotic selection with tetracycline-resistant C. trachomatis L1 (L1::tetR) and either the transposon control mutant L2 ct383/4::Tn bla or the proposed ComEC homolog disrupted clone L2 ct339::Tn bla were performed (Fig. 5) (Table 3). When C. trachomatis L1::tetr and L2 ct383/4::Tn bla were used for coinfections, high levels (>6 × 105 IFUs) and nearly equal amounts of recombinant progeny displaying either parental OmpA (58% L1 and 42% L2) were observed. The relatively equal frequencies support the idea that DNA uptake and lateral transfer of the tetR gene from the L1 strain into to L2 genome occurred as efficiently as that of the bla gene from the L2 strains into the L1 strain. In contrast, when the same L1::tetr parent was used in a coinfection with L2 ct339::Tn bla, similar levels of L1 OmpA-expressing progeny with dual resistance were detected (5.17 × 105 IFUs) but nearly 100-fold-lower levels of progeny displaying L2 OmpA were observed (7 × 103 IFUs) (Table 3). This supports the idea that DNA uptake and transfer of the bla gene into L1, which has an intact ct339 gene, were as efficient as the previous cross. In contrast, tetR was found to be incorporated into the L2 genome with the ct339::Tn bla mutation at a 2 log-lower level. While this supports the idea of the importance of CT339 (comEC) in DNA acquisition, the low level of tetR resistance suggests that the comEC gene product may not be essential for the process. Frequency of C. trachomatis serotype (OmpA) following coinfection and dual antibiotic selection An alternative hypothesis to explain the low level of L2 OmpA-positive samples seen following the L1::tetR and L2 ct339::Tn bla crosses is that, instead of poor uptake of the tetR gene into L2 ct339::Tn bla organisms, a region of DNA that included the L2 ompA gene and the ct339::Tn bla marker was transferred and integrated into L1 parent organisms. This would “convert” the L1 to an L2 OmpA serotype. To investigate this hypothesis, whole-genome sequencing was performed on several individual recombinants from each coinfection (L1::tetr versus L2 ct339::Tn bla or L2 ct383/4::Tn bla). As indicated in Fig. 6A, L1::tetr and L2 ct383/4::Tn bla crosses yielded genomes that predominantly reflected the OmpA serotype (mostly blue for L1 OmpA and mostly gray for L2 OmpA). Specifically, L1 or L2 OmpA-positive samples had an average of 78% L1 or 84% L2 genomic composition, respectively. In contrast, L2 OmpA-positive samples generated after a L1::tetr × L2 ct339::Tn bla coinfection had minimal L2 genome in the resulting clones (L2 [gray]; Fig. 6B), with an average genomic L2 composition of 36%, representing less than half the level observed in L1::tetr × L2 ct383/4::Tn bla crosses. Matching the levels of antibiotic resistance transfer in ct339 intact samples (L2 ct383/4::Tn bla), L1 positive OmpA samples showed an average of 80% L1 genomic composition (blue; Fig. 6B). These data support the hypothesis that DNA regions containing an L2 ompA gene and the ct339::Tn bla marker were most likely acquired by L1 parent clones through lateral gene transfer instead of tetR acquisition of a L2 ompA ct339::Tn bla organism.
FIG 6

Schematic representation of regions and genome compositions of C. trachomatis recombinant clones following lateral gene transfer with selected Tn mutants. Blue bars represent the regions of the genome from the L1/tetr parent. Gray bars represent regions from either L2 ct383/4::Tn bla or L2 ct339::Tn bla parent. Percentages of the C. trachomatis L2 genome present are indicated (right). (A) Progeny genomes from crosses between tetracycline-resistant C. trachomatis L1 and ct383/4::Tn bla. (B) Progeny genomes from crosses between tetracycline-resistant C. trachomatis L1 and ct339::Tn bla.

Schematic representation of regions and genome compositions of C. trachomatis recombinant clones following lateral gene transfer with selected Tn mutants. Blue bars represent the regions of the genome from the L1/tetr parent. Gray bars represent regions from either L2 ct383/4::Tn bla or L2 ct339::Tn bla parent. Percentages of the C. trachomatis L2 genome present are indicated (right). (A) Progeny genomes from crosses between tetracycline-resistant C. trachomatis L1 and ct383/4::Tn bla. (B) Progeny genomes from crosses between tetracycline-resistant C. trachomatis L1 and ct339::Tn bla. The generation of L1::tetr/ct339::Tn bla recombinant clones provided an additional opportunity to further investigate the essentiality of ct339 for DNA acquisition and genome incorporation. These clones were used in coinfections with the parent L2 ct339::Tn bla clone with dual antibiotic selection (Fig. 5C). If ct339 were essential for DNA acquisition and incorporation, then all resulting clones should be only L1 OmpA positive, as the L2 ompA gene would not have the ability to be transferred and incorporated into the L1 genome to enable a serotype conversion. However, if ct339 is only partially required, then a mix of L1 and L2 OmpA populations would be expected to be observed following coinfection and antibiotic selection (i.e., with the tetR marker taken up and incorporated into the L2 genome or L2 OmpA transferred and incorporated into the L1 genome). Three independent coinfections revealed that only L1 OmpA-positive inclusions were observed with extensive (∼5 × 107) levels of IFUs utilized per evaluated cross (data not shown). Additionally, transformation of the L2 ct339::Tn bla mutant was also attempted using an inducible green fluorescent protein (GFP) plasmid (pTLR2-GFP) and chloramphenicol for selection. Every attempt to transform parental L2 samples that had an intact chromosomal ct339 gene was successful using the inducible plasmid. In contrast, none of the attempts to transform L2 ct339::Tn bla with the plasmid were successful (data not shown). To further address the functionality of CT339 in lateral gene transfer, similar coinfections and dual-selection experiments were performed with tetracycline-resistant C. trachomatis serovar F (F::tetr). Using strains that are more phylogenetically distant (52) reduces the challenge of delineating highly similar genomic crossover regions. Three independent crosses and selections were performed with C. trachomatis F::tetR and either C. trachomatis L2 ct383/4::Tn bla or C. trachomatis L2 ct339::Tn bla (Fig. 6B). As observed in the L1 × L2 ct383/4::Tn bla experiments (Fig. 6A) (Table 3), approximately half of the inclusions with an intact ct339 exhibited either OmpA F (56%) or L2 (44%) seroreactivity (Table 3). Similarly to the L1::tetr versus L2 ct339::Tn crosses, more than 99.94% of the F::tetr × L2 ct339::Tn inclusions were positive for only OmpA F (Table 3). Taken together, these data support the hypothesis that ct339 is critical for DNA uptake and is likely serving as a ComEC functional homolog in C. trachomatis.

DISCUSSION

There have been many recent firsts in the area of genetically modifying Chlamydia trachomatis, including chemical mutagenesis (35–37), group II intron gene disruption systems (29), allele replacement (33, 34, 53), inducible gene expression (28, 54), and targeted gene repression (32). The development and validation of a transposon mutagenesis system using the Himar1 transposase, as presented here, provide another first and a key advance for the Chlamydia field. The data presented demonstrate that the transposase is functional within Chlamydia and that the use of the nonreplicative plasmid results in mutant C. trachomatis clones containing a single genomic insertion. The insertion sites are readily discovered and can be characterized by common PCR-sequencing-based techniques. These insertion mutations are stable, even without antibiotic selection, limiting the chances of genetic reversion. Support for this stability was provided by the multiple passages and large-scale growth conditions (3 to 5 passages for expansion and spinner flask cultivation), without antibiotics, employed prior to animal studies as well as by the confirmation of Tn insertions in samples prior to and after animal infections. A primary benefit of this single-insertion, random mutagenesis approach is the ability to associate a specific genetic disruption with a resulting phenotype. While polar effects can occur as the result of a Tn insertion, such effects can be viewed as a benefit, as an insertion can enable researchers to focus on a selected but known pool of candidates associated with a particular phenotype. As demonstrated by the insertion disruption of ComEC homolog CT339 and by the subsequent biological studies related to lateral gene transfer in Chlamydia presented here, the scientific contributions of this molecular tool and approach are expected to be very useful for Chlamydia studies. Notwithstanding these benefits, the present report also highlights the relatively low efficiency associated with Chlamydia transposon mutagenesis and its current limitations for large-scale studies. While most of this restriction is thought to be due to the extremely poor transformation efficiency associated with C. trachomatis, the low insertional efficiency may also suggest that high numbers of genes are essential for growth and completion of the chlamydial developmental cycle under cell culture conditions. A total of 70 genes incurred a Tn insertion in this study, while the results of a random chemical mutagenesis study performed by Nguyen and Valdivia (37) indicated that 84 protein-coding genes incurred a nonsense mutation with limited in vitro growth effects. Fifteen of the 84 genes were also disrupted in that Tn insertion analysis, providing a total of 139 genes that have disruptions in the coding region following ethyl methanesulfonate (EMS) mutagenesis or Tn insertion. This represents around 15% of the encoding gene products. While the number of genes that are essential for growth under tissue culture conditions is currently unknown, the relative low level of overlap of disruptive Tn and EMS mutations suggests that many more C. trachomatis genes may tolerate disruption. Among the more striking observations were the enhanced in vitro growth of a ct148::Tn mutant clone and the almost log-fold decreased infectivity in mice (Fig. 2C; see also Fig. 4). The Tn insertion occurs in the first third of the coding region, providing higher expectations that the function of this gene product is indeed disrupted. The gene downstream from ct148 is oriented in the opposite direction, although there is a gene 200 bp upstream. This distance and the reported location of the transcriptional start site 85 bp upstream of ct148 (40) support the idea that there is a single gene operon and that polar effects from this Tn insertion are limited. The ct148 gene encodes a FAD-dependent monooxygenase (FDM). Monooxygenases are known to play roles in multiple metabolic pathways, and, as Iliffe-Lee and McClarty showed previously (55), C. trachomatis contains an almost complete and functional Embden-Meyerhof glycolysis and pentose phosphate pathway. For a number of other bacteria, it has been shown that metabolic proteins are nonessential for growth in vitro and yet play vital roles in vivo (8, 56–58). Many of the key nutrients required for survival are provided in media used to grow these pathogens. Thus, any detrimental effect that a mutation may have may not be as easily identified in vitro. In contrast, in vivo infections provide physiological conditions for growth which are not provided via media, enabling the effects of these mutations to be detected. While the specific role of ct148 in infectivity remains unknown, the in vivo data provide support for the idea that components that are seemingly nonessential for Chlamydia growth in tissue culture may, in fact, play significant roles in mammalian models of infection. A similar discrepancy between in vitro and in vivo growth outcomes was also observed with the ct868::Tn clone which disrupts cdu1. Cdu1 is a deubiquitinase, and it has been shown that disruption of this protein results in an increase of ubiquitination of Mcl-1 (46). Cdu1 has also been demonstrated to be capable of inhibiting host NF-κB, which represents a central regulator of numerous immune responses, including cytokine secretion and T-cell proliferation, and a vital host defense against intracellular pathogens (59–61). Overall, these observations highlight the challenges and potential discrepancies of functional studies performed in tissue culture, strengthening the necessity for analysis using in vivo models of infection. The most striking phenotype was that of the observable growth and morphological deficiencies of strain ct696::Tn (see Fig. S2 in the supplemental material). First classified as a slow grower, approximately 8 days of growth of ct696::Tn were required for for detection of visible inclusions by phase microscopy, and subsequent analysis by confocal microscopy identified decreased numbers of RBs/EBs as well as the absence of the nuclear localization typically observed with Chlamydia inclusions. Due to its genetic location near the genes encoding the known type III secretion (T3S) effector proteins CT694 and CT695, it has been hypothesized that ct696 may also play a role in T3S; however, studies have suggested that this may not be the case. Secretion of CT696 was not observed in previous studies employing a heterologous T3S system with Yersinia enterocolitica (62, 63), and ct696 transcription was found to occur independently of ct694 (64, 65). The ct696 gene (ctl0065) was also disrupted using allelic exchange (33); however, growth phenotypes were not provided. CT696 is a conserved Chlamydiaceae hypothetical protein with no sequence or conserved domains shared outside the members of this family. Using the bacterial localization tool PSORTb (66), CT696 was predicted to be a cytosolic protein. While additional in-depth analysis is required to evaluate the role and function of CT696 in growth and inclusion formation, this observation provides support for these efforts as well as a good example of the utility of this transposon approach for discovery of genes important to the biology of Chlamydia. Along with gaps in understanding the mechanisms of development and in vivo infectivity of Chlamydia, there is also limited information regarding the components and mechanisms for lateral gene transfer. The absence of lateral gene transfer in organisms that contain the ct339::Tn insertion provides compelling support for the essential contribution of this gene product to this fundamental evolutionary process. CT339 is predicted to be a multipass transmembrane protein with domain similarity to ComEC, the competence uptake protein seen in many bacteria. According to the protein family database (pfam) architecture, genes encoding proteins with this competence motif often exist near genes encoding proteins that include lactamase-superfamily domains, which are predicted to regulate the competence operon (67). Baker et al. recently showed the ComEC from Bacillus contains a β-lactamase-like domain within its C-terminal loop (approximately residues 494 to 763), potentially functioning as a nuclease (68). While it is widely accepted that double-stranded DNA (dsDNA) must first be converted into ssDNA for uptake and incorporation into recipient genomes, the nuclease responsible for this activity in Bacillus remains unknown; thus, it has been hypothesized that this lactamase-like domain within ComEC may be fulfilling this role. As a potential homolog of ComEC, a Tn disruption in the C terminus of CT339 may prevent the degradation of dsDNA into ssDNA and would decrease the ability of Chlamydia to undergo lateral gene transfer. However, Pfam and SMART (69) analyses of CT339 did not identify a similar lactamase-like domain near the C terminus. Rather, genome analysis of C. trachomatis identified RNase Z (CT346), a lactamase-superfamily protein neighboring CT339—suggesting that this protein may instead be fulfilling that role in the chlamydial competence system. Future studies assessing the dimerization and pore formation of CT339 and potential nuclease activity of CT346 will assist in identifying how CT339 enables DNA uptake. Other potential components involved in DNA uptake in Chlamydia are less evident. Pili or pseudopili predominantly facilitate binding and transport of DNA to the bacterial surface, although no proteins sharing any sequence similarity to pilus homologs were identified in Chlamydia. Interestingly, Helicobacter pylori is unique among naturally transformable bacteria in that it does not use pili but instead relies on a dedicated type IV secretion system for DNA uptake (70). Gram-negative bacteria typically transport dsDNA through an outer membrane secretin channel (e.g., PilQ) and then process the dsDNA into ssDNA with a periplasmic protein, ComEA. Single-stranded DNA is then transported through inner membrane protein ComEC and into the bacterial cytoplasm, where it is bound by RecA or DprA (71). Direct pairwise BLAST analysis of C. trachomatis with numerous Gram-negative secretin homologs (PilQ) revealed sequence similarity (E values <10−9) to only type II and type III secretion outer membrane proteins, GspD (CT572) and YscC (CT674), respectively. Similarly, no protein with similarity to various ComEA or DprA homologs was identified through sequence-based pairwise analysis. Clearly, there is much to be learned about the Chlamydia DNA uptake system, although it is safe to state that, similarly to H. pylori, Chlamydia is likely an exception to the general DNA uptake model. In summary, the development and characterization of a transposon system that is functional in Chlamydia represent a substantial advance and a valued addition to the growing repertoire of genetic manipulations in this field. Such a transposon system is expected to have an enabling effect on the discovery of biological and pathogenesis-related genes, allowing the association of single-gene insertions with evaluated phenotypes. Only a subset of the initial Tn insertion mutant clones was evaluated for in vitro and in vivo growth and infectivity. An expanded analysis of the remainder of the Tn insertional clones by the use of these and other phenotypic screens will elucidate the contribution and role of various gene products. This report has also highlighted the current inefficiency in transformation in Chlamydia, which will need to be overcome for large-scale mutagenesis studies. Despite this shortcoming, there is much promise for this technique and its associated applications, as evident from the support for CT339 in the fundamental evolutionary process of lateral gene transfer in Chlamydia. There are also high expectations that this system will be applicable and functional for studies in other Chlamydia species and serovars (e.g., C. muridarum and C. trachomatis serovar D), thus enabling animal studies and analysis of more clinically relevant strains for the discovery of virulence factors and potential therapeutic targets.

MATERIALS AND METHODS

Chlamydial strains and propagation.

C. trachomatis serovar L2 434/Bu was propagated in L929 mouse fibroblast cells (ATCC CCL-1) using RPMI 1640 medium (Invitrogen, Grand Island, NY) supplemented with 5% heat-inactivated fetal bovine serum (FBS) plus 10 μg/ml gentamicin (Fisher Scientific, Pittsburgh, PA). Briefly, L929 monolayers were grown to confluence in spinner flasks (∼8 × 105 cells/ml) and infected with purified EBs at a multiplicity of infection (MOI) of 1. Cultures were allowed to grow for up to 48 h at 37°C and 5% CO2. Percent infectivity was assayed by IFA microscopy (described below). EBs were harvested as previously described (72) using a series of centrifugation and sonication steps to disrupt the host cells and release EBs. Once isolated, EBs were either frozen immediately or further purified using Omnipaque (Barrington, IL) and ultracentrifugation. All EBs were stored in sucrose-phosphate-glutamic acid (SPG) media at −80°C. Clonal isolates were obtained as previously described (73).

Development of pCMA transformation plasmid.

pUC19 (GenBank accession no. L09137) was used as the initial backbone for pCMA generation and primers used are listed in Table S1 in the supplemental material. The C9 hyperactive transposase was amplified from pBADC9 (kind gift from D. Lampe of Duquesne University [3]) and cloned between the EcoRI and AatII sites. An EagI site was incorporated for subsequent promoter cloning. Initially, a vector (pCMT) that contained a tetracycline-encoding transposon was generated for application in C. muridarum by the use of pACYC184 (GenBank accession no. X06403) as the template. Primers incorporated Himar inverted repeats and restriction sites for cloning into the XmaI site. To remove the β-lactamase gene carried on pUC19, the transposase, tetracycline transposon, and ori region were amplified with primers containing NcoI sites for self-ligation. Ligase-independent cloning and HindIII sites were used to replace the tetracycline transposon with one encoding the β-lactamase and the associated promoter from pSW2 (27). To assist with selective expression of the transposase within Chlamydia and with less expression during plasmid propagation in E. coli, the chlamydial ct559 promoter and ribosomal binding sites were cloned upstream of the transposase gene using the EagI site (38). The complete DNA sequence for pCMA is provided in the supplemental material. The graphical depiction of the plasmid (see Fig. S1 in the supplemental material) was generated using Savvy Scalable vector graphics (74). Primers used in this study. Download Table S1, PDF file, 0.2 MB.

Transposon mutagenesis.

The method used for transformation of C. trachomatis was modified from previously described methods (27, 39). L929 cells were seeded to confluence in 6-, 12-, or 24-well plates and allowed to adhere overnight. The Chlamydia-DNA transformation reaction mixture (200 μl total volume) was prepared with 10 μl of C. trachomatis L2 434/Bu EB seed stock, 1× SPG (∼1 × 107 IFU), 15 μg of pCMA plasmid DNA, and 100 μl of 2× CaCl2 buffer (20 mM Tris-HCl [pH 7.5], 100 mM CaCl2), with double-distilled water (ddH2O) added to reach the final volume. Following gentle pipette mixing, the reaction mixtures were incubated for 30 min at room temperature (RT). The mixture was added to 12 ml of 1× CaCl2 buffer (10 mM Tris-HCl [pH 7.5], 50 mM CaCl2) before being overlaid onto a L929 monolayer that was washed once with 1× CaCl2 buffer (10 mM Tris-HCl [pH 7.5], 50 mM CaCl2). Plates were spun at 550 × g for 30 min at RT. Fresh RPMI medium supplemented with FBS, gentamicin, and 1 μg/ml cycloheximide was added, and the plates were incubated at 37°C and 5% CO2 overnight. Ampicillin (Fisher Scientific, Pittsburgh, PA) (1 μg/ml) was then added for antibiotic selection at 16 to 18 h postinfection. Cultures were kept under conditions of selection using increasing concentrations of antibiotics and serially passaged every 48 hpi. After the final passage, EBs were harvested for identification of insertion site and subsequent analyses. Transformation efficiencies were estimated using 1 × 107 IFU input organism and 15 μg plasmid DNA, resulting in an average of 4 unique clonal isolates from each transformation (4 IFU/15 μg DNA). Twenty-three transformations were performed, resulting in 105 ampicillin-resistant cultures. The levels of transformation efficiency were separately assessed with five independent transformations using pGFP::SW2 plasmid under similar conditions and the same stocks of C. trachomatis as were used in transposon mutagenesis.

Whole-genome sequencing.

DNA was extracted from purified EBs using a Qiagen blood and tissue kit (Qiagen, Valencia, CA). Manufacturer’s instructions were used with minor modifications. In brief, purified EBs were aliquoted with buffer AL before proteinase K was added and the reaction mixtures were incubated at 56°C for 1 h. After incubation, buffer AL and ethanol (96% to 100%) were added and mixed thoroughly by the use of a vortexing mixer. The reaction mixtures were added onto a provided DNeasy Mini spin column and collection tube and were centrifuged at 6,000 × g. Two wash steps were then performed using buffer AW1 and AW2, each with centrifugation. Finally, the reaction mixtures were incubated with buffer AE for 20 min at room temperature and centrifuged and the eluate was saved. For quality control, each sample was verified using a spectrophotometer (Denovix Ds-11 FX+) to quantify DNA. Extracted DNA was prepared for sequencing at the Genome Sequencing Core at the University of Kansas, where library preparation and further quality control were completed. Samples were multiplexed and run on an Illumina Miseq PE100 platform. Paired-end reads were generated with a Phred score (>Q30) of 95.44%. Reads were then demultiplexed and analyzed using the Geneious software suite. Total read coverage was calculated as a function of the proportion of reads that mapped to the WT reference genome (the total of chlamydial reads) over the total number of reads generated for the sample, including host DNA and other contaminant DNA. A threshold of 10 reads was created to check for the depth of coverage at each base pair (75).

Assembly and analysis of the transposon mutant genomes.

The C. trachomatis LGV 434/Bu (“Hefty”) parental clone sequence (NCBI sequence accession no. CP019386.1) was generated through assembly guided by reference to the previously published genome Chlamydia trachomatis 434/Bu (NCBI sequence accession no. NC_010287.1). The Hefty parental genome sequence contained three mutations relative to the reference strain, namely, two nonsynonymous mutations (G946945A [H1121N] and C942546A [R274H]) and one intergenic indel (indel in lowercase; 127353/4 [AGGCCCattctaaaggccCCCTT]). After the parental draft was generated, each of the other samples were generated using the parental sequence as the reference sequence. In each case, read depth and potential loss of read continuity were considered for potential duplications or rearrangements. The reads were also mapped to the transposon sequence for each sample to ensure that the transposon was inserted into the correct site at the genome. Alignment files were generated for alignments between each mutant genome draft and the parental draft. Any mutations corresponding to these that might have accumulated through the study were annotated and verified using the reads. Host DNA contamination within each sample was mitigated using the reference-guided assembly techniques. Transposon insertion sites were analyzed both through the use of the reference-guided mapping of the genomes and separately through the use of reference-guided assembly of the raw reads to the transposon sequence. In each case, these were analyzed separately from the hypothesized insertion sites to prevent bias. The read quality of the transposon assemblies was proportional to the size of each genome in every case. Plasmid sequences were generated for each sample by using the C. trachomatis LGV plasmid (NCBI sequence accession no. NC_021051.1). Plasmid gene assignments incorporated both pgp1-8 (42) and cds1-8 (76) nomenclature. All alignments were performed in Geneious using global alignment with free end gaps and a cost matrix corresponding to 65% similarity. Completed sequences were submitted to GenBank and assigned accession numbers (see “Data accessibility” section below). The transposon mutant genomes were evaluated for new single nucleotide polymorphisms (SNPs), and no mutations were discovered after the transformation and cultivation processes. While all studies were performed using C. trachomatis LGV 434/Bu, C. trachomatis serovar D gene nomenclature is utilized due to recognition and field familiarity.

Assembly and analysis of the recombinant progeny genomes.

Each recombinant genome was generated using assembly guided by reference to the OmpA parental genome. Genomes were then aligned to both parental genomes and scanned for regions of homology using the Geneious global alignment tool with free end gaps and a cost matrix corresponding to 65% similarity. Initial sequence assembly was verified through assembly guided by reference to the minority parent. Regions of homology were annotated, and margins were estimated based on similarity to the individual parents.

In vitro growth analysis of Tn mutants.

For temporal assessment of progeny production, L929 mouse fibroblast cells were infected in triplicate with C. trachomatis parental or Tn mutant clones with a multiplicity of infection (MOI) of 0.5 in 24-well plates. At 18, 24, 30, 36, and 42 h postinfection (hpi), wells were washed once with Hanks’ balanced salt solution (HBSS) and then immediately frozen in 1× SPG at −80°C within the 24-well plate. The 24-well plates were then thawed on ice and transferred to 1.5-ml Eppendorf tubes and sonicated in a Q500 Qsonica cuphorn sonicator (Qsonica) with the following settings: 75% amplitude; 4 pulses; 30-s ON/30-s OFF cycle in chilled (∼5°C) water. To determine titers of inclusion-forming units, samples were then serially diluted and used to infect confluent monolayers of L929 mouse fibroblast cells in 96-well μClear CellStar plates (catalog no. 655090; Greiner Bio-One, Frickenhausen, Germany) or 8-well μ-Slides (Ibidi, Martinsried, Germany). After 24 h postinfection, the cells were washed with HBSS and then fixed with 100% methanol. Cells were washed with phenol-free HBSS before staining was performed with a MicroTrak C. trachomatis culture confirmation kit (Trinity Biotech, Wicklow, Ireland). After at least 1 h of room temperature incubation, 1 μM DAPI (4′,6-diamidino-2-phenylindole) diluted in phosphate-buffered saline (PBS) was added and allowed to stain wells for 10 min. A final overlay of 0.1 M Tris-glycerol was added, and cells were imaged on an Olympus IX71 inverted microscope (Olympus, Waltham, MA) with both 10× and 40× objectives. Inclusions were enumerated manually for each sample by immunofluorescence microscopy. For calculation of progeny production, titers were also determined for the inoculum that was initially used to infect the 24-well plates at the time of infection to incorporate subtle differences in starting infectivity for each mutant relative to the parental strain (see Fig. S4 in the supplemental material). To normalize variations in Tn mutant progeny production that would result from differences in starting infectivity levels, the ratio of starting inoculum of the parental strain to the starting inoculum of the Tn mutant was individually multiplied by each Tn mutant’s titers at each time point (18, 24, 30, 36, or 42 hpi). Data are shown as means and standard deviations (SD) for triplicate wells, generated in GraphPad Prism 7, and statistical differences were calculated using the two-tailed Student's t test. With a P value of <0.05, ct732::Tn had significantly reduced progeny production at 24, 30, 36, and 42 hpi; ct590::TN and ct036::Tn had significantly reduced progeny production at 24, 30, and 42 hpi; ct350::Tn had significantly reduced progeny production at 30 and 42 hpi; ct153::Tn and ct550::Tn had increased progeny production at 24 hpi; ct339::Tn had increased progeny production at 24 and 42 hpi; and ct148::Tn had increased progeny production at 30 and 42 hpi.

Confocal immunofluorescence microscopy.

L929 cells were grown to confluence in an 8-well ibiTreat μ-Slide (Ibidi, Martinsried, Germany) and were infected with the respective C. trachomatis/Tn mutants. At ∼24 hpi, infected cells were fixed with 100% methanol for 10 min at RT. Cells were washed once with HBSS and again with PBS and then stained using the preparation supplied in the MicroTrak C. trachomatis culture confirmation test (Syva Co., Palo Alto, CA) (180 μl) diluted 1:40 in PBS for 1 h 50 min at RT in the dark or overnight at 4°C. A 2-μl volume of 1 μM DAPI (4′,6-diamidino-2-phenylindole) diluted 1:100 in PBS was then added to wells and allowed to stain for 10 min at RT in the dark. The stain was then removed, and the cells were washed with PBS. A final overlay of Vectashield antifade mounting medium (Burlingame, CA) was added, and slides were stored at 4°C in the dark until the imaging step. Cells were visualized on an Olympus IX81/3I spinning disk confocal inverted microscope at ×150 magnification and captured on an Andor Zyla 4.2 scientific complementary metal oxide semiconductor (sCMOS) camera (Belfast, Northern Ireland). Microscope and camera were operated using SlideBook 6 software (Intelligent Imaging Innovations, Denver, USA). Exposure time remained consistent for all fields captured, with the exposure time for DAPI set at 2 s, for OmpA at 4 s, and for cytoplasm at 6 s. Three to seven Z stack images were taken at 0.3-μm intervals per cell imaged. Images were processed in SlideBook 6, and No Neighbors deconvolution (with a subtraction constant of 0.4) was applied to all images.

In vitro inclusion size analysis for Tn mutants.

L929 mouse fibroblast cells were infected at low MOI (∼10% of cells infected) in triplicate on two separate 96-well plates with parental population or a clonal population of Tn mutant Chlamydia trachomatis. At 24 hpi, cells were fixed with methanol for 10 min. Cells were then stained using a MicroTrak C. trachomatis culture confirmation kit for 1 h at room temperature. DAPI (4′,6-diamidino-2-phenylindole) (1 μM) was diluted in PBS and allowed to stain wells for 10 min. A final overlay of 0.1 M Tris-glycerol was added, and cells were imaged on an EVOS FL Auto 2 microscope (Thermo Scientific, Waltham, MA) using a 20× objective. A total of 16 fields were imaged for 6 wells for each sample, including more than 200 inclusions per sample (range, approximately 200 to 1,000). Each inclusion area was then measured using MIPAR (MIPAR, Worthington, OH). Within MIPAR, segmentation of inclusions was performed by applying a threshold to images to identify inclusions based on a range of pixel values that was standardized to parental images. After segmentation of inclusions, the total area was measured and quantified as the total number of pixels. This output was then exported to GraphPad, and statistical analysis was performed. Statistical analysis consisted of a one-way analysis of variance (ANOVA) with Dunnett’s multiple-comparison test (statistical significance P value, <0.05).

Mouse transcervical infections.

Female C57BL/6 mice (6 to 8 weeks old) were purchased from Jackson Laboratories and housed in accordance with the requirements specified by the University of Kansas Institutional Care and Use Committee. Mice were treated subcutaneously with 2.5 mg medroxyprogesterone acetate (Depo-Provera, Pfizer, NY) upon arrival (day −7). Fresh aliquots of parental or Tn mutant C. trachomatis clones were diluted in sucrose-phosphate-glutamic acid (SPG) buffer and kept on ice until use. Using a nonsurgical embryo transfer device (NSET; ParaTechs, Lexington, KY), mice were inoculated transcervically with 10 μl diluted stock (final concentration, 5 × 105 IFU/mouse) by insertion of the device into the genital tract beyond the opening of the cervix. For each infection, samples used to infect mice were also evaluated for titer to ensure delivery of the expected infectious dose. The infections and analyses performed with ct868::Tn were repeated from the initially reported experiments (46).

ddPCR assessment of Chlamydia infection in vivo.

Mice were humanely euthanized 5 days postinfection, and the genital tracts were collected in SPG. Uterine horns were homogenized using a rotor/stator homogenizer (Biospec, Bartlesville, OK). Aliquots (100 μl) were frozen at −20°C until use. The remaining stocks of homogenized tissues were stored at −80°C. DNA isolation was performed using the 100-μl aliquots and a DNeasy blood and tissue kit (Qiagen). Isolated DNA was then used for droplet digital PCR (ddPCR) analyses. Primers and probes for C. trachomatis secY and murine rpp30 (see Table S1 in the supplemental material) were used with ddPCR Supermix for Probes (Bio-Rad, Hercules, CA) to set up the PCRs. Oil-for-Probes droplet emersions were generated using a droplet generator cassette (Bio-Rad). The PCR conditions were as follows: 95°C for 10 min and 40 cycles of 94°C for 30 s and 98°C for 10 min followed by cooling to 4°C. Fluorescent reads of individual droplets were calculated after PCR was performed using a QX200 droplet reader (Bio-Rad). Data were analyzed using QuantaSoft Software (Bio-Rad), and the results are reported as log10 ratios of Chlamydia DNA to host DNA (secY/rpp30 copies/μl). Box and whisker scatter plots were generated in GraphPad Prism 7, and recoverable organisms were compared using unpaired multiple t tests with no correction for multiple comparisons.

Bioinformatic analysis of CT339 and chlamydial competence.

BLAST analyses and subsequent queries within the Conserved Domain Database resulted in hits within the competence superfamily and multidomain hits for ComEC. Multiple-sequence alignments were generated using ClustalW and 10 variable species hits within the Clusters of Orthologous Groups of proteins (COG0658) (77). The following proteins were used (NCBI accession numbers shown in parentheses): competence protein ComEC family protein Shigella dysenteriae 1617 (YP008850592.1), competence locus E Helicobacter pylori Hp P-26 (EJC51989.1); competence protein ComEC Enterococcus faecium DO (YP006375852.1); ComE Synechocystis sp. PCC 6803 (BAA17126.1); ComEC Listeria monocytogenes EGD-e (CAC99560.1); ComE operon protein 3 Bacillus subtilis subsp. subtilis strain 168 (NP 390435.1); hypothetical protein AGR C 2573 Agrobacterium tumefaciens sp. strain C58 (NP354400.1); competence protein Neisseria meningitidis MC58 (NP273744.1); hypothetical protein CT339 Chlamydia trachomatis D/UW-3/CX (NP 219846.1); ComEC/Rec2 family protein Clostridium botulinum A strain ATCC 3502 (YP 001255462.1); ComEA Neisseria meningitidis (CAB44958); ComEA protein Helicobacter bilis (WP_004084273); competence ComEA Shigella dysenteriae 1617 (EFP70107); competence protein ComGA Enterococcus faecium (WP_002304768); competence protein ComGA Listeria monocytogenes (WP_009933475); ComGA Bacillus subtilis (BAA12533); (multispecies) competence protein ComGB (WP_002286180); (multispecies) competence protein ComGB Bacilli (WP_048681721); competence protein ComGB Listeria monocytogenes (WP_010990101). (multispecies) type IV pilus secretin PilQ Neisseria (WP_016686778); type 4 pilus secretin PilQ (outer membrane porin) Shigella dysenteriae 1617 (AHA67697); (multispecies) pilus assembly protein PilE Neisseria (WP_002214937); and ComGC Bacillus subtilis (BAA12535). The following five hydropathy prediction programs were used to predict topology for CT339: HMMTOP v2.0 (78); MEMSAT-SVM (79); TMHMM2.0 (80); TOPPRED (81); and SPLIT (82). Transmembrane illustrations were generated and modified using Protter v1.0 (83).

Generation of recombinant clones for assessment of bacterial competence.

All experiments performed with tetracycline-resistant Chlamydia as described in this work were reviewed and approved by the National Institutes of Health Recombinant DNA Advisory Committee (University of Washington). Recombination experiments were performed as previously described (47). Briefly, sets of individual shell vials were seeded with McCoy cells and subsequently coinfected with the following combinations of drug-resistant strains: C. trachomatis L1/tetr (NCBI accession number ACUI01000000), C. trachomatis serovar F/tetr, and either C. trachomatis LGV2 (ct383/4::Tn bla) or C. trachomatis LGV2 ct339::Tn bla. Cultures were incubated for 40 h postinfection in the absence of antibiotics and were then detached using −80°C/37°C freeze-thaw. Recombinants were isolated by infection of 96 new shell vial monolayers with 1 ml freeze-thaw lysates and treatment with both penicillin and tetracycline and were passaged until dually resistant clones were detected. Recombinant clones were propagated and cloned by limiting dilution and subsequently evaluated for identification of serovar-specific OmpA. DNA from clones was harvested and subjected to WGS as described above.

Data accessibility.

Completed sequences were submitted to GenBank and assigned the following accession numbers (shown in parentheses): CT015::Tn (NHAT01000000); CT036::Tn (NHAU01000000); CT153::Tn (NHAV01000000); CT333::Tn (NHAW01000000); CT339::Tn (NHAX01000000); CT392::Tn (NHAY01000000); CT550::Tn (NHAZ01000000); CT819::Tn (NHBA01000000). The pCMA vector was completely sequenced and deposited (GenBank accession no. MN177722).
  81 in total

1.  The HMMTOP transmembrane topology prediction server.

Authors:  G E Tusnády; I Simon
Journal:  Bioinformatics       Date:  2001-09       Impact factor: 6.937

Review 2.  Emancipating Chlamydia: Advances in the Genetic Manipulation of a Recalcitrant Intracellular Pathogen.

Authors:  Robert J Bastidas; Raphael H Valdivia
Journal:  Microbiol Mol Biol Rev       Date:  2016-03-30       Impact factor: 11.056

3.  Expression and targeting of secreted proteins from Chlamydia trachomatis.

Authors:  Laura D Bauler; Ted Hackstadt
Journal:  J Bacteriol       Date:  2014-01-17       Impact factor: 3.490

Review 4.  Animal models for studying female genital tract infection with Chlamydia trachomatis.

Authors:  Evelien De Clercq; Isabelle Kalmar; Daisy Vanrompay
Journal:  Infect Immun       Date:  2013-07-08       Impact factor: 3.441

5.  Natural transformation competence in Helicobacter pylori is mediated by the basic components of a type IV secretion system.

Authors:  D Hofreuter; S Odenbreit; R Haas
Journal:  Mol Microbiol       Date:  2001-07       Impact factor: 3.501

6.  Genome sequence of an obligate intracellular pathogen of humans: Chlamydia trachomatis.

Authors:  R S Stephens; S Kalman; C Lammel; J Fan; R Marathe; L Aravind; W Mitchell; L Olinger; R L Tatusov; Q Zhao; E V Koonin; R W Davis
Journal:  Science       Date:  1998-10-23       Impact factor: 47.728

7.  Horizontal transfer of tetracycline resistance among Chlamydia spp. in vitro.

Authors:  R J Suchland; K M Sandoz; B M Jeffrey; W E Stamm; D D Rockey
Journal:  Antimicrob Agents Chemother       Date:  2009-08-17       Impact factor: 5.191

8.  Evidence that CT694 is a novel Chlamydia trachomatis T3S substrate capable of functioning during invasion or early cycle development.

Authors:  S Hower; K Wolf; K A Fields
Journal:  Mol Microbiol       Date:  2009-05-15       Impact factor: 3.501

9.  Interstrain gene transfer in Chlamydia trachomatis in vitro: mechanism and significance.

Authors:  Robert DeMars; Jason Weinfurter
Journal:  J Bacteriol       Date:  2007-12-14       Impact factor: 3.490

10.  Chlamydia trachomatis diversity viewed as a tissue-specific coevolutionary arms race.

Authors:  Alexandra Nunes; Paulo J Nogueira; Maria J Borrego; João P Gomes
Journal:  Genome Biol       Date:  2008-10-23       Impact factor: 13.583

View more
  20 in total

1.  Analysis of Orientia tsutsugamushi promoter activity.

Authors:  Jason R Hunt; Jason A Carlyon
Journal:  Pathog Dis       Date:  2021-09-23       Impact factor: 3.951

2.  Inter-species lateral gene transfer focused on the Chlamydia plasticity zone identifies loci associated with immediate cytotoxicity and inclusion stability.

Authors:  Zoe E Dimond; Robert J Suchland; Srishti Baid; Scott D LaBrie; Katelyn R Soules; Jacob Stanley; Steven Carrell; Forrest Kwong; Yibing Wang; Daniel D Rockey; Kevin Hybiske; P Scott Hefty
Journal:  Mol Microbiol       Date:  2021-11-16       Impact factor: 3.979

3.  Markerless Gene Deletion by Floxed Cassette Allelic Exchange Mutagenesis in Chlamydia trachomatis.

Authors:  Gabrielle Keb; Kenneth A Fields
Journal:  J Vis Exp       Date:  2020-01-30       Impact factor: 1.355

4.  Development of Transposon Mutagenesis for Chlamydia muridarum.

Authors:  Yibing Wang; Scott D LaBrie; Steven J Carrell; Robert J Suchland; Zoe E Dimond; Forrest Kwong; Daniel D Rockey; P Scott Hefty; Kevin Hybiske
Journal:  J Bacteriol       Date:  2019-11-05       Impact factor: 3.490

5.  Chromosomal Recombination Targets in Chlamydia Interspecies Lateral Gene Transfer.

Authors:  Robert J Suchland; Steven J Carrell; Yibing Wang; Kevin Hybiske; Debbie B Kim; Zoe E Dimond; P Scott Hefty; Daniel D Rockey
Journal:  J Bacteriol       Date:  2019-11-05       Impact factor: 3.490

6.  A Nonsurgical Embryo Transfer Technique for Fresh and Cultured Blastocysts in Rats.

Authors:  Barbara J Stone; Kendra H Steele; Hongsheng Men; Sarah J Srodulski; Elizabeth C Bryda; Angelika Fath-Goodin
Journal:  J Am Assoc Lab Anim Sci       Date:  2020-08-12       Impact factor: 1.232

7.  Comprehensive genome analysis and comparisons of the swine pathogen, Chlamydia suis reveals unique ORFs and candidate host-specificity factors.

Authors:  Zoe E Dimond; P Scott Hefty
Journal:  Pathog Dis       Date:  2021-03-10       Impact factor: 3.166

8.  The growing repertoire of genetic tools for dissecting chlamydial pathogenesis.

Authors:  Arkaprabha Banerjee; David E Nelson
Journal:  Pathog Dis       Date:  2021-05-11       Impact factor: 3.166

9.  Generation of Tetracycline and Rifamycin Resistant Chlamydia Suis Recombinants.

Authors:  Hanna Marti; Sankhya Bommana; Timothy D Read; Theresa Pesch; Barbara Prähauser; Deborah Dean; Nicole Borel
Journal:  Front Microbiol       Date:  2021-06-30       Impact factor: 5.640

Review 10.  An Ancient Molecular Arms Race: Chlamydia vs. Membrane Attack Complex/Perforin (MACPF) Domain Proteins.

Authors:  Gabrielle Keb; Kenneth A Fields
Journal:  Front Immunol       Date:  2020-07-14       Impact factor: 7.561

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.