Literature DB >> 30881052

Antimicrobial resistance, virulence genes profiling and molecular relatedness of methicillin-resistant Staphylococcus aureus strains isolated from hospitalized patients in Guangdong Province, China.

Yingjian Liang1, Changli Tu1, Cuiyan Tan1, Mohamed Abd El-Gawad El-Sayed Ahmed2,3,4, Min Dai5, Yong Xia6, Yan Liu7, Lan-Lan Zhong2,3, Cong Shen2,3, Guanping Chen2,3, Guo-Bao Tian2,3, Jing Liu1, Xiaobin Zheng1.   

Abstract

PURPOSE: The main objective of this study was to decipher the prevalence, antimicrobial resistance, major virulence genes and the molecular characteristics of methicillin-resistant Staphylococcus aureus (MRSA) isolated from different clinical sources in southern China.
MATERIALS AND METHODS: The present study was performed on 187 non-duplicate S. aureus clinical isolates collected from three tertiary hospitals in Guangdong Province, China, 2010-2016. Antimicrobial susceptibility testing was performed by the disk diffusion method and by measuring the minimum inhibitory concentration. Screening for resistance and virulence genes was performed. Clonal relatedness was determined using various molecular typing methods such as multilocus sequence typing, spa and staphylococcal chromosomal cassette mec (SCCmec) typing. Whole genome sequencing was performed for three selected isolates.
RESULTS: Out of 187 isolates, 103 (55%) were identified as MRSA. The highest prevalence rate was found among the skin and soft tissue infection (SSTI) samples (58/103), followed by sputum samples (25/103), blood stream infection samples (15/103) and others (5/103). Antimicrobial susceptibility results revealed high resistance rates for erythromycin (64.1%), clindamycin (48.5%), gentamicin (36.9%) and ciprofloxacin (33.98%). All isolates were susceptible to vancomycin. Resistance genes and mutation detected were as follows: aac(6')-aph(2") (24.3%), dfrG (10.7%), rpoB (21.4%), cfr (0%), fexA (1.94%), gyrA (35.92%), gyrB (0.97%), grlA (20.4%), grlB (10.68%), ermA (21.4%), ermB (18.44%), ermC (21.4%) and lnuA (18.44%). Profiling of virulence genes revealed the following: sea (11.7%), seb (21.4%), sec (0.97%), sed (0.97%), hla (86.41%), hlb (17.48%), hlg (10.68%), hld (53.4%), Tsst-1 (3.9%) and pvl (27.2%). Clonal relatedness showed that ST239-SCCmecA III-t37 clone was the most prevalent clone.
CONCLUSION: Our study elucidated the prevalence, antibiotic resistance, pathogenicity and molecular characteristics of MRSA isolated from various clinical sources in Guangdong, China. We found that the infectious rate of MRSA was higher among SSTI than other sources. The most predominant genotype was ST239-SCCmecA III-t37 clone, indicating that ST239-t30 clone which was previously predominant had been replaced by a new clone.

Entities:  

Keywords:  MRSA; antibiotic resistance; molecular typing; resistance genes; virulence factors; whole genome sequencing

Year:  2019        PMID: 30881052      PMCID: PMC6394240          DOI: 10.2147/IDR.S192611

Source DB:  PubMed          Journal:  Infect Drug Resist        ISSN: 1178-6973            Impact factor:   4.003


Introduction

Staphylococcus aureus is a highly virulent opportunistic pathogen capable of causing a variety of infections, including skin and soft tissue infection (SSTI), blood stream infection (BSI) and toxin-mediated syndromes as well as life-threatening diseases.1-3 S. aureus, as one of the “ESKAPE” organisms, is a growing threat worldwide, as it can cause a variety of serious nosocomial infections.4 Infections caused by S. aureus are divided into two types: methicillin-sensitive S. aureus (MSSA) and methicillin-resistant Staphylococcus aureus (MRSA), which is also known as oxacillin-resistant S. aureus.5 Recently, MRSA strains have become responsible for about 25%–50% of clinical infections caused by S. aureus in many countries.6 Commonly, the MSSA becomes MRSA via acquisition of large and potentially transmissible genomic islands called staphylococcal chromosomal cassette mec (SCCmec), which harbor mecA/mecC genes. Awareness of the different antibiotic resistance patterns and the molecular characteristics of MRSA can effectively help in the treatment of MRSA infections as well as slowing the epidemic spread of it. MRSA has acquired multiple resistance to a wide range of antibiotics including aminoglycosides. Practically, MRSA was found to be resistant to all available β-lactam antibiotics.3,7 Several reports about the prevalence, molecular characterization and antimicrobial resistance pattern of MRSA in China are available since China represents a country of high prevalence rate of MRSA, especially in Guangdong Province, one of the largest southern coastal provinces which has a large population and is adjoining Hong Kong and Taiwan. However, a large proportion of these reports are mainly focusing on a single source of MRSA infection, ignoring the possibility of MRSA infection from multiple sources. Therefore, our study aims to focus on MRSA isolates collected from different clinical sources.8-16

Materials and methods

Clinical isolates

This cross-sectional study was conducted on a total of 187 non-repetitive S. aureus isolates collected from different clinical specimens in three tertiary hospitals in Guangdong Province, China, denoted as H1, H2 and H3, in the year 2010–2016. All the MRSA isolates were collected from the routine laboratory work of these hospitals. Specimens were collected from different wards including medical ward, surgical ward, intensive care unit and pediatrics department and were recovered from different clinical sources including SSTI, blood, sputum and others (inflamed joint fluid and ascitic fluid). The isolates were identified as S. aureus by using the BD PhoenixTM100 microbial identification system (bioMérieux, Marcy l’Etoile, France). For detection of MRSA, all the identified S. aureus were tested for their antimicrobial susceptibility by disk diffusion technique using cefoxitin (FOX; 30 µg) according to the Clinical and Laboratory Standards Institute (CLSI, 2017) guidelines. Then mecA gene was detected by PCR as previously described.17 The samples positive for the mecA gene and resistant to FOX were identified as MRSA.

DNA extraction

All the samples were cultured on Mueller–Hinton agar plates at 33°C overnight. Then, a single bacterial colony was suspended onto 3 mL of sterile lysogeny broth medium (Oxoid, Hampshire, UK) and subsequently incubated at 33°C with vigorous shaking for 8 hours. Then, DNA was extracted using Hipure bacterial DNA kit (Magen, Guangzhou, China) according to the manufacturer’s instructions.

Antimicrobial susceptibility and minimum inhibitory concentration (MIC) determination

In vitro antimicrobial susceptibility of MRSA isolates was determined by modified Kirby–Bauer disk diffusion method according to the CLSI 2017 guidelines. Antimicrobial drugs tested included: penicillin (P), FOX, rifampicin (RFD), quinupristin/dalfopristin (Q/D) and trimethoprim–sulfamethoxazole (SXT). MIC was detected by broth microdilution method and interpreted according to the CLSI 2017 guidelines for erythromycin (ERY), clindamycin (CLI), gentamicin (GEN), ciprofloxacin (CIP), chloramphenicol (CHL), nitrofurantoin (NIT) and vancomycin (VAN). Tigecycline (TGC) was evaluated using MICs according to the European Committee on Susceptibility Testing guidelines (version 1.3, 2010; Basel, Switzerland).

Molecular detection of antibiotic resistance genes

Isolates were screened for the production of the common resistance genes and mutation for different antimicrobial classes by PCR as follows: RFD (rpoB), CHL (cfr and fexA), aminoglycosides (acc(6′)-aph(2″)), macrolides (ermA, ermB and ermC), lincosamides (lnuA), SXT (dfrG) and fluoroquinolones (gyrA, gyrB, grlA and grlB).14,18–22 Purified positive PCR products were sequenced using BigDye terminator chemistry on an automated ABI 3130 sequencer (PE Applied Biosystems, Foster City, CA, USA) based on Sanger’s sequencing method. Gene sequences were corrected using CodonCode Aligner version 7.1.2. sequencing analysis software and then analyzed using BlastN and BlastP against the National Center for Biotechnology Information database (www.ncbi.nlm.nih.gov).

Detection of virulence factors

Detection of virulence genes was performed among MRSA isolates. Ten exotoxins coding gene, including four enterotoxins (sea, seb, sec and sed), four hemolysin toxins (hla, hlb, hld and hlg), toxic shock syndrome toxin (tsst-1) and Panton–Valentine leukocidin (pvl) were amplified by multiplex PCR as previously described.2

Molecular typing of MRSA

All the MRSA strains were typed by three different molecular characterization methods as follows: SCCmec, spa type and multilocus sequence typing (MLST). In the SCCmec typing, MRSA strains were identified as SCCmec type I, II, III, IV or V by performing PCR using nine pairs of primers and the primers for the mecA gene as previously described.17 The SCCmec types were determined on the basis of the band pattern obtained. Spa typing was performed according to the website https://spa.ridom.de/. The isolates were assigned to the specific spa types according to the guidelines described by the publicly available Center of Genomic Epidemiology (https://cge.cbs.dtu.dk/services/spaTyper-1.0/).23 MLST was performed based on seven housekeeping genes (arcC, aroE, glpF, gmK, pta, tpiA and yqiL) obtained from the MLST database as previously described.24 Isolates were assigned sequence types (STs) according to the MLST database (http://saureus.mlst.net).

Whole genome sequencing (WGS)

WGS was performed for three selected isolates, QY152, L2316 and L2317. QY152 was selected for its relatedness to ST398, which is not common in China, but common in Europe. Both L2316 and L2317 were selected for their TGC resistance (the only two TGC-resistant isolates) as well as their relatedness to ST9. The ST398 isolate (SO385, GenBank: AM990992) was used as a reference strain for comparative genomics. The resulting draft genomes were described. DNA libraries were constructed with 350 bp paired-end fragments. The isolate reads were produced by Illumina Hiseq2000 platform. Reads were assembled using SPAdes. The genome annotation was performed using PROKKA, E-value setting as 1e−5 25 and Rapid Annotations Subsystems Technology. Bacteriophages detection was performed using PHAge Search Tool.26 Antimicrobial resistance genes were identified using the Comprehensive Antibiotic Resistance Database (https://card.mcmaster.ca/) and the virulence factors were screened using the Virulence Factors Database (http://www.mgc.ac.cn/VFs/). This Whole Genome Shotgun project of the three selected isolates has been deposited at GenBank under the following accession numbers: RDQU000000, RDQT000000 and RDQS000000, respectively.

Statistical analysis

Statistical analysis for resistance and virulence genes as well as for the resistance rates to the tested antibiotics among our MRSA was performed using chi-squared test (SPSS version 20). P-values <0.01 were considered statistically significant.

Results

MRSA identification

Among 187 identified S. aureus samples, 103 (55.1%) were confirmed as MRSA depending on mecA gene and resistance to FOX. The majority of these MRSA (58/103, 56.31%) were recovered from SSTI, followed by sputum (25/103, 24.3%), BSI (15/103, 14.6%) and others (5/103, 4.9%), as shown in Table 1.
Table 1

Prevalence and resistance pattern of MRSA isolates

Clinical sample (N=103)HospitalsResistance pattern (%)
IsolatesH1H2H3PFOXDASXTRFDTGCGENVANCLIERYCHLCIPNITMDR
SSTI (58, 56.3%)11, 18.97%047, 81.03%58, 100%5, 100%5, 8.62%4, 6.9%10, 17.24%1, 1.72%8, 12.07%a031, 53.45%34, 58.62%9, 15.51%7, 12.07%a030, 51.72%a
Sputum (25, 24.3%)24, 96%1, 4%025, 100%25, 100%3, 12%4, 16%7, 28%1, 4%24, 96%b011, 44%20, 80%0%21, 84%b024, 96%b
BSI (15, 14.6%)2, 13.33%1, 6.67%12, 80%15, 100%15, 100%1, 6.67%3, 20%1, 6.67%0%4, 26.67%a06, 40%7, 46.67%2, 13.33%5, 33.33%a09, 60%a
Others (5, 4.9%)3, 60%02, 40%5, 100%5, 100%00%1, 20%0%2, 40%a02, 40%5, 100%1, 20%2, 40%a,b05, 100%a,b
Total40, 38.83%2, 1.94%61, 59.22%103, 100%103, 100%9, 8.74%11, 10.68%19, 18.45%2, 1.94%38, 36.89%050, 48.54%66, 64.07%12, 11.65%35, 33.98%068, 66.02%
P-value0.9270.2870.3710.685<0.010.7340.0390.731<0.01<0.01

Note:

Each subscript letter denotes a subset of group categories whose column proportions do not differ significantly from each other at the 0.01 level.

Abbreviations: BSI, blood stream infection; CHL, chloramphenicol; CIP, ciprofloxacin; CLI, clindamycin; ERY, erythromycin; FOX, cefoxitin; GEN, gentamicin; MDR, mutidrug resistance; MRSA, methicillin-resistant Staphylococcus aureus; NIT, nitrofurantoin; RFD, rifampicin; SSTI, skin and soft tissue infection; SXT, trimethoprim– sulfamethoxazole; TGC, tigecycline; VAN, vancomycin.

Antimicrobial susceptibility testing

All MRSA isolates were found to be resistant to penicillin and FOX, while all were susceptible to VAN and NIT. Some of the tested antimicrobials revealed high resistance pattern, including ERY (66/103, 64.1%), CLI (50/103, 48.5%), GEN (38/103, 36.9%) and CIP (35/103, 33.98%), while others presented relatively low resistance rates, including RFD (19/103, 18.5%), CHL (12/103, 11.65%), SXT (11/103, 10.7%), Q/D (9/103, 8.74%) and TGC (2/103, 1.94%). All the isolates were found to be resistant to at least two antibiotics, and 68/103 (66.2%) were multidrug resistant (MDR), exhibiting resistance to three or more antibiotic classes, where 44.12% (30/68) of MDR isolates were recovered from SSTI, 35.3% (24/68) from sputum, 13.2% (9/68) from BSI and 7.4% (5/68) from other sites. The resistance rates of GEN, ERY, CIP, RFD and Q/D were found to be higher in sputum than in SSTI or BSI; however, statistically differences were only found in GEN and CIP (P<0.01, Table 1; Figure 1).
Figure 1

Percentages of antibiotic resistance rates of MRSA isolated from various clinical sources.

Abbreviations: BSI, blood stream infection; CHL, chloramphenicol; CIP, ciprofloxacin; CLI, clindamycin; ERY, erythromycin; FOX, cefoxitin; GEN, gentamicin; MRSA, methicillin-resistant Staphylococcus aureus; NIT, nitrofurantoin; P, penicillin; RFD, rifampicin; SSTI, skin and soft tissue infection; SXT, trimethoprim–sulfamethoxazole; TGC, tigecycline; VAN, vancomycin.

PCR amplification and sequencing of antibiotic resistance genes

Screening for fluoroquinolone resistance-encoding genes revealed the presence of gyrA (37/103, 35.92%), gyrB (1/103, 1.94%), grlA (21/103, 20.4%) and grlB (11/103, 10.68%), as shown in Table S1. Macrolide-encoding resistance genes detected were as follows: ermA (22/103, 21.4%), ermB (19/103, 18.44%) and ermC (22/103, 21.4%). Aac(6′)-aph(2″) gene which is correlated with GEN resistance was detected in 25/103 (24.3%) of MRSA. Regarding CHL, fexA (2/103, 1.94%) was detected, while no cfr was found, indicating the low antimicrobial resistance rate of MRSA to CHL. The rpoB gene was detected in 22/103 (21.4%) isolates, lnuA gene in 19/103 (18.44%) isolates, while dfrG was detected in 11/103 (10.7%) of MRSA isolates (Table 2).
Table 2

Resistance pattern and virulence genes of MRSA isolates from different clinical sources

Clinical sample (N=103)Resistance genes and mutation (%)Virulence genes (%)
aac6-aph2dfrGrpoBcfrfexAgyrAgyrBgrlAgrlBermAermBermClnuAseasebsecsedhlahlbhldhlgTsst-1Pvl
SSTI (58, 56.3%)4, 6.9%a4, 6.9%11, 8.97%01, 1.7%8, 13.8%a0, 0a5, 8.6%a2, 3.44%a5, 8.6%a13, 22.4%a,b12, 20.7%12, 20.7%a,b7, 12.1%18, 31.03%a01, 1.7%44, 75.9%9, 15.5%26, 44.8%5, 8.6%2, 3.44%25, 43.10%c
Sputum (25, 24.3%)18, 72%b5, 20%9, 36%01, 4%21, 84%b1, 4%b14, 56%b7, 28%b14, 56%b0b8, 32%0b3, 12%0, 0%b0025, 100%4, 16%23, 92%6, 24%1, 4%0a
BSI (15, 14.6%)3, 20%a2, 13.3%1, 6.7%006, 40%a0, 0%a2, 13.3%a2, 13.3%a,b2, 13.3%a4, 26.7%a05, 33.3%a1, 6.7%4, 26.7%a0015, 100%3, 20%3, 20%001, 6.7%a,b
Others (5, 4.9%)0a01, 20%002, 40%a,b0, 0%a,b0, 0%a,b0a,b1, 20%a,b2, 40%a2, 40%2, 40%a1, 20%0, 0%a,b1, 20%05, 100%2, 40%3, 60%01, 4%2, 40%b,c
Total25, 24.3%11, 10.7%22, 21.4%02, 1.94%37, 35.92%1, 0.97%21, 20.4%11, 10.68%22, 21.4%19, 18.5%22, 21.4%19, 18.5%12, 11.7%22, 21.4%1, 0.97%1, 0.97%89, 86.4%18, 17.5%55, 53.4%11, 10.7%4, 3.9%28, 27.2%
P-value<0.010.2750.1510.685<0.010.437<0.01<0.01<0.010.01020.042<0.010.797<0.010.1941<0.010.51<0.010.0950.31<0.01

Note:

Each subscript letter denotes a subset of group categories whose column proportions do not differ significantly from each other at the 0.01 level.

Abbreviations: BSI, blood stream infection; MRSA, methicillin-resistant Staphylococcus aureus; SSTI, skin and soft tissue infection.

Virulence genes profiling

Multiplex PCR revealed that 97/103 (94.2%) MRSA isolates were harboring virulence genes, including four enterotoxin genes, sea (12/103, 11.7%), seb (22/103, 21.4%), sec (1/103, 0.97%) and sed (1/103, 0.97%), and six exotoxin genes, whereas for hemolysin toxins (hla, hlb, hlg and hld), results revealed that hla gene was the highest detected gene that was harbored by 89/103 isolates (86.41%), followed by hld (55/103, 53.4%), hlb (18/103, 17.48%) and hlg (11/103, 10.68%). The majority of hla-positive strains were recovered from SSTI (44/89, 49.4%) followed by sputum (25/89, 28.1%), BSI (15/89, 16.85%) and others (5/89, 5.62%). Concerning tsst-1 gene, it was harbored by 4/103 isolates (3.9%). PCR assay for detection of pvl gene showed that 28/103 (27.2%) MRSA were pvl positive and the majority of them were isolated from SSTI (25/28, 89.3%; Table 2). Results of SCCmec typing indicated that five types of SCCmec elements were detected. Type III was the most predominant (39/103, 37.86%) followed by type IV (17/103, 16.5%), wherein the majority of isolates belonged to type IVa (15/17 88.2%) then type IVb (2/17, 11.8%). The prevalence of SCCmec types II and V was very low (2/103, 1.94% and 1/103, 0.97%, respectively), while no isolates belonging to type I were found. Out of 103 MRSA isolates, 44 (42.7%) were classified as non-typable MRSA. The majority of the isolates harboring hla gene (37/89, 41.57%) were found to be belonging to SCCmec type III, followed by type IV (12/89, 13.48%), type II (2/89, 2.24%) and type V (1/89, 1.12%), while 36/89 (40.44%) of them were found to be associated with non-typable MRSA. Tsst-1 gene was associated with SCCmec type II (2/4, 50%). Regarding PVL-positive isolates, 16/28 (57.1%) isolates belonged to the predominant SCCmec type III. Spa typing revealed a diverse range of spa types, wherein 25 types were detected among MRSA. t437 (22/103, 21.4%) was the most predominant type, followed by t37 (18/103, 17.5%). The remaining spa types were distributed homogeneously among MRSA isolates. Also, 17/103 (16.5%) of MRSA isolates were not identified in the spa database (Table S2). According to the MLST typing, MRSA isolates were assigned to 23 different STs; also, 18 novel STs were detected and deposited in the database of PubMLST (https://pubmlst.org/saureus/), as shown in Table S2. ST239 was the most prevalent among our isolates (24/103, 23.3%), followed by ST338 (18/103, 17.5%). ST239 was mainly distributed in H1, while ST338 was circulating in H3. It is noteworthy that 65 different clones have been detected where ST239-SCCmecA III-t37 clone was found to be the most predominant genotype circulating in H1 and H2 (9/103, 8.7%), followed by ST338-SCCmecA III-t437 (6/103, 5.83%), which was found to be circulating mainly in H3. Isolates harboring hla gene were related to different clones, while the majority were associated with ST338 (13/89, 14.61%) and t437 (16/89, 17.97%). Of the 28/103 isolates harboring pvl gene, 7/28 (25%) isolates belonged to ST338-SCCmecA III-t437 clone. The tsst-1 gene (4/103) was associated with ST1, ST72, ST641 and ST863 (Figure 2).
Figure 2

Phylogenetic tree of 103 MRSA isolates.

Notes: A maximum likelihood phylogeny was used of every MRSA isolate. Strain names are color-coded based on the hospital: blue is hospital 1, black is hospital 2 and red is hospital 3. The main molecular types are shown in various colors as shown in the legend. The inner bar indicates the main SCCmecA and the outer bar indicates the main spa types. Main STs are indicated by the middle bar.

Abbreviations: MRSA, methicillin-resistant Staphylococcus aureus; SCCmec, staphylococcal chromosomal cassette mec; ST, sequence type.

Whole genome sequencing

WGS was performed for three selected isolates (QY152, L2316 and L2317). QY152 was found to be harboring six resistance genes and two common virulence factors: hemolysin and adhesin. The mepA and mepR genes were detected among the TGC-resistant isolates (Table 3).
Table 3

General characteristics of the genomes of QY152, L2316 and L2317 in comparison with SO385

Elements and characteristicsSO385aQY152L2316L2317
Chromosome
Size (bp)2,872,5822,715,9792,799,4722,792,378
G + C content (%)32.932.832.732.7
tRNA gene59575757
rRNA operon6876
Protein-coding genes2,6992,5022,6592,592
Insertion sequences12655
Bacteriophages2132
Plasmids3000
Resistance genescopA, tet(M), tet(K), strblaZ, ermC, norA, mepA, tet(38), sav1866blaZ, ermC, norA, mepA, tet(38), sav1866, tet(L), ant(4)-Ib, aac(6)-aph(2), fosB, dfrG, fexAblaZ, ermC, norA, mepA, tet(38), sav1866, tet(L), ant(4)-Ib, aac(6)-aph(2), fosB, dfrG, fexA
Virulence factorsνSaβ, NWMN0280Hemolysin, adhesin, staphostatin B and othersHemolysin, adhesin, aur and othersHemolysin, adhesin, aur and others

Note:

SO385 livestock-associated MRSA (ST398 isolate) from the Netherlands. GenBank: AM990992.

Abbreviation: MRSA, methicillin-resistant Staphylococcus aureus.

Discussion

As a clinically important drug-resistance pathogen, MRSA can cause a variety of infections, including SSTI, respiratory tract infection, BSI and others. Herein, we investigated the prevalence, antibiotic resistance, virulence factors and the molecular characteristics of MRSA isolated from different clinical sources as shown in Table 1. The prevalence of MRSA in the present study was high. However, the prevalence among SSTI was much lower than that reported from a burn center in southeastern China in 2014–2015,16 but was consistent with that reported in a study from Taiwan in 2008.27 The prevalence of our MRSA isolates in BSI was lower than those reported from China in 2016 and Latin America in 2011–2014.28,29 The detection rate of MRSA among our sputum samples was much higher than that reported from Dongguan and Shenzhen, two cities of Guangdong Province,12,30 but much lower than that reported in a multicenter study in China from 2007 to 2009.31 Among our isolates, high drug resistance was observed. More than half of the isolates were MDR, which mostly came from sputum and SSTI and were found related to ST239 (23/24) and ST1016 (7/8). The high MDR problem of ST239-SCCmecA III-t37/t30 clone is still extremely serious. The MDR rate in our study was a little lower than that reported in a previous study in Beijing Children’s Hospital, China.32 We believe that different clinical samples show differences in developing drug resistance, which is attributed to the different selection processes. However, in contrast to our hypothesis, the antimicrobial resistance rate among our MRSA isolates did not show a statistical difference, except for CIP and GEN, where acc(6′)-aph(2″), gyrA, gyrB, grlA and grlB were found to be more prevalent among sputum samples (P<0.01). We hypothesized that the reason was that fluoroquinolones were often used in pneumonia, which may increase the resistance rate.33,34 According to the US Food and Drug Administration black box, TGC was a last-line agent for MRSA infections until September 2010.36 In the present study, TGC resistance was very low (2/103, 1.94%), similar to that reported in a study from Zhejiang Province. The rate of TGC resistance in China is still low, but the number of MRSA isolates resistant to TGC is actually growing.35 Here, WGS revealed the occurrence of the efflux protein coding gene mepA among the whole genome analyzed sequences, which was found to be related to decreasing the susceptibility to TGC. MepA is rarely reported in China, while it is more prevalent in African countries.37,38 Regarding the virulence genes, our study showed relatively similar findings for sea, seb, sec, sed, tsst-1, pvl and hla with those reported of a burn center in southeastern China.16 Isolates recovered from SSTI were associated with >15 types of MLST and spa types, which indicated high diversity and complexity in their genetic background. Our results were consistent with those reported in a multicenter study of SSTI in China39 where the predominant spa type was t437. In the present study, ST338-t437 was the predominant clone, which is inconsistent with other studies which revealed that ST59-t437 clone was predominant.28 However, it has been reported that both ST338-t437 and ST59-t437 belonged to the same clonal complex (CC59), where ST59 was the predominant ST, while single-locus variants belonging to ST338 were obtained.40 Therefore, we could probably suppose that ST239-t30 clone which was predominant in 2013 had been gradually replaced by ST338-t437 or ST59-t437. Our results were similar to those of a study conducted in Wenzhou, China from 2012 to 2013 in which all the isolates belonging to CC59 were susceptible to NIT, Q/D and SXT; however, 81.8% of them were resistant to ERY and CLI.41 Noteworthy, two of our isolates recovered from SSTI at the same hospital were found to be belonging to ST398, which has been known as a livestock-associated MRSA (LA-MRSA) clone.42 In previous studies, it was reported that most of the LA-MRSA isolates in Asia belonged to ST9, while ST398-related isolates were mainly reported in European and North American countries.43,44 Generally, due to the lack of several common virulence factors, the ST398 MRSA in Europe did not cause the frequent invasive diseases in humans.45 However, a recent report indicated that the Chinese LA-MRSA ST398 isolates are far different from those of other continents, because they likely evolved from human-adapted MSSA.46 Recently, a report about the emergence of ST398 in a pig farm in Guangdong, China was published,13 which indicated the transmission of this clone between different continents. Therefore, we supposed that the two isolates belonging to ST398 may be transmitted via livestock, which is in accordance with other reports that showed the possibility of transmission of ST398 from the animal reservoir to humans.28,47,48 Also, since the source of infection was SSTI, we can conclude that the possible way of transmission of MRSA was via skin contact with the livestock, which requires certain precautions. Among the sputum clinical samples, 6/25 (24%) of MRSA belonged to t1081 type, which is supposed to be more prevalent in long-term care facilities (LTCFs).49 Several reports indicated that t1081 had spread from the Netherlands to Hong Kong and Taiwan.50–54 The present study was done in Guangdong, which is a province located near Taiwan and Hong Kong; therefore, presumably, t1081 might not only be introduced from LTCF residents to hospitalized patients, but also from Hong Kong and Taiwan to Mainland China.

Conclusion

In conclusion, our study elucidated and gave insight on the high prevalence of MRSA in southern China, especially from SSTI and sputum clinical samples. Notably, GEN and CIP should be used carefully in respiratory tract infections with MRSA and rational use of antibiotics should be undertaken to slow the epidemic spread of MDR in China. Our study also showed that ST239-SCCmecA III-t37 clone was the most prevalent among our isolates, indicating that ST239-t30 clone, which was previously predominant worldwide, had been replaced by a new clone, providing confirmation that clonal replacement is persistent. Mutation of gyrA, gyrB, grlA and grlB among MRSA isolates from different sources Note: Reference: GenBank: AASB02000026.1 (gyrA/gyrB), GenBank: AKYW15.1 (grlA/grlB). Abbreviation: MRSA, methicillin-resistant Staphylococcus aureus. MLST, SCCmec types and spa types of MRSA isolates from different sources Abbreviations: BSI, blood stream infection; MLST, multilocus sequence typing; MRSA, methicillin-resistant Staphylococcus aureus; SCCmec, staphylococcal chromosomal cassette mec; SSTI, skin and soft tissue infection.
Table S1

Mutation of gyrA, gyrB, grlA and grlB among MRSA isolates from different sources

No.gyrAgyrBgrlAgrlB
QY3C251T (Ser84Leu)///
QY35C251T (Ser84Leu)///
QY56G317A (Phe106Tyr)///
QY110C251T (Ser84Leu)///
L2301C251T (Ser84Leu)///
L2303C251T (Ser84Leu), T290A (Met90Lys)///
L2307C251T (Ser84Leu)///
L2308C251T (Ser84Leu)///
L2309C251T (Ser84Leu)/G253A (Arg85Gln)/
L2311C251T (Ser84Leu)/C242T (Ser81Phe)/
L2312C251T (Ser84Leu)/T138G (Ile46Met)A1266T (Glu422Asp)
L2313C251T (Ser84Leu)/C242T (Ser81Phe), G253A (Arg85Gln)/
L2314C251T (Ser84Leu)///
L2315C251T (Ser84Leu)///
L2316T250G (Ser84Ala)/C242T (Ser81Phe)/
L2317T250G (Ser84Ala)/C242T (Ser81Phe)/
L2318C251T (Ser84Leu)/G253A (Arg85Gln)/
L2319C251T (Ser84Leu)//G1294A (Asp432Asn)
L2320C251T (Ser84Leu)//C1351T (Pro451Leu)
L2321C251T (Ser84Leu)/C242T (Ser81Phe)/
L2322C251T (Ser84Leu), G317A (Phe106Tyr)/C242T (Ser81Phe)G1294A (Asp432Asn)
L2323C251T (Ser84Leu)/C242T (Ser81Phe)/
L2325C251T (Ser84Leu)/G253A (Arg85Gln)/
L2326C251T (Ser84Leu)/C242T (Ser81Phe)C1351T (Pro451Leu)
L2327C251T (Ser84Leu), G317A (Phe106Tyr)/G253A (Arg85Gln)/
L2328C251T (Ser84Leu)/G253A (Arg85Gln)/
L2330C251T (Ser84Leu)///
L2331C251T (Ser84Leu), T253C (Ser85Pro)///
L2332C251T (Ser84Leu)/G253A (Arg85Gln)/
L2335C251T (Ser84Leu)///
L2336C251T (Ser84Leu)/C242T (Ser81Phe)A1266T (Glu422Asp), C1387A, T1389A (Gly463Arg)
L2337C251T (Ser84Leu)/C242T (Ser81Phe)C1351T (Pro451Leu)
L2338C251T (Ser84Leu)/C242T (Ser81Phe)G1294A (Asp432Asn)
L2343C251T (Ser84Leu), G317A (Phe106Tyr)/C242T (Ser81Phe)G1294A (Asp432Asn)
L2344C251T (Ser84Leu)/G253A (Arg85Gln)/
L2503C251T (Ser84Leu), A263T (Glu88Asp), G286A, A287C, T288A (Asp96Thy)//C1282T (Ser428Phe), C1330A, C1332A (Leu444Ile), A1346T (Tyr449Phe), T1358A (Val453Asp), C1387A, T1389A (Gly463Arg)
L2508C251T (Ser84Leu)G1390A (Val464Ile)C242T (Ser81Phe)G1294A (Asp432Asn)

Note: Reference: GenBank: AASB02000026.1 (gyrA/gyrB), GenBank: AKYW15.1 (grlA/grlB).

Abbreviation: MRSA, methicillin-resistant Staphylococcus aureus.

Table S2

MLST, SCCmec types and spa types of MRSA isolates from different sources

Molecular typingTotal n (%)SSTI n (%)Sputum n (%)BSI n (%)Others n (%)
SCCmec
 I00000
 II2 (1.94)01 (4)01 (20)
 III39 (37.86)17 (29.31)16 (64)4 (26.67)2 (40)
 IV17 (16.5)14 (24.14)1 (4)2 (13.33)0
 a15 (88.24)13 (22.41)2 (13.33)0
 b2 (11.76)1 (1.72)1 (4)00
 c00000
 d00000
 V1 (0.97)01 (4)00
 No type44 (42.72)27 (26.21)6 (24)9 (60)2 (40)
MLST
 23924 (23.30)7 (12.07)14 (56)2 (13.33)1 (20)
 33818 (17.48)16 (27.59)01 (6.67)1 (20)
 598 (7.77)5 (8.62)03 (20)0
 10618 (7.77)2 (3.44)6 (24)00
 883 (2.91)2 (3.44)01 (6.67)0
 452 (1.94)2 (3.44)000
 3982 (1.94)2 (3.44)000
 9652 (1.94)1 (1.72)01 (6.67)0
 11 (0.97)1 (1.72)000
 51 (0.97)1 (1.72)000
 61 (0.97)1 (1.72)000
 92 (1.94)1 (1.72)1 (4)00
 101 (0.97)1 (1.72)000
 301 (0.97)1 (1.72)000
 721 (0.97)1 (1.72)000
 1881 (0.97)001 (6.67)0
 6301 (0.97)1 (1.72)000
 6411 (0.97)0001 (20)
 8631 (0.97)01 (4)00
 8891 (0.97)01 (4)00
 21481 (0.97)001 (6.67)0
 31881 (0.97)1 (1.72)000
 48601 (0.97)1 (1.72)000
 49401 (0.97)0001 (20)
 49421 (0.97)1 (1.72)000
 49431 (0.97)01 (4)00
 49441 (0.97)01 (4)00
 49451 (0.97)001 (6.67)0
 49461 (0.97)001 (6.67)0
 49471 (0.97)001 (6.67)0
 49482 (1.94)1 (1.72)000
 49491 (0.97)1 (1.72)000
 49571 (0.97)001 (6.67)0
 49581 (0.97)2 (3.44)000
 49591 (0.97)1 (1.72)000
 49602 (1.94)2 (1.72)000
 49611 (0.97)0001 (20)
 49621 (0.97)1 (1.72)000
 49631 (0.97)1 (1.72)000
 49641 (0.97)1 (1.72)000
 49651 (0.97)001 (6.67)0
spa
 t43722 (21.36)19 (32.76)1 (4)2 (13.33)0
 t3718 (17.48)6 (10.34)9 (36)2 (13.33)1 (20)
 t306 (5.83)1 (1.72)4 (16)1 (6.67)0
 t10816 (5.83)06 (24)00
 t1894 (3.88)2 (3.44)02 (13.33)0
 t4414 (3.88)2 (3.44)01 (6.67)1 (20)
 t623 (2.91)1 (1.72)01 (6.67)1 (20)
 t1163 (2.91)3 (5.17)000
 t342 (1.94)2 (3.44)000
 t8992 (1.94)1 (1.72)1 (4)00
 t140342 (1.94)1 (1.72)01 (6.67)0
 t21 (0.97)0001 (20)
 t191 (0.97)1 (1.72)000
 t1141 (0.97)1 (1.72)000
 t4211 (0.97)01 (4)00
 t7011 (0.97)1 (1.72)000
 t12121 (0.97)1 (1.72)000
 t12441 (0.97)1 (1.72)000
 t23581 (0.97)1 (1.72)000
 t35231 (0.97)1 (1.72)000
 t55541 (0.97)1 (1.72)000
 t64971 (0.97)1 (1.72)000
 t77071 (0.97)001 (6.67)0
 t120111 (0.97)0000
 t174031 (0.97)01 (4)00
 Not available17 (16.5)10 (17.24)2 (8)4 (26.67)1 (20)

Abbreviations: BSI, blood stream infection; MLST, multilocus sequence typing; MRSA, methicillin-resistant Staphylococcus aureus; SCCmec, staphylococcal chromosomal cassette mec; SSTI, skin and soft tissue infection.

  53 in total

1.  Preliminary molecular epidemiology of the Staphylococcus aureus in lower respiratory tract infections: a multicenter study in China.

Authors:  De-Zhi Li; Yu-Sheng Chen; Jing-Ping Yang; Wei Zhang; Cheng-Ping Hu; Jia-Shu Li; Lan Mu; Ying-Hui Hu; Rong Geng; Ke Hu; Shao-Xi Cai; Huan-Ying Wan; Qiu-Yue Wang; Li-Ping Wei; Juan DU; Qin Yu; Xiao-Ning Zhong; Rui-Qin Wang; Jian-Jun Ma; Gui-Zhen Tian; Si-Qin Wang; Zhan-Cheng Gao
Journal:  Chin Med J (Engl)       Date:  2011-03       Impact factor: 2.628

2.  Guidelines for the management of adults with hospital-acquired, ventilator-associated, and healthcare-associated pneumonia.

Authors: 
Journal:  Am J Respir Crit Care Med       Date:  2005-02-15       Impact factor: 21.405

3.  Novel multiplex PCR assay for characterization and concomitant subtyping of staphylococcal cassette chromosome mec types I to V in methicillin-resistant Staphylococcus aureus.

Authors:  Kunyan Zhang; Jo-Ann McClure; Sameer Elsayed; Thomas Louie; John M Conly
Journal:  J Clin Microbiol       Date:  2005-10       Impact factor: 5.948

4.  Distribution of florfenicol resistance genes fexA and cfr among chloramphenicol-resistant Staphylococcus isolates.

Authors:  Corinna Kehrenberg; Stefan Schwarz
Journal:  Antimicrob Agents Chemother       Date:  2006-04       Impact factor: 5.191

5.  The prevalence of aminoglycoside resistance and corresponding resistance genes in clinical isolates of staphylococci from 19 European hospitals.

Authors:  F J Schmitz; A C Fluit; M Gondolf; R Beyrau; E Lindenlauf; J Verhoef; H P Heinz; M E Jones
Journal:  J Antimicrob Chemother       Date:  1999-02       Impact factor: 5.790

6.  Virulence and resistance determinants of German Staphylococcus aureus ST398 isolates from nonhuman sources.

Authors:  M A Argudín; B-A Tenhagen; A Fetsch; J Sachsenröder; A Käsbohrer; A Schroeter; J A Hammerl; S Hertwig; R Helmuth; J Bräunig; M C Mendoza; B Appel; M R Rodicio; B Guerra
Journal:  Appl Environ Microbiol       Date:  2011-03-04       Impact factor: 4.792

7.  Prevalence of resistance to macrolide, lincosamide and streptogramin antibiotics in Gram-positive cocci isolated in a Korean hospital.

Authors:  Jung-A Lim; Ae-Ran Kwon; Sook-Kyung Kim; Yunsop Chong; Kungwon Lee; Eung-Chil Choi
Journal:  J Antimicrob Chemother       Date:  2002-03       Impact factor: 5.790

8.  A novel MATE family efflux pump contributes to the reduced susceptibility of laboratory-derived Staphylococcus aureus mutants to tigecycline.

Authors:  Fionnuala McAleese; Peter Petersen; Alexey Ruzin; Paul M Dunman; Ellen Murphy; Steven J Projan; Patricia A Bradford
Journal:  Antimicrob Agents Chemother       Date:  2005-05       Impact factor: 5.191

9.  Multilocus sequence typing for characterization of methicillin-resistant and methicillin-susceptible clones of Staphylococcus aureus.

Authors:  M C Enright; N P Day; C E Davies; S J Peacock; B G Spratt
Journal:  J Clin Microbiol       Date:  2000-03       Impact factor: 5.948

10.  Whole genome analysis of a livestock-associated methicillin-resistant Staphylococcus aureus ST398 isolate from a case of human endocarditis.

Authors:  Maarten J Schijffelen; C H Edwin Boel; Jos A G van Strijp; Ad C Fluit
Journal:  BMC Genomics       Date:  2010-06-14       Impact factor: 3.969

View more
  12 in total

1.  Molecular Characteristics, Antimicrobial Resistance and Virulence Gene Profiles of Staphylococcus aureus Isolates from Wuhan, Central China.

Authors:  Yu Fu; Mengyuan Xiong; Xuehan Li; Junying Zhou; Xiao Xiao; Fang Fang; Xiaohuan Cheng; Yingbang Le; Yirong Li
Journal:  Infect Drug Resist       Date:  2020-06-30       Impact factor: 4.003

2.  Genomic Investigation of Methicillin-Resistant Staphylococcus aureus ST113 Strains Isolated from Tertiary Care Hospitals in Pakistan.

Authors:  Nimat Ullah; Hamza Arshad Dar; Kanwal Naz; Saadia Andleeb; Abdur Rahman; Muhammad Tariq Saeed; Fazal Hanan; Taeok Bae; Amjad Ali
Journal:  Antibiotics (Basel)       Date:  2021-09-17

3.  Community-associated Staphylococcus aureus PVL+ ST22 predominates in skin and soft tissue infections in Beijing, China.

Authors:  Nan Xiao; Jianghui Yang; Ning Duan; Binghuai Lu; Lijun Wang
Journal:  Infect Drug Resist       Date:  2019-08-12       Impact factor: 4.003

4.  Distribution of virulence genes and SCCmec types among methicillin-resistant Staphylococcus aureus of clinical and environmental origin: a study from community of Assam, India.

Authors:  Deepshikha Bhowmik; Shiela Chetri; Bhaskar Jyoti Das; Debadatta Dhar Chanda; Amitabha Bhattacharjee
Journal:  BMC Res Notes       Date:  2021-02-10

5.  Staphylococcus aureus ST59: Concurrent but Separate Evolution of North American and East Asian Lineages.

Authors:  Jo-Ann McClure; Sahreena Lakhundi; Amani Niazy; George Dong; Osahon Obasuyi; Paul Gordon; Sidong Chen; John M Conly; Kunyan Zhang
Journal:  Front Microbiol       Date:  2021-02-10       Impact factor: 5.640

6.  Trend in Antimicrobial Resistance of Staphylococcus aureus: Results from the China Antimicrobial Surveillance Network (CHINET) in the Last 15-Year-Period Reports (2005-2019).

Authors:  Yingjian Liang; Lidi Qiu; Xiaobin Zheng; Jing Liu
Journal:  Infect Drug Resist       Date:  2021-06-10       Impact factor: 4.003

7.  Antibiotic susceptibility of human-associated Staphylococcus aureus and its relation to agr typing, virulence genes, and biofilm formation.

Authors:  Safoura Derakhshan; Masoumeh Navidinia; Fakhri Haghi
Journal:  BMC Infect Dis       Date:  2021-07-01       Impact factor: 3.090

8.  Prevalence of fosfomycin resistance and gene mutations in clinical isolates of methicillin-resistant Staphylococcus aureus.

Authors:  Yi-Chien Lee; Pao-Yu Chen; Jann-Tay Wang; Shan-Chwen Chang
Journal:  Antimicrob Resist Infect Control       Date:  2020-08-17       Impact factor: 4.887

9.  Antimicrobial and Antivirulence Action of Eugenia brejoensis Essential Oil in vitro and in vivo Invertebrate Models.

Authors:  Clovis Macêdo Bezerra Filho; Luís Cláudio Nascimento da Silva; Márcia Vanusa da Silva; Anders Løbner-Olesen; Carsten Struve; Karen Angeliki Krogfelt; Maria Tereza Dos Santos Correia; Maria Luiza Vilela Oliva
Journal:  Front Microbiol       Date:  2020-03-19       Impact factor: 5.640

10.  Virulence Factor Genes and Antimicrobial Susceptibility of Staphylococcus aureus Strains Isolated from Blood and Chronic Wounds.

Authors:  Anna Budzyńska; Krzysztof Skowron; Agnieszka Kaczmarek; Magdalena Wietlicka-Piszcz; Eugenia Gospodarek-Komkowska
Journal:  Toxins (Basel)       Date:  2021-07-14       Impact factor: 4.546

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.