Literature DB >> 30655510

High frequencies of circulating memory T cells specific for calreticulin exon 9 mutations in healthy individuals.

Morten O Holmström1,2, Shamaila M Ahmad3, Uffe Klausen3, Simone K Bendtsen3, Evelina Martinenaite3, Caroline H Riley4, Inge M Svane3,5, Lasse Kjær6, Vibe Skov6, Christina Ellervik7,8,9, Niels Pallisgaard10, Hans C Hasselbalch6, Mads H Andersen3,11.   

Abstract

Mutations in exon 9 of the calreticulin gene (CALR) frequently occur in patients with chronic myeloproliferative neoplasms (MPN). Patients exhibit spontaneous cellular immune responses to epitopes derived from the mutant CALR C-terminus, and CALR-mutant-specific T cells recognize autologous CALR-mutant malignant cells. This study investigated whether CALR-mutant-specific T cells occur naturally in CALRwt MPN-patients and in healthy individuals. Specific immune responses against epitopes in the mutant CALR peptide sequence were detected in both CALRwt MPN-patients and in healthy individuals. Healthy donors displayed more frequent and stronger CALR-mutant specific T-cell responses compared to the responses identified in CALR-mutant MPN-patients. Several T-cell responses were identified in healthy donors directly ex vivo. Importantly, by running functional analyses on live-sorted immune cells from healthy donors, we showed that circulating CALR-mutant-specific immune cells are T-memory cells. These findings suggest, that healthy individuals acquire a CALR exon 9 mutation, but the immune system reacts and clears the mutant cells, and during this reaction generates CALR-mutant specific T-memory cells. We believe that these findings provide the evidence for tumor immune surveillance in MPN.

Entities:  

Mesh:

Substances:

Year:  2019        PMID: 30655510      PMCID: PMC6336769          DOI: 10.1038/s41408-018-0166-4

Source DB:  PubMed          Journal:  Blood Cancer J        ISSN: 2044-5385            Impact factor:   11.037


Introduction

In 2013, two independent research groups reported on the occurrence of somatic mutations in exon 9 of the calreticulin (CALR) gene in 75% of patients with Janus kinase 2 (JAK2)wt chronic myeloproliferative neoplasms (MPN)[1,2]. We recently provided evidence that patients with CALR-mutant MPN exhibit frequent, spontaneous cellular immune responses against epitopes derived from the mutant CALR C-terminus[3], and that CALR-mutant-specific T-cells derived from patients can recognize and kill autologous CALR-mutant cells in a CALR-mutant dependent manner[4]. As such the CALR mutations generate an immunogenic antigen that could be used as target for cancer immune therapy[5]. As the CALR mutations are only identified in patients with myeloid cancer, the immune system in healthy individuals should not have been challenged with mutant CALR epitopes, and hence should not react to stimulation with these. Accordingly, several studies on immune reactivity against other shared commonly occurring mutations, such as pRAS mutations and BRAF mutations in solid cancers, have indicated that cells from healthy individuals fail to show spontaneous immune responses against these neoantigens[6,7]. In regard to immune responses to the BCR-ABL fusion transcript, one study showed responses in peripheral blood mononuclear cells (PBMC) from 3/18 healthy donors after stimulation in vitro with autologous dendritic cells that had been pulsed with a BCR-ABL peptide[8], whereas another study failed to show immune responses against the transcript in healthy individuals[9]. Other studies have focused on immune responses against the somatic MYD88L265P mutation, which occurs in several types of lymphoma[10]. One study demonstrated a T-cell response, when T-cells derived from healthy individuals were stimulated with the MYD88L265P epitope, but the responses required two stimulations with peptide-pulsed dendritic cells[11]. Of interest, none of the above studies have demonstrated immune responses against tumor-specific antigens in cells from healthy individuals tested in an ex vivo setting, without prior in vitro peptide stimulation. Even more, it has never been shown, which cells in the T-cell compartment actually harbor these neo-antigen-specific T cells. Given the high immunogenicity of the CALR exon 9 mutations we investigated if healthy donors display T-cell responses specific for the CALR mutations and if so, whether such CALR-mutant specific T cells are antigen experienced T-memory cells (Tmem) or naive T cells (Tnaive). The identification of a memory response is important, as CALR-mutant specific T cells in the Tmem compartment suggest that healthy donors may acquire a CALR exon 9 mutation, which is cleared by specific T-cells and Tmem is established in the process. This study demonstrates that healthy donors display stronger and more frequent CALR-mutant specific T-cell responses compared to CALR-mutant patients. Even more, we show that the mutant CALR C-terminus harbors an immunogenic hotspot, and finally that CALR-mutant specific T cells in healthy individuals are Tmem.

Materials and methods

Materials

Buffy coats from anonymized blood donors were acquired from the blood bank at Rigshospitalet, Copenhagen, Denmark. Peripheral blood mononuclear cells (PBMC) from patients with JAK2V617F-mutant MPN were acquired after informed consent from the patient. PBMC were isolated with Lymphoprep (Axis Shield, Oslo, Norway) and frozen in fetal calf serum with 10% dimethyl sulfoxide (Sigma-Aldrich, St. Louis, MO, USA). To determine whether age might influence specific immune responses to CALR-mutants, we isolated PBMCs from 50 healthy individuals of different ages. All participants provided informed consent, in agreement with the Helsinki Declaration, before study entry. The project was approved by the local Ethics Committee of the Zealand Region (Approval number SJ-175 and SJ-456).

Peptides

We chose to work with the following peptides, which were either provided by KJ Ross-Petersen (Klampenborg, Denmark) or Schafer-N (Copenhagen, Denmark): CALRLong1 (RRMMRTKMRMRRMRRTRRKMRRKMSPARP), CALRLong2 (TRRKMRRKMSPARPRTSCREACLQGWTEA), CALRLong3 (KMRMRRMRRTRRKMRRKMS), and CALRLong4 (RRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA). In addition, we used the CALRLong36 (RMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA) peptide, provided by PolyPeptide Laboratories (Strasbourg, France). We also chose to work with the following short peptides, all provided by KJ Ross-Petersen (Klampenborg, Denmark): CALR-01 (RTRRKMRRK), CALR-02 (RTSCREACL), CALR-03 (RTKMRMRRM), and CALR-04 (RTRRKMRRKM). The sequences of peptides and their relation to the entire CALR-mutant C-terminal are given in Fig. 1. To identify the immunogenic hotspot in the mutant CALR C-terminus, we segregated the entire mutant C-terminus into nonamer epitopes, with eight overlapping amino acids. Thus, we generated a total of 36 nonamer peptides, which we termed the CALR library (Supplementary Material 1). These epitopes were acquired from Pepscan (Lelystad, Netherlands). Negative control peptides were generated by scrambling the CALR-mutant peptide sequence. We generated three negative control peptides with the following sequences: MRRTMMMMMPRRRRRRKRRSKTRAPRMRK, MERKMAEQRPCRKPSTRALATCRRWGSRT, and TSMMRRRRRRKRRKMMKRM. These peptides were provided by KJ Ross-Petersen.
Fig. 1

Amino acid sequences for the long and short epitopes used in this study.

The sequences are shown relative to the mutant CALR C-terminus. Every 10th amino acid is underscored to facilitate tracking

Amino acid sequences for the long and short epitopes used in this study.

The sequences are shown relative to the mutant CALR C-terminus. Every 10th amino acid is underscored to facilitate tracking

Enzyme-linked immunospot assay

To analyze CALR-mutant-specific immune responses, we employed Enzyme-Linked ImmunoSPOT (ELISPOT) assays, according to protocols described previously[12]. Immune responses were analyzed with the interferon-gamma (IFN-γ) or tumor necrosis factor alpha (TNF-α) ELISPOT assay. Unless otherwise stated, all experiments were performed with the in vitro IFN-γ ELISPOT assay. The ELISPOT assays employed 1.3 to 4 × 105 cells/well. Unless otherwise stated, all ELISPOT experiments were performed in triplicates. Additionally, when not otherwise stated, ex vivo ELISPOTs were performed with thawed PBMCs that had been allowed to rest overnight at 37 °C in an incubator with 5% CO2 and a humidified atmosphere. ELISPOT experiments were set-up as previously described[12]. ELISPOT plates were analyzed and counted using the ImmunoSpot S6 Ultimate Analyzer (CTL Analyzers, Shaker Heights, OH, USA). For the identification of immune responses against epitopes in the CALR library, we deviated from the standard in vitro stimulation protocol. For cultures that we planned to analyze for responses against the B1-C6 region of the CALR-mutant C-terminus, we performed in vitro stimulations with the CALRLong1 peptide. For cultures that we planned to analyze for response against the C7-D12 region of the CALR-mutant C-terminus, we performed in vitro stimulation with the CALRLong2 peptide. The in vitro assays with CALRLong1 and CALRLong2 saved time and cells, with minimal effects on the sensitivity of the experiments, because CALRLong1 spanned residues B1-C6, and CALRLong2 spanned residues C7-D12.

Magnetically activated cell sorting (MACS)

CD4+ Tmem cells and Tnaive were sorted with the MACS method, with the Memory CD4+ T-cell Isolation Kit (order no 130–091–893) and with the Naive Pan T-cell Isolation Kit (order no 130–097–095), respectively (both Miltenyi Biotech, Bergish Gladbach, Germany), according to the manufacturer’s protocols. Cells were thawed and rested overnight, then sorted the next day. Cells were sorted twice on a magnetic column to ensure high purity in the enriched cells. During Tnaive isolation, we added the optional anti-TCR γ/δ antibodies to ensure depletion of γ/δ T cells. We analyzed the purity of the enriched fractions by staining with Fixable Viability Stain 510, CD3-APC-H7, CD45RO-PE, and CD45RA-APC (all BD Biosciences, San José, CA, USA). Cells were analyzed on a FACS Canto II flow cytometer (BD Biosciences, San José, CA, USA) equipped with FACS Diva Software. Gating strategy for the identification of CD3+ T cells for the phenotypic analysis of memory cell markers is provided in Supplementary Material 2.

Fluorescence-activated cell sorting (FACS) of live cells

Cells were thawed, and then rested overnight in x-vivo medium (Lonza, Basel, Switzerland) with 5% human serum in an incubator. The next day, cells were washed twice in FACS buffer, then stained with the following: LIVE/DEAD Fixable Near-IR Dead Cell Stain Kit (Waltham, MA, USA), CD45RA-APC, CD62L-PE, and CD3-FITC (BD Biosciences, San José, CA, USA). Cells were stained for 30 min on ice, washed twice, and then resuspended in FACS buffer at 50 × 106 cells/mL. Next, cells were sorted on a FACS ARIA flow cytometer with appropriate application settings and compensation controls. Cell sorting was performed with a purity setting. After sorting, cells were allowed to rest in x-vivo medium (Lonza, Basel, Switzerland) in an incubator. After sorting of all the cells, samples of 104 cells were analyzed to ensure proper sorting purity. Gating strategy for the identification of CD3+ T cells for the phenotypic analysis and subsequent sorting of different memory cell fractions is provided in Supplementary Material 2. Materials and methods for intracellular cytokine staining (ICS), establishment of T-cell cultures specific for mutant CALR epitopes and statistical analyses are provided in Supplementary Material 3.

Results

Patients with JAK2V617F-mutant MPN harbor an immune response to mutant CALR epitopes

We scrutinized peripheral blood mononuclear cells (PBMC) from patients with JAK2V617F-mutant polycythemia vera (PV) for immune responses against the immunogenic CALRLong1 and CALRLong2 epitopes that are derived from the mutant CALR C-terminus[3]. Surprisingly, 2/6 patients with PV exhibited a significant response against CALRLong1 (data not shown) and 3/5 had a significant immune response against CALRLong2 (Fig. 2a), according to the distribution free resampling method (DFR)[13]. CALR/JAK2 double mutants are very rare and these mutations are generally mutually exclusive[14-17].
Fig. 2

Spontaneous CD4+ and CD8+ T-cell responses against several epitopes in the mutant CALR C-terminus in healthy donors.

a Cells from five patients with JAK2V617F-mutant MPN were analyzed for responses against CALRLong2 in an IFN-γ ELISPOT with varying effector cell concentrations. (Left) The number of spot-forming cells in control wells was subtracted from the number of spot-forming cells in peptide-stimulated wells. (Right) Example of an ELISPOT performed with PBMCs from one patient that was JAK2V617F+; PBMCs were stimulated with or without the CALRLong2 peptide. b The numbers of healthy individuals that showed specific immune responses to CALRLong1 and CALRLong2 peptides in IFN-γ ELISPOT. DFR-defined and DFR2x-defined responses are indicated. c Example of wells from healthy individuals that responded to (left) CALRLong1 and (right) CALRLong2. d, e Intracellular cytokine staining performed in cells from healthy individuals shows that CD4+ T-cells were double-positive for TNF-α and IFN-γ, after stimulation with either: d CALRLong1 (n = 5), or e CALRLong2 (n = 4), compared to a negative control scrambled peptide. f (Left) Cells from five healthy individuals were analyzed for spontaneous immune responses against three nonamer epitopes (CALR-01, CALR-02, CALR-03) and one decamer epitope derived from the CALR-mutant C-terminus. No samples showed DFR-defined responses against CALR-01; 4/5 samples responded to CALR-02; 1/5 samples responded to CALR-03; and 1/5 samples responded to CALR-04. (Right) Example of a response against CALR-02. g Cells from three healthy individuals that showed immune responses against CALR-02. Intracellular staining shows TNF-α and IFN-γ production in CD4+ and CD8+ T-cells stimulated with CALRLong2, compared to unstimulated cells. Error bars display standard error of the mean. *p ≤ 0.05 according to the DFR rule

Spontaneous CD4+ and CD8+ T-cell responses against several epitopes in the mutant CALR C-terminus in healthy donors.

a Cells from five patients with JAK2V617F-mutant MPN were analyzed for responses against CALRLong2 in an IFN-γ ELISPOT with varying effector cell concentrations. (Left) The number of spot-forming cells in control wells was subtracted from the number of spot-forming cells in peptide-stimulated wells. (Right) Example of an ELISPOT performed with PBMCs from one patient that was JAK2V617F+; PBMCs were stimulated with or without the CALRLong2 peptide. b The numbers of healthy individuals that showed specific immune responses to CALRLong1 and CALRLong2 peptides in IFN-γ ELISPOT. DFR-defined and DFR2x-defined responses are indicated. c Example of wells from healthy individuals that responded to (left) CALRLong1 and (right) CALRLong2. d, e Intracellular cytokine staining performed in cells from healthy individuals shows that CD4+ T-cells were double-positive for TNF-α and IFN-γ, after stimulation with either: d CALRLong1 (n = 5), or e CALRLong2 (n = 4), compared to a negative control scrambled peptide. f (Left) Cells from five healthy individuals were analyzed for spontaneous immune responses against three nonamer epitopes (CALR-01, CALR-02, CALR-03) and one decamer epitope derived from the CALR-mutant C-terminus. No samples showed DFR-defined responses against CALR-01; 4/5 samples responded to CALR-02; 1/5 samples responded to CALR-03; and 1/5 samples responded to CALR-04. (Right) Example of a response against CALR-02. g Cells from three healthy individuals that showed immune responses against CALR-02. Intracellular staining shows TNF-α and IFN-γ production in CD4+ and CD8+ T-cells stimulated with CALRLong2, compared to unstimulated cells. Error bars display standard error of the mean. *p ≤ 0.05 according to the DFR rule

Cells from healthy individuals display strong and frequent immune responses against the CALRLong1 and CALRLong2 peptides and against short CALR-mutant epitopes

Next, we investigated whether cells from healthy individuals might also exhibit an immune response against the CALRLong1 and CALRLong2 epitopes. Surprisingly, cells from 20/27 (74%) individuals showed a significant response to CALRLong1 (Fig. 2b, c), and cells from 22/29 (76%) individuals showed a significant immune response to CALRLong2 (Fig. 2b, c). Using ICS, 5 and 4 healthy individuals were analyzed for responses against CALRLong1 (Fig. 2d) and CALRLong2 (Fig. 2e), respectively. Stimulation of PBMC with mutant CALR epitopes lead to increased production of TNF-α and IFN-γ from CD4+ T-cells. The responses were only borderline significant, probably due to low sample size. Given these highly surprising results, we investigated the immunogenic potential of three CALR-mutant nonamer epitopes (CALR-01, CALR-02, and CALR-03) and one CALR-mutant decamer epitope (CALR-04). CALR-02 induced responses in cells from 4/5 individuals, and CALR-03 and CALR-04 induced responses in cells from one individual each (Fig. 2f). Furthermore, we tested cytokine release in three donors against CALR-02 using ICS (Fig. 2g). However, the difference in cytokine release between stimulated and unstimulated cells did not reach statistical significance.

Screening for immune responses against nonamer epitopes in the mutant CALR C-terminus identifies an immunogenic hotspot sequence

Given the remarkably high frequency of responses against the CALR-mutant epitopes we verified that there was no homology between the 44 amino acid mutant CALR sequence and other known epitopes by the Basic Local Alignment Search Tool (BLAST)[18] using the blastpprogramme and the non-redundant protein sequences (nr) database. We next examined whether the CALR-mutant specific immune responses might be directed towards a certain part of the mutant sequence. Hence, we divided the 44-amino acid mutant C-terminus that is shared between the majority of CALR-mutant patients, into nonamer epitopes, with eight overlapping amino acids (Supplementary Material 1). Accordingly, we generated 36 nonamer epitopes, and analyzed PBMCs from ten healthy individuals for immune responses against each of these epitopes. We observed immune responses against all parts of the mutant CALR sequence (Supplementary Material 4); however, we could clearly identify an immunogenic hotspot located in the B6 to C7 region. Thus, although all parts of the mutant CALR C-terminus were immunogenic, the most immunogenic part (the hotspot) was located in the second quartile of the mutant C-terminus.

Cells from healthy subjects display strong, frequent immune responses against peptides spanning the entire mutant CALR C-terminus

As the B7-C6 hotspot sequence seemed to be highly immunogenic we merged the sequence into one long peptide (CALRLong3) and analyzed the immunogenicity of this epitope. Not surprisingly, 12/14 healthy donors harbored a response to CALRLong3 (Fig. 3a). However, our analysis of the CALR library showed that immune responses are identified agains all parts of the C-terminus. Therefore, we analyzed immune responses against CALRLong4, which spans the 34 most C-terminal amino acids in the mutant C-terminus, and CALRLong36, that spans all 36 amino acids in the CALR-mutant C-terminus. The immunogenicity of the latter was of particular interest, as this peptide is used in the phase I clinical vaccination trial currently running at our institution (NCT03566446). Both CALRLong4 and CALRLong36 incited frequent and strong responses (Fig. 3a). We then performed ELISPOT assays on PBMC plated directly ex vivo and allowed to incubate in the ELISPOT plate for 22 h. Ex vivo responses against CALRLong4 was found in 4/5 analyzed samples, and three samples displayed a DFR2x-defined significant response (Fig. 3b). Likewise, 2/2 analyzed samples showed an ex vivo response against CALRLong36 (Fig. 3c). As the CALRLong4 and CALRLong36 peptides are long peptides and, therefore, need antigen processing for presentation on the cell surface, the 22 h ex vivo ELISPOT may not show the full response to the mutant epitopes. As such, we performed 72 h ex vivo IFN-γ ELISPOT in PBMC from 11 healthy donors, (Fig. 3d) and TNF-α ELISPOT in PBMC from ten healthy donors (Fig. 3e). All 11 donors had an IFN-γ response, and six displayed a TNF-α response, once more demonstrating that the CALR-mutant epitopes are highly immunogenic, and the responses identified are indeed elicited by circulating CALR-mutant-specific T-cells. By using ICS on in vitro stimulated cultures to investigate the phenotype of the cytokine-producing cells stimulated with CALRLong3, CALRLong4 and CALRLong36 we found that it is mainly CD4+ T-cells that are activated upon antigen stimulation (Fig. 3f).
Fig. 3

In vitro and ex vivo immune responses against epitopes that spanned the entire mutant C-terminus.

a (Left) In vitro IFN-γ ELISPOT results show the number of cells that specifically responded to CALRLong3, CALRLong4, and CALRLong36 peptides. The DFR-defined and DFR2x-defined responses are indicated below the graph. Example of responses against CALRLong3 (left), CALRLong4 (middle), and CALRLong36 (right). b (Left) Ex vivo 22 h IFN-γ ELISPOT responses against CALRLong4 in cells from five healthy individuals; (right) example of a response. c (Left) Ex vivo 22 h IFN-γ ELISPOT responses against CALRLong36 in cells from two healthy individuals. d Ex vivo 72 h IFN-γ ELISPOT against CALRLong4 in cells from 11 healthy individuals, with wells displaying a representative response shown to the right. e Ex vivo 72 h TNF-α ELISPOT against CALRLong4 in cells from ten healthy individuals, with wells displaying a representative response shown to the right. f Intracellular cytokine staining of cells from healthy individuals depicts IFN-γ/TNF-α-double-positive CD4+ T-cells stimulated with either CALRLong3 (left), CALRLong4 (middle), or CALRLong36 (right). Cells from ten healthy donors were analyzed for responses against CALRLong4, and cells from five healthy donors were analyzed for response against CALRLong3 and CALRLong5. Error bars display standard error of the mean. *p ≤ 0.05 according to the DFR rule. **p ≤ 0.05 according to the DFR2x rule

In vitro and ex vivo immune responses against epitopes that spanned the entire mutant C-terminus.

a (Left) In vitro IFN-γ ELISPOT results show the number of cells that specifically responded to CALRLong3, CALRLong4, and CALRLong36 peptides. The DFR-defined and DFR2x-defined responses are indicated below the graph. Example of responses against CALRLong3 (left), CALRLong4 (middle), and CALRLong36 (right). b (Left) Ex vivo 22 h IFN-γ ELISPOT responses against CALRLong4 in cells from five healthy individuals; (right) example of a response. c (Left) Ex vivo 22 h IFN-γ ELISPOT responses against CALRLong36 in cells from two healthy individuals. d Ex vivo 72 h IFN-γ ELISPOT against CALRLong4 in cells from 11 healthy individuals, with wells displaying a representative response shown to the right. e Ex vivo 72 h TNF-α ELISPOT against CALRLong4 in cells from ten healthy individuals, with wells displaying a representative response shown to the right. f Intracellular cytokine staining of cells from healthy individuals depicts IFN-γ/TNF-α-double-positive CD4+ T-cells stimulated with either CALRLong3 (left), CALRLong4 (middle), or CALRLong36 (right). Cells from ten healthy donors were analyzed for responses against CALRLong4, and cells from five healthy donors were analyzed for response against CALRLong3 and CALRLong5. Error bars display standard error of the mean. *p ≤ 0.05 according to the DFR rule. **p ≤ 0.05 according to the DFR2x rule

The frequency of CALR-mutant-specific immune responses does not change with age

As the median age of diagnosis of CALR-mutant MPN-patients is 47–57 years[16,19-22], we wondered if the emergence of CALR-mutant MPN could be explained by an age dependent loss of CALR-mutant specific immune response. Hence, we analyzed the specific responses against CALRLong1 and CALRLong4 in PBMC from 25 healthy individuals with a median age of 19 years (range 18–21 years) and in PBMC from 25 healthy individuals with a median age of 57 years (range 50–64 years). No difference in frequency nor amplitude of responses against CALRLong1 and CALRLong4 was identified between the two age defined cohorts (Supplementary Material 5A, 5B). In total we have analyzed the CALR- mutant specific immune responses in a vast amount of healthy subjects: Of 74 subjects analyzed for response against CALRLong1, 54 (78%) exhibited a DFR-defined significant immune response, and 24 (32%) exhibited a DFR2x-defined significant response. The responses against CALRLong4 were even more frequent; of 110 subjects analyzed, PBMC from 98 (89%) exhibited a DFR-defined significant response and 60 individuals (55%) exhibited a DFR2x-defined significant response.

CALR-mutant specific immune responses are identified in CD4+ Tmem, but not Tnaive cells

Given the high frequencies and amplitudes of CALR-mutant-specific T-cell responses in healthy individuals, we speculated that these T-cell responses might be attributable to Tmem rather than Tnaive. To investigate this hypothesis, we isolated CD4+ Tmem from a healthy individual that had shown a clear CALRLong4-specific T-cell response. In these CD4+ Tmem enriched cells, we readily detected a strong in vitro immune response against CALRLong4 (Fig. 4a). Similarly, we isolated enriched Tnaive from the same donor, and these cells did not show a specific response to CALRLong4 in vitro (Fig. 4b). However, we detected a CALRLong4-specific immune response in the unsorted PBMC fraction and in the Tnaive-depleted fraction. Next, we used FACS to enrich PBMC from two healthy donors for T effector memory T-cells (TEM), which were stimulated ex vivo in ELISPOT with CALRLong4. Strong ex vivo immune responses in the highly pure TEM cell fractions were detected (Fig. 4c).
Fig. 4

CALR-mutant-specific T-cell responses in different T-cell compartments.

a PBMCs from healthy individuals were enriched for CD4+ Tmem with MACS. Enriched cells, CD4+ Tmem-depleted cells, and unsorted cells were analyzed in a standard IFN-γ ELISPOT. (Middle) The number of spots per T-cell fraction and (top) a representative photograph of wells stimulated with either CALRLong4 or a negative scrambled peptide. (Bottom) Purity analyses of CD3+ gated cells in corresponding cell fractions. ELISPOT assays were performed in triplicate. b PBMCs from healthy individuals were enriched for Tnaive cells with MACS. Enriched cells, Tnaive-depleted cells, and unsorted cells were analyzed in a standard IFN-γ ELISPOT. (Middle) The number of spots per T-cell fraction; (top) a representative photograph of wells stimulated with either CALRLong4 or a negative scrambled peptide. (Bottom) Purity analyses of CD3+ gated cells in corresponding cell fractions. ELISPOT assays were performed in triplicates. c PBMCs from healthy individuals were enriched for T effector memory cells (TEM) (CD3+, CD45RA-, CD62L−) with FACS, and analyzed in an ex vivo IFN-γ ELISPOT. (Left) The number of spot-forming cells and a representative photograph of wells stimulated with either CALRLong4 or a negative scrambled peptide. (Right) FACS plots of unsorted PBMCs and TEM-enriched fractions show the purity of TEM-enriched fractions in CD3+ gated cells. Error bars display standard error of the mean

CALR-mutant-specific T-cell responses in different T-cell compartments.

a PBMCs from healthy individuals were enriched for CD4+ Tmem with MACS. Enriched cells, CD4+ Tmem-depleted cells, and unsorted cells were analyzed in a standard IFN-γ ELISPOT. (Middle) The number of spots per T-cell fraction and (top) a representative photograph of wells stimulated with either CALRLong4 or a negative scrambled peptide. (Bottom) Purity analyses of CD3+ gated cells in corresponding cell fractions. ELISPOT assays were performed in triplicate. b PBMCs from healthy individuals were enriched for Tnaive cells with MACS. Enriched cells, Tnaive-depleted cells, and unsorted cells were analyzed in a standard IFN-γ ELISPOT. (Middle) The number of spots per T-cell fraction; (top) a representative photograph of wells stimulated with either CALRLong4 or a negative scrambled peptide. (Bottom) Purity analyses of CD3+ gated cells in corresponding cell fractions. ELISPOT assays were performed in triplicates. c PBMCs from healthy individuals were enriched for T effector memory cells (TEM) (CD3+, CD45RA-, CD62L−) with FACS, and analyzed in an ex vivo IFN-γ ELISPOT. (Left) The number of spot-forming cells and a representative photograph of wells stimulated with either CALRLong4 or a negative scrambled peptide. (Right) FACS plots of unsorted PBMCs and TEM-enriched fractions show the purity of TEM-enriched fractions in CD3+ gated cells. Error bars display standard error of the mean

Ex vivo CALR-mutant-specific immune responses reside primarily in the CD4+ Tmem compartment

As the use of FACS for sorting TEM cells can potentially interfere with cell functionality, we looked further into the CALR-mutant-specific T-cell responses by sorting PBMCs from three healthy individuals using MACS to enrich for CD4+ Tmem and Tnaive. The enrichments were based on negative selection; i.e., the cells of interest were not treated with antibodies that could either activate or inactivate the cells. We investigated the enriched T cells with an ex vivo IFN-γ ELISPOT assay for responses against CALRLong1, CALRLong4, and CALRLong36. The CD4+ Tmem from all donors displayed strong CALR-mutant-specific T-cell responses, mainly against CALRLong4 and CALRLong36. In samples from two individuals, the enriched Tnaive fraction did not display any immune responses (Fig. 5a, b). However, in one individual, both the CD4+ Tmem fraction and the Tnaive fraction displayed responses against the three mutant epitopes (Fig. 5c). However, the strongest immune response was identified in the Tmem fraction.
Fig. 5

CALR-mutant-specific ex vivo responses in both CD4+ Tmem and Tnaive compartments.

PBMCs from three healthy individuals (a, b, and c) were enriched for CD4+ Tmem and Tnaive with MACS. Enriched cells were analyzed in an ex vivo IFN-γ ELISPOT. (Top) Photographs of wells stimulated with either CALRLong4 or a negative scrambled peptide; (middle) analysis of purity of the different cell fractions in CD3+ gated cells; (bottom) graph shows the number of cells specific for CALRLong1, CALRLong4, and CALRLong36. The number of peptide-specific cells was calculated by subtracting the number of spots in wells stimulated with a scrambled negative control peptide from the number of spots in peptide-stimulated wells. Error bars display standard error of the mean

CALR-mutant-specific ex vivo responses in both CD4+ Tmem and Tnaive compartments.

PBMCs from three healthy individuals (a, b, and c) were enriched for CD4+ Tmem and Tnaive with MACS. Enriched cells were analyzed in an ex vivo IFN-γ ELISPOT. (Top) Photographs of wells stimulated with either CALRLong4 or a negative scrambled peptide; (middle) analysis of purity of the different cell fractions in CD3+ gated cells; (bottom) graph shows the number of cells specific for CALRLong1, CALRLong4, and CALRLong36. The number of peptide-specific cells was calculated by subtracting the number of spots in wells stimulated with a scrambled negative control peptide from the number of spots in peptide-stimulated wells. Error bars display standard error of the mean To clarify whether these results might be reproducible by using another enrichment procedure, we performed FACS live-cell sorting to isolate either Tmem (CD3+, CD62L+, CD45RA-; CD3+, CD62L−, CD45RA+; and CD3+, CD62L-, CD45RA−) or Tnaive (CD3+, CD62L+, CD45RA+) fractions. Next, we analyzed the enriched fractions and the unsorted cells using ex vivo IFN-γ ELISPOT to identify spontaneous immune responses against CALRLong4. Once more, we detected responses in enriched Tmem, whereas no significant responses were detected in the Tnaive fraction (Fig. 6a). To determine whether the cryopreservation of PBMC might have influenced the responses, we isolated PBMC from freshly drawn blood from a healthy individual with a known response to CALRLong4. The PBMC were rested overnight and then live-sorted with FACS and assayed in an ex vivo IFN-γ ELISPOT. Upon stimulation with CALRLong4 and CALRLong36, we once more detected cytokine release from Tmem, but not from Tnaive (Fig. 6b). Next, Tmem from the cell sorting were stimulated in vitro for 7 days with the CALRLong4 peptide and analyzed with ICS to investigate the phenotype of the responding Tmem. Accordingly, we demonstrated that both CD4+ and CD8+ Tmem responded to stimulation with CALRLong4 (Fig. 6c). Due to the low yield of Tnaive from the cell sorting procedure, we did not analyze potential CALRLong4-specific responses in Tnaive with ICS.
Fig. 6

CALR-mutant-specific responses in FACS-sorted Tmem, but not in Tnaive.

a PBMCs from a healthy individual were enriched for Tmem (CD3+, CD62L+, CD45RA− or CD3+, CD62L−, CD45RA+ or CD3+, CD62L−, CD45RA−) and Tnaive (CD3+, CD62L+, CD45RA+). Cells were analyzed in an ex vivo IFN-γ ELISPOT to determine the numbers of spot-forming cells (left) in each cell fraction that responded to CALRLong4. (Middle) photographs of wells. (Right) Analysis of purity of the different T-cell fractions in CD3+ gated cells. b PBMCs isolated from freshly drawn blood from an older healthy individual with a clear CALRLong4-specific response were rested overnight in an incubator. Cells were sorted into Tmem and Tnaive, and analyzed for peptide-specific T-cell responses in an ex vivo IFN-γ ELISPOT assay. The number of spot-forming cells was determined in each cell fraction for cells stimulated with (left) CALRLong4 or (middle) CALRLong36. (Right) FACS purity analysis results. Due to difficulties in separating Tnaive (CD3+, CD62L+, CD45RA+) and TEMRA (CD3+, CD62L-, CD45RA+) cells, the sorting gates were set differently from those set in a, to avoid contamination of Tnaive and TEM enrichments. c Tmem isolated in b were intracellularly stained after one week of in vitro stimulation with the CALRLong4 peptide. Panel shows the cytokines produced by (left) CD4+ T-cells and (right) CD8+ T-cells upon stimulation with CALRLong4 or a negative control scrambled peptide. Error bars display standard error of the mean

CALR-mutant-specific responses in FACS-sorted Tmem, but not in Tnaive.

a PBMCs from a healthy individual were enriched for Tmem (CD3+, CD62L+, CD45RA− or CD3+, CD62L−, CD45RA+ or CD3+, CD62L−, CD45RA−) and Tnaive (CD3+, CD62L+, CD45RA+). Cells were analyzed in an ex vivo IFN-γ ELISPOT to determine the numbers of spot-forming cells (left) in each cell fraction that responded to CALRLong4. (Middle) photographs of wells. (Right) Analysis of purity of the different T-cell fractions in CD3+ gated cells. b PBMCs isolated from freshly drawn blood from an older healthy individual with a clear CALRLong4-specific response were rested overnight in an incubator. Cells were sorted into Tmem and Tnaive, and analyzed for peptide-specific T-cell responses in an ex vivo IFN-γ ELISPOT assay. The number of spot-forming cells was determined in each cell fraction for cells stimulated with (left) CALRLong4 or (middle) CALRLong36. (Right) FACS purity analysis results. Due to difficulties in separating Tnaive (CD3+, CD62L+, CD45RA+) and TEMRA (CD3+, CD62L-, CD45RA+) cells, the sorting gates were set differently from those set in a, to avoid contamination of Tnaive and TEM enrichments. c Tmem isolated in b were intracellularly stained after one week of in vitro stimulation with the CALRLong4 peptide. Panel shows the cytokines produced by (left) CD4+ T-cells and (right) CD8+ T-cells upon stimulation with CALRLong4 or a negative control scrambled peptide. Error bars display standard error of the mean

CALR-mutant-specific immune responses reside primarily in the TEM and TCM fractions

As the CALR-mutant specific T cells clearly reside within the Tmem compartment we then examined which of the cells in this compartment are the most reactive to the CALR-mutations. Hence, we used FACS live-cell sorting to isolate four different CD3+ T-cell fractions: TEM (CD3+, CD62L−, CD45RA−), T central memory cells (TCM: CD3+, CD62L+, CD45RA−), terminally differentiated memory cells (TEMRA: CD3+, CD62L−, CD45RA+), and Tnaive (CD3+, CD62L+, CD45RA+). Then, we analyzed CALRLong4-specific immune responses in sorted cells using ex vivo IFN-γ ELISPOT assays. Cells from two different individuals were analyzed. The first sample showed the highest antigen-specific immune responses in the TEM and TEMRA fractions (Fig. 7a, top). However, due to the scarcity of cells, we only analyzed TEM cell responses in duplicate wells and TEMRA cell responses in a single well. We also identified some reactivity in the TCM fraction. The lowest cytokine release was identified in the Tnaive fraction. Purity analyses of the enriched fractions invariably showed very high purity (Fig. 7a, bottom). Repeating the sorting procedure in another donor we got a higher cell yield and were able to analyze TEM, TCM, and Tnaive fractions in triplicate experiments. Both the TCM and TEM fractions of this sample displayed very strong CALRLong4-specific immune responses. In contrast, the Tnaive and TEMRA responses were very weak (Fig. 7b).
Fig. 7

CALR-mutant-specific responses in both TEM and TCM.

a PBMCs from a healthy individual were enriched for T effector memory cells (TEM: CD3+, CD62L- CD45RA−), T central memory cells (TCM: CD3+, CD62L+, CD45RA-), TEMRA (CD3+, CD62L−, CD45RA+), and Tnaive (CD3+, CD62L+, CD45RA+). Cells were analyzed in an ex vivo IFN-γ ELISPOT for responses against CALRLong4. (Top) Representative wells for each cell fraction show responses to both CALRLong4 and a scrambled negative control peptide; (middle) graph shows the numbers of spot-forming cells in each cell fraction. (Bottom) Analysis of purity of the different T-cell fractions in CD3+ gated cells. Due to cell scarcity, TEM and TEMRA responses were measured in duplicate and in a single experiment, respectively. TCM and Tnäive responses were measured in triplicate. b PBMCs from healthy individuals were sorted and analyzed as described above. (Top) Representative wells for each cell fraction show responses to both CALRLong4 and a scrambled negative control peptide. (Bottom) Graph shows the number of spot-forming cells in each cell fraction. Due to cell scarcity, we did not perform purity analyses. TEMRA responses were analyzed in a single experiment, but all other cell fractions were analyzed in triplicate. Error bars display standard error of the mean

CALR-mutant-specific responses in both TEM and TCM.

a PBMCs from a healthy individual were enriched for T effector memory cells (TEM: CD3+, CD62L- CD45RA−), T central memory cells (TCM: CD3+, CD62L+, CD45RA-), TEMRA (CD3+, CD62L−, CD45RA+), and Tnaive (CD3+, CD62L+, CD45RA+). Cells were analyzed in an ex vivo IFN-γ ELISPOT for responses against CALRLong4. (Top) Representative wells for each cell fraction show responses to both CALRLong4 and a scrambled negative control peptide; (middle) graph shows the numbers of spot-forming cells in each cell fraction. (Bottom) Analysis of purity of the different T-cell fractions in CD3+ gated cells. Due to cell scarcity, TEM and TEMRA responses were measured in duplicate and in a single experiment, respectively. TCM and Tnäive responses were measured in triplicate. b PBMCs from healthy individuals were sorted and analyzed as described above. (Top) Representative wells for each cell fraction show responses to both CALRLong4 and a scrambled negative control peptide. (Bottom) Graph shows the number of spot-forming cells in each cell fraction. Due to cell scarcity, we did not perform purity analyses. TEMRA responses were analyzed in a single experiment, but all other cell fractions were analyzed in triplicate. Error bars display standard error of the mean

CALR-mutant specific T-cell cultures from CD4+ Tmem recognize several epitopes from the mutant CALR C-terminus and upregulate CD107a upon antigen stimulation

We have previously demonstrated that it is possible to isolate and expand CALR-mutant specific T cells from CALR-mutant MPN-patients. To further verify, that CALR-mutant specific T cells in healthy donors are indeed antigen experienced Tmem, we chose to analyze whether it is possible to isolate and expand CALR-mutant specific T cells from the Tmem compartment of healthy donors. Hence, using MACS we enriched CD4+ Tmem from PBMC from two different healthy donors. The cells were enriched twice to ensure a high purity of cells (Fig. 8a, left and 8c, left). Next, the CD4+ Tmem were stimulated three times with autologous DCs that were either pulsed with CALRLong1 or CALRLong4 peptide. Antigen responses were measured at day 5 after each DC stimulation using ICS. A total of three DC stimulations were performed. Due to scarcity of T cells, the CALRLong1 specific culture was expanded after the third DC stimulation using our rapid expansion protocol with high dose IL-2. The two T-cell cultures responded with cytokine release (Fig. 8a, c, middle panel), and enhanced expression of the degranulation marker CD107a upon stimulation with antigen (Fig. 8a, c, right panel). This last finding is especially noteworthy, as CALR-mutant specific T cells from patients were shown to display specific cytotoxicity to autologous CALR-mutant cells through upregulation of CD107a[4]. Finally, by analyzing immune responses from the two T-cell cultures, we demonstrated that the CALR-mutant specific T cells recognize several epitopes in the mutant C-terminus (Fig. 8b, d). Thus, antigen experienced T cells isolated and expanded from healthy donors do secrete cytokines upon stimulation with several epitopes from the mutant CALR C-terminus, and these T cells are potentially able to kill CALR-mutant cells.
Fig. 8

Establishment of two T-cell cultures specific for mutant CALR epitopes.

a (Left) Purity analysis of isolated CD4+ T-memory cells with cells stained for CD45RO (top, left) and cells that were unstained (below, left). The percentages depict the amount of CD45RO+ cells from the CD3+ fraction. After three stimulations with autologous DC cells were analyzed for cytokine release against CALRLong4 (top, middle) and scrambled negative control peptide (below, middle). Cells were also analyzed for expression of CD107a upon stimulation with CALRLong4 (top, right) and negative control peptide (below, right). b The T-cell culture was analyzed for responses against the CALR library and several other CALR-mutant epitopes with the amount of spots shown (top), and representative wells displayed (below). c CD4+ T-memory cells were isolated from another donor and used to establish a T-cell culture specific for the CALRLong1 epitope. Purity analysis (left), cytokine release (middle), and CD107a upregulation were analyzed as in a. d The CALRLong1 specific T-cell culture was analyzed for responses against the CALR library. We identified responses against several short epitopes from the CALR library as well as long epitopes (top). Representative wells are shown (below)

Establishment of two T-cell cultures specific for mutant CALR epitopes.

a (Left) Purity analysis of isolated CD4+ T-memory cells with cells stained for CD45RO (top, left) and cells that were unstained (below, left). The percentages depict the amount of CD45RO+ cells from the CD3+ fraction. After three stimulations with autologous DC cells were analyzed for cytokine release against CALRLong4 (top, middle) and scrambled negative control peptide (below, middle). Cells were also analyzed for expression of CD107a upon stimulation with CALRLong4 (top, right) and negative control peptide (below, right). b The T-cell culture was analyzed for responses against the CALR library and several other CALR-mutant epitopes with the amount of spots shown (top), and representative wells displayed (below). c CD4+ T-memory cells were isolated from another donor and used to establish a T-cell culture specific for the CALRLong1 epitope. Purity analysis (left), cytokine release (middle), and CD107a upregulation were analyzed as in a. d The CALRLong1 specific T-cell culture was analyzed for responses against the CALR library. We identified responses against several short epitopes from the CALR library as well as long epitopes (top). Representative wells are shown (below)

Discussion

We previously described in detail that the immune system of CALR-mutant patients specifically reacts to the mutant CALR C-terminus[3]. Even more, we showed that CALR-mutant specific T cells cloned from CALR-mutant patients recognize and kill autologous CALR-mutant target cells in a CALR-mutant-dependent manner[4]. However, in CALRwt individuals, the immune system should not have been challenged with mutant CALR epitopes, and accordingly such individuals should not display a CALR-mutant specific immune response. Surprisingly, we identified CALR-mutant specific immune responses in several JAK2V617F-mutant MPN-patients. Although we did not test whether these patients also carried CALR mutations, we speculated that it would be highly unlikely as JAK2 and CALR double mutants are rare[14-16]. This finding lead us to analyze CALR-mutant specific responses in healthy donors, and we were surprised to find even stronger and more frequent responses in healthy donors compared to the responses identified by us in CALR-mutant MPN-patients[3]. The stronger and more frequent responses might be explained by the theory of cancer immuno-editing;[23] cancer cells may be cleared by the immune system (in healthy individuals), be held in equilibrium by the immune system (in the MPN-setting; patients with essential thrombocythemia), or escape the immune system and enter into the metastatic disseminated stage (in the MPN-setting; patients with myelofibrosis)[23,24]. By following this notion, the data described here implies, that healthy individuals are able to clear cells harboring the CALR-mutation and, accordingly, this tumor cell elimination generates CALR-mutant specific Tmem. Interestingly, Tubb et al.[25] recently isolated CALR-mutant specific CD8+ T cells from peripheral blood in healthy donors using HLA-I tetramers. Even though this study did not provide data on the frequency of healthy donors harboring CALR-mutant specific T cells, and, most importantly, did not investigate the phenotype of such T cells, it still supports our findings of immune responses against mutant CALR in healthy individuals. As such, no studies have investigated the phenotype of neo-antigen-specific T cells in healthy donors, and only a limited number of studies have investigated the memory phenotype of T cells that display reactivity to tumor-associated antigens. Pittet et al.[26] investigated the phenotype of CD8+ T cells from healthy individuals with a reactivity against the melanoma associated antigen MART-1 and found the specific T cells to be Tnaive. In contrary we describe by several different means, that Tmem are activated both in vitro and ex vivo upon stimulation with the mutant CALR antigen. Importantly, we further describe that T-cell cultures derived from high purity Tmem fractions from two healthy donors reacted against several epitopes in the mutant CALR C-terminal. The data presented in this study imply that the immune system in healthy individuals has been exposed to CALR-mutant cells. Given the exquisite immunogenicity of these mutations, the CALR-mutant cells have been cleared by the immune system before the establishment of overt malignancy and, consequently T-cell memory to the CALR-mutations has been generated. We did not only detect frequent and strong T-cell responses among in vitro stimulated T cells, but also directly ex vivo. These ex vivo responses are especially remarkable as it, even in cancer patients, is rare to detect tumor-associated antigen-specific T-cells ex vivo by tetramer staining or ELISPOT[27]. As such, it is unusual for cells from healthy individuals to display a high frequency of specific immunity against a cancer neo-antigen. Given the high frequency of responses to the mutant antigens we verified that the CALR mutations do not share sequence homology with any other known epitope. We also ordered peptides from three different peptide providers (see Materials and methods) in order to rule out the possibility of peptide impurities as an explanation to the T-cell responses. Furthermore, the established T-cell cultures derived from Tmem recognized several epitopes in the mutant CALR C-terminus, demonstrating that the observed responses indeed are CALR-mutant specific T-cell responses. The high frequency of CALR-mutant-specific immune responses observed in healthy individuals samples raises the question why some individuals develop CALR-mutant MPN. The functionality of the immune system is believed to decline with age, and the median age at diagnosis of CALR-mutant MPN is reported to be 47–57 years[16,19-22]. Therefore, we examined the frequency of immune responses to the CALR-mutant C-terminus in two age defined cohorts (median ages: 19 years vs. age 57 years). However, no differences were found in neither frequency nor response between to two age defined cohorts. As the CALR mutations are highly immunogenic it might seem paradoxical, that the disease is not cleared by the immune system. However, there are several explanations to the paradoxical emergence of CALR-mutant MPN. Firstly, it was recently shown, that CALR-mutant patients display lower levels of human leukocyte antigen-I[28], and patients with MPN show increased levels of myeloid derived suppressor cells[29]. Although these explanations could partially clarify why CALR-mutant cells are able to evade immune-mediated destruction, it does not explain why CALR-mutant cells are initially able to establish themselves in the bone marrow, evade immune-mediated destruction, expand and develop overt CALR-mutant MPN. We are currently investigating a cohort of healthy individuals for low-burden CALR-mutations and hope that we thereby may identify healthy individuals with low-burden CALR-mutation. A thorough analysis of the immune constitution of such individuals might add important new information on the development and evolution of CALR-mutant MPN, which could potentially be prevented by therapeutic cancer vaccination with CALR-mutant epitopes. In conclusion, we have demonstrated that a majority of healthy individuals harbor immune cells that display CALR-mutant-specific T-cell responses, and that the frequency and amplitude of these responses are higher than in CALR-mutant patients. Neither do the frequency nor amplitude of responses depend on age. Moreover, we show that the majority of the immune responses are attributed to Tmem, particularly cells of the TEM and TCM compartments. In essence this demonstrates that the immune system in healthy individuals has eliminated tumor cells and generated T-cell memory, thus demonstrating the first of the three E’s - elimination - in the theory of cancer immuno-surveillance/editing[24]. Supplementary Material 1 Supplementary Material 2 Supplementary Supplementary Material 4 Supplementary Material 5 Supplementary Material 6 Supplementary materials legends
  28 in total

1.  CALR vs JAK2 vs MPL-mutated or triple-negative myelofibrosis: clinical, cytogenetic and molecular comparisons.

Authors:  A Tefferi; T L Lasho; C M Finke; R A Knudson; R Ketterling; C H Hanson; M Maffioli; D Caramazza; F Passamonti; A Pardanani
Journal:  Leukemia       Date:  2014-01-09       Impact factor: 11.528

2.  JAK2 V617F and CALR mutations are not mutually exclusive; findings from retrospective analysis of a small patient cohort.

Authors:  Gillian McGaffin; Kirsteen Harper; David Stirling; Lorna McLintock
Journal:  Br J Haematol       Date:  2014-06-17       Impact factor: 6.998

3.  The CALR exon 9 mutations are shared neoantigens in patients with CALR mutant chronic myeloproliferative neoplasms.

Authors:  M O Holmström; C H Riley; I M Svane; H C Hasselbalch; M H Andersen
Journal:  Leukemia       Date:  2016-08-18       Impact factor: 11.528

4.  Mapping the human T cell repertoire to recurrent driver mutations in MYD88 and EZH2 in lymphoma.

Authors:  Julie S Nielsen; Andrew R Chang; Darin A Wick; Colin G Sedgwick; Zusheng Zong; Andrew J Mungall; Spencer D Martin; Natalie N Kinloch; Susann Ott-Langer; Zabrina L Brumme; Steven P Treon; Joseph M Connors; Randy D Gascoyne; John R Webb; Brian R Berry; Ryan D Morin; Nicol Macpherson; Brad H Nelson
Journal:  Oncoimmunology       Date:  2017-04-28       Impact factor: 8.110

5.  Calreticulin mutations and long-term survival in essential thrombocythemia.

Authors:  A Tefferi; E A Wassie; T L Lasho; C Finke; A A Belachew; R P Ketterling; C A Hanson; A Pardanani; N Gangat; A P Wolanskyj
Journal:  Leukemia       Date:  2014-05-05       Impact factor: 11.528

6.  Somatic mutations of calreticulin in myeloproliferative neoplasms.

Authors:  Thorsten Klampfl; Heinz Gisslinger; Ashot S Harutyunyan; Harini Nivarthi; Elisa Rumi; Jelena D Milosevic; Nicole C C Them; Tiina Berg; Bettina Gisslinger; Daniela Pietra; Doris Chen; Gregory I Vladimer; Klaudia Bagienski; Chiara Milanesi; Ilaria Carola Casetti; Emanuela Sant'Antonio; Virginia Ferretti; Chiara Elena; Fiorella Schischlik; Ciara Cleary; Melanie Six; Martin Schalling; Andreas Schönegger; Christoph Bock; Luca Malcovati; Cristiana Pascutto; Giulio Superti-Furga; Mario Cazzola; Robert Kralovics
Journal:  N Engl J Med       Date:  2013-12-10       Impact factor: 91.245

7.  Long-term survival and blast transformation in molecularly annotated essential thrombocythemia, polycythemia vera, and myelofibrosis.

Authors:  Ayalew Tefferi; Paola Guglielmelli; Dirk R Larson; Christy Finke; Emnet A Wassie; Lisa Pieri; Naseema Gangat; Rajmonda Fjerza; Alem A Belachew; Terra L Lasho; Rhett P Ketterling; Curtis A Hanson; Alessandro Rambaldi; Guido Finazzi; Juergen Thiele; Tiziano Barbui; Animesh Pardanani; Alessandro M Vannucchi
Journal:  Blood       Date:  2014-07-18       Impact factor: 22.113

Review 8.  Immunologic monitoring of cancer vaccine therapy: results of a workshop sponsored by the Society for Biological Therapy.

Authors:  Ulrich Keilholz; Jeffrey Weber; James H Finke; Dmitry I Gabrilovich; W Martin Kast; Mary L Disis; John M Kirkwood; Carmen Scheibenbogen; Jeff Schlom; Vernon C Maino; H Kim Lyerly; Peter P Lee; Walter Storkus; Franceso Marincola; Alexandra Worobec; Michael B Atkins
Journal:  J Immunother       Date:  2002 Mar-Apr       Impact factor: 4.456

9.  Distinct clinical characteristics of myeloproliferative neoplasms with calreticulin mutations.

Authors:  Hajnalka Andrikovics; Tunde Krahling; Katalin Balassa; Gabriella Halm; Andras Bors; Magdalena Koszarska; Arpad Batai; Janos Dolgos; Judit Csomor; Miklos Egyed; Andrea Sipos; Peter Remenyi; Attila Tordai; Tamas Masszi
Journal:  Haematologica       Date:  2014-06-03       Impact factor: 9.941

10.  JAK2 or CALR mutation status defines subtypes of essential thrombocythemia with substantially different clinical course and outcomes.

Authors:  Elisa Rumi; Daniela Pietra; Virginia Ferretti; Thorsten Klampfl; Ashot S Harutyunyan; Jelena D Milosevic; Nicole C C Them; Tiina Berg; Chiara Elena; Ilaria C Casetti; Chiara Milanesi; Emanuela Sant'antonio; Marta Bellini; Elena Fugazza; Maria C Renna; Emanuela Boveri; Cesare Astori; Cristiana Pascutto; Robert Kralovics; Mario Cazzola
Journal:  Blood       Date:  2013-12-23       Impact factor: 22.113

View more
  8 in total

1.  Neo-antigen specific memory T-cell responses in healthy individuals.

Authors:  Morten Orebo Holmström; Hans Carl Hasselbalch; Mads Hald Andersen
Journal:  Oncoimmunology       Date:  2019-04-19       Impact factor: 8.110

2.  Mutant calreticulin in myeloproliferative neoplasms.

Authors:  Joan How; Gabriela S Hobbs; Ann Mullally
Journal:  Blood       Date:  2019-12-19       Impact factor: 22.113

Review 3.  PD-1/PD-L1, MDSC Pathways, and Checkpoint Inhibitor Therapy in Ph(-) Myeloproliferative Neoplasm: A Review.

Authors:  Jen-Chin Wang; Lishi Sun
Journal:  Int J Mol Sci       Date:  2022-05-23       Impact factor: 6.208

4.  Patients With Myeloproliferative Neoplasms Harbor High Frequencies of CD8 T Cell-Platelet Aggregates Associated With T Cell Suppression.

Authors:  Ana Micaela Carnaz Simões; Morten Orebo Holmström; Pia Aehnlich; Anne Rahbech; Aneta Radziwon-Balicka; Carlos Zamora; Tobias Wirenfeldt Klausen; Vibe Skov; Lasse Kjær; Christina Ellervik; Daniel El Fassi; Silvia Vidal; Hans Carl Hasselbalch; Mads Hald Andersen; Per Thor Straten
Journal:  Front Immunol       Date:  2022-05-06       Impact factor: 8.786

Review 5.  Inflammatory Microenvironment and Specific T Cells in Myeloproliferative Neoplasms: Immunopathogenesis and Novel Immunotherapies.

Authors:  Vincenzo Nasillo; Giovanni Riva; Ambra Paolini; Fabio Forghieri; Luca Roncati; Beatrice Lusenti; Monica Maccaferri; Andrea Messerotti; Valeria Pioli; Andrea Gilioli; Francesca Bettelli; Davide Giusti; Patrizia Barozzi; Ivana Lagreca; Rossana Maffei; Roberto Marasca; Leonardo Potenza; Patrizia Comoli; Rossella Manfredini; Antonino Maiorana; Enrico Tagliafico; Mario Luppi; Tommaso Trenti
Journal:  Int J Mol Sci       Date:  2021-02-14       Impact factor: 5.923

Review 6.  Neoantigens in Hematological Malignancies-Ultimate Targets for Immunotherapy?

Authors:  Malte Roerden; Annika Nelde; Juliane S Walz
Journal:  Front Immunol       Date:  2019-12-20       Impact factor: 7.561

7.  Therapeutic Cancer Vaccination With a Peptide Derived From the Calreticulin Exon 9 Mutations Induces Strong Cellular Immune Responses in Patients With CALR-Mutant Chronic Myeloproliferative Neoplasms.

Authors:  Jacob Handlos Grauslund; Morten Orebo Holmström; Nicolai Grønne Jørgensen; Uffe Klausen; Stine Emilie Weis-Banke; Daniel El Fassi; Claudia Schöllkopf; Mette Borg Clausen; Lise Mette Rahbek Gjerdrum; Marie Fredslund Breinholt; Julie Westerlin Kjeldsen; Morten Hansen; Steffen Koschmieder; Nicolas Chatain; Guy Wayne Novotny; Jesper Petersen; Lasse Kjær; Vibe Skov; Özcan Met; Inge Marie Svane; Hans Carl Hasselbalch; Mads Hald Andersen
Journal:  Front Oncol       Date:  2021-02-26       Impact factor: 6.244

Review 8.  Novel therapeutics in myeloproliferative neoplasms.

Authors:  Sangeetha Venugopal; John Mascarenhas
Journal:  J Hematol Oncol       Date:  2020-12-02       Impact factor: 17.388

  8 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.