Xiaolei Liang1, Ruirui Wang2, Wenshan Dou3, Li Zhao4, Lanxia Zhou4, Junfang Zhu4, Kairong Wang5, Jiexi Yan4. 1. The Reproductive Medicine Special Hospital of the First Hospital of Lanzhou University, Key Laboratory for Reproductive Medicine and Embryo, Lanzhou, China. 2. The First Clinical Medical College, Lanzhou University, Lanzhou, China. 3. The Second Clinical Medical College, Lanzhou University, Lanzhou, China. 4. The Key Laboratory, The First Hospital of Lanzhou University, Lanzhou, China, yanjx_1121@163.com. 5. School of Basic Medical Sciences, Institute of Biochemistry and Molecular Biology, Lanzhou University, Lanzhou, China.
Abstract
PURPOSE: Due to the emergence of multidrug resistance (MDR), traditional antileukemia drugs no longer meet the treatment needs. Therefore, new antileukemia drugs with different action mechanisms are urgently needed to cope with this situation. MATERIALS AND METHODS: Arminin 1a-C is an antimicrobial peptide (AMP) developed from the ancient metazoan marine Hydra. In this study, we first explored its antileukemia activity. RESULTS: Our results showed that Arminin 1a-C formed an α-helical structure and efficaciously suppressed the viability of leukemia cell lines whether or not they were multidrug resistant or sensitive, and there were no obvious differences between these cell lines. Arminin 1a-C exhibited distinct selectivity between noncancerous and cancerous cell lines. Arminin 1a-C interfered with K562/adriamycin (ADM) cell (a kind of multidrug-resistant leukemia cell line) proliferation in a very rapid manner and formed pores in its cell membrane, making it difficult to develop resistance against Arminin 1a-C. CONCLUSION: Our data show that Arminin 1a-C possesses great potential as a therapeutic candidate for the treatment of multidrug-resistant leukemia.
PURPOSE: Due to the emergence of multidrug resistance (MDR), traditional antileukemia drugs no longer meet the treatment needs. Therefore, new antileukemia drugs with different action mechanisms are urgently needed to cope with this situation. MATERIALS AND METHODS: Arminin 1a-C is an antimicrobial peptide (AMP) developed from the ancient metazoan marine Hydra. In this study, we first explored its antileukemia activity. RESULTS: Our results showed that Arminin 1a-C formed an α-helical structure and efficaciously suppressed the viability of leukemia cell lines whether or not they were multidrug resistant or sensitive, and there were no obvious differences between these cell lines. Arminin 1a-C exhibited distinct selectivity between noncancerous and cancerous cell lines. Arminin 1a-C interfered with K562/adriamycin (ADM) cell (a kind of multidrug-resistant leukemia cell line) proliferation in a very rapid manner and formed pores in its cell membrane, making it difficult to develop resistance against Arminin 1a-C. CONCLUSION: Our data show that Arminin 1a-C possesses great potential as a therapeutic candidate for the treatment of multidrug-resistant leukemia.
Despite recent advances in chemotherapy and the use of bone marrow transplantation, a large number of patients with leukemia eventually die of this disease. According to the Cancer Statistics of 2017, approximately 62,000 new leukemia cases were estimated and 24,000 people would die from this disease.1,2 As it is difficult to find a suitable donor for bone marrow transplantation, chemotherapy has become an important therapeutic method for most leukemia treatments. However, the multidrug resistance (MDR) of leukemic cells often leads to treatment failure in leukemia patients, which is caused by the extensive use of traditional chemotherapeutic drugs.3 In addition, traditional chemotherapeutic agents always cause damage to tissues and healthy cells induced by inadvertent drug interactions, consequently inducing harmful side effects.4,5 Therefore, the development of new antileukemia drugs that can prevent the induction of drug resistance and that are not toxic to normal cells has extraordinary significance.Antimicrobial peptides (AMPs) are expressed in many organisms, and they are diverse in structure.6 So far, more than 2,900 cationic AMPs have been purified from nature or chemosynthesized.7 AMPs exhibit broad antimicrobial activity against various microbes, including bacteria, fungi and viruses.8,9 In addition, some of the AMPs play an important role in the innate immune system.10,11 In addition to the antimicrobial and immunomodulatory function described earlier, in recent years, the anticancer activity of AMPs has also attracted attention.12,13 With the increasing severity of MDR, AMPs may serve as a potential resource for the development of novel anticancer chemotherapy agents, because their mode of action exhibits differences from traditional mechanisms and promises potent activity against a broad spectrum of cancers.14,15The oceans occupy most of the earth’s surface and could provide abundant peptides and natural small molecules. Compared with the terrestrial environment, marine organisms live in a totally different environment. They live in an environment filled with microbes that could infect at every opportunity. Therefore, most marine organisms produce AMPs.16 Arminin 1a is a novel AMP that was discovered during the investigation of the ancient metazoan Hydra. It did not show any sequence homology to any known AMPs. The C-terminus of Arminin 1a, which consists of 31 amino acids, showed a broad spectrum and potent activity against bacteria, including human multidrug-resistant pathogenic bacteria.17The purpose of the current study includes the following points. First, little is known about the function of Arminin 1a-C besides its antibacterial activity. Therefore, we addressed this problem and explored the antileukemia activity of Arminin 1a-C, especially its activity against drug-resistant leukemia cell lines. Second, toxicity of traditional chemotherapeutic drugs still remains the major challenge in the treatment of human malignancies. In this regard, it is meaningful for future clinical applications to research whether the activity of Arminin 1a-C expands to human leukemia cells without causing harm to normal human cells. The third objective was to preliminarily explore the mechanism of Arminin 1a-C action on leukemia cells. An understanding about how Arminin 1a-C kills human leukemia cells might provide a basis for guidance in cancer treatments in the future. Finally, we wanted to confirm the secondary structure of Arminin 1a-C to understand the relationship between its structure and activity. This information is vital to the potential development of Arminin 1a-C as a therapeutic molecule for leukemia.
Materials and methods
Peptide
Arminin 1a-C was synthesized by the N-9-fluorenylmethoxy-carbonyl (F-moc) stepwise solid-phase method as reported.18 LL-37 was obtained from GuoTai Biotechnology (HeFei, China). To preliminarily explore its mechanism of action, Arminin 1a-C was labeled with fluorescein isothiocyanate (FITC, a fluorescent dye). The FITC-labeled Arminin 1a-C was synthesized following Wender’s description.19 Homo geneity of these peptides was more than 95%. Electrospray ionization mass spectrometry (ESI-MS) was utilized to evaluate the atomic mass.
Cell lines
The leukemia cell lines used in this study included the K562 cell line (chronic myelogenous leukemia cell line) and its acquired multidrug-resistant cell line K562/adriamycin (ADM), the HL-60 cell line (promyelocytic leukemia cell line), the THP-1 cell line (monocytic leukemia cell line) and the Jurkat cell line (T cell leukemia cell line). Peripheral blood mononuclear cells (PBMCs), human umbilical vein endothelial cells (HUVECs) and human embryonic kidney cell line (HEK293) were considered noncancerous cells. All the cell lines except PBMCs were obtained from the School of Basic Medical Sciences of Lanzhou University, Lanzhou, China (which were purchased from American Type Culture Collection [ATCC], Manassas, VA, USA). PBMCs were obtained from heparinized blood samples of healthy donors and were isolated using a standard method of Ficoll-Hypaque density-gradient centrifugation (catalog number LTS1077; Haoyang Bioscience, Tianjin, China).20 All donors signed an informed consent form, and the experimental protocol was approved by the ethics committee of the First Hospital of Lanzhou University (LDYYLL2017-20). All the cells were cultured in Roswell Park Memorial Institute (RPMI) 1640 medium with 10% FBS at 37°C in 5% CO2. The use of cell lines was approved by the institutional review board of the School of Basic Medical Sciences and the First Hospital of Lanzhou University.
Cell proliferation and viability assay
The cell proliferation and viability activity of Arminin 1a-C against K562/ADM, K562, HL-60, THP-1 and Jurkat cells as well as HUVECs, HEK293 cells and PBMCs were examined by MTT assay as reported.21 HUVECs, HEK293 cells and PBMCs were used as normal cells. In brief, 1×104 cells/well were seeded in a 96-well plate. Then, Arminin 1a-C (final concentrations were 1.25 µM, 2.5 µM, 5 µM, 10 µM and 20 µM) that was dissolved in PBS or PBS alone was added to the wells. Then, 24 hours later, 10 µL of 5 mg/mL MTT (Chemical Abstracts Service [CAS] number: 298-93-1; Beyotime Biotechnology, Shanghai, China) reagent solution was added and incubated for another 4 hours at 37°C. After that, 100 µL of SDS–isobutanol–HCl solution (10% SDS, 5% isobutanol and 12 µM HCl) was added into each well and incubated for 24 hours. Then, the absorbance at 570 nm was detected by a microplate reader (catalog number: 168-1000; Bio-Rad Laboratories Inc., Hercules, CA, USA).
Hemolytic assay
The hemolytic activity of Arminin 1a-C was studied according to Ryan et al.22 Fresh peripheral blood from healthy volunteers was harvested in heparinized tubes and centrifuged (800× g, 10 minutes). The pellet was gently washed with cold PBS three times and was resuspended in PBS (erythrocyte working concentration was 8%). Then, 100 µL of red blood cell suspension was added into a microtiter plate and incubated with 100 µL of peptide solution (final concentrations were 10 µM, 25 µM, 50 µM, 75 µM, 100 µM, 150 µM, 200 µM and 300 µM) for 60 minutes at 37°C. PBS and Triton-X 100 (0.2%, CAS number: 9002-93-1; Sigma-Aldrich Co., St Louis, MO, USA) were considered as negative and positive controls, respectively. Hemoglobin release was measured after centrifugation (1,000× g, 10 minutes) by a microplate reader at 490 nm.
Lactate dehydrogenase (LDH) detection
The cytotoxicity of Arminin 1a-C was indicated by LDH leakage into the culture medium. When plasma membranes are injured in cells, LDH release in the media will increase. The released LDH will reduce NAD+ to NADH+/H+ by oxidizing lactate to pyruvate, and two hydrogens are transferred from NADH+/H+ to the yellow tetrazolium salt after an enzymatic reaction.23 In this assay, both leukemia cell lines (K562/ADM, K562 and HL-60) and normal cell lines (HUVEC, HEK293 and PBMCs) were assessed. Briefly, cells (1×104/well) were cultured overnight at 37°C, and then AMPs (final concentrations were 1.25 µM, 2.5 µM, 5 µM, 10 µM, 20 µM and 40 µM) were added and incubated for an additional 4 hours. This test was performed following the manufacturer’s instructions (Cytotoxicity Detection KitPLUS [LDH], catalog number 04744926001; Hoffman-La Roche Ltd., Basel, Switzerland). After that, the microplate was centrifuged, and then 100 µL of medium was transferred to another microplate. LDH reaction mixture was added to each well for a 15-minute reaction. Then, the absorbance at 490 nm was monitored by a microplate reader (Bio-Rad Laboratories Inc.).
Propidium iodide (PI) uptake assay
Membrane damage induced by Arminin 1a-C was evaluated by the PI uptake assay. Multidrug-resistant K562/ADM cells were reacted with Arminin 1a-C (final concentration was 10 µM) or PBS only for 30 minutes. After that, a fluorescent dye PI (final concentration was 2 µg/mL; CAS number: 25535-16-4; Beyotime Biotechnology) was added and incubated for an additional 10 minutes in the dark at room temperature. Then, cold PBS was added to end the staining and to wash off the excess dye. A fluorescence microscope (TE2000; Nikon Corporation, Tokyo, Japan) was employed to take the fluorescence images.
Scanning electron microscopy (SEM) of K562/ADM
Approximately 1×106/well K562/ADM cells were seeded in a six-well microplate. Then, 10 µM Arminin 1a-C was added for 30 minutes. The cells were harvested and washed gently with PBS. Then, 1 mL of 3% glutaraldehyde solution was used to fix the cells. After cell fixation, all pellets were impregnated in 2.5% tannic acid for 2 days, and then they were counter fixed in 2% osmium tetroxide for 2 hours. Following dehydration in ethanol, the cells were dried in a freeze-drying device (JEOL-JFD-310; JEOL, Tokyo, Japan) and coated with gold. SEM (JSM-6380Lv; JEOL Ltd., Tokyo, Japan) was used to compare the membrane alterations.
Flow cytometry analysis
The membrane permeability of the peptide was monitored by flow cytometry analysis by FITC-labeled Arminin 1a-C. In brief, K562/ADM cells were washed three times with PBS and were resuspended to obtain a 106/mL cell suspension. Then, 0.25 mL of Arminin 1a-C (final concentrations were 1.25 µM, 2.5 µM, 5 µM, 10 µM and 20 µM) was incubated with 0.25 mL of cell suspension for 15 minutes. A flow cytometer (Beckman Coulter, Inc., Brea, CA, USA) was utilized to obtain data, which were analyzed by CellQuest Pro software.
Circular dichroism (CD) spectrum
The secondary structure of Arminin 1a-C was analyzed by CD spectra using an Olis DSM 1000 CD spectrophotometer (Olis, Inc., Augusta, GA, USA) according to a previously reported protocol.24 The spectrophotometer was operated under a nitrogen flush with a 1 mm path length at room temperature. Arminin 1a-C was dissolved in trifluoroethanol (TFE; 50%, v/v, CAS number: 75-89-8; Sigma-Aldrich Co.) or 10 mM PBS (final concentration was 50 µM). Then, the spectra of these solutions were recorded between 195 nm and 240 nm using a quartz cuvette. The percentage of α-helical structure content was calculated according to the following formula:
where is the complete random coil ellipticity. is the mean ellipticity for complete helical conformation and is given by
where n is the chain length in residues and x is the number of non-H-bonded carbonyl groups in the peptides. For carboxyamidated peptides, Rohl and Baldwin25 proposed that x = 3.
Results
Peptides
Arminin 1a-C is composed of 31 amino acids, and the primary sequence and other biophysical parameters are summarized in Table 1. The HPLC chromatogram and MS are shown in Figures S1 and S2, respectively. The peptide contains a series of lysine and arginine residues located at different positions. Lysine, arginine and the N-terminus were considered to be positive charges. The C-terminus of this peptide is amidated, which makes Arminin 1a-C confer a charge of +13 together with other positive amino acids. The detailed biophysical property predictions of Arminin 1a-C were determined based on Srivastava and Ghosh26 The mean hydrophobicity (H) and hydrophobic moment of the peptide were calculated utilizing the consensus scale of hydrophobicity stated by Eisenberg and Mclachlan.27 The secondary structure of Arminin 1a-C was predicted by the software supplied by the web. The website is http://heliquest.ipmc.cnrs.fr/, and it showed that Arminin 1a-C adopted an α-helix structure according to the prediction software (Figure 1).28
Table 1
Amino acid sequence, molecular weight and biophysical parameters of Arminin 1a-C
Peptide
Sequence
Length (a.a)
MW
Net charge
pIa
Hydrophobicityb (H)
Hydrophobic momentb (μH)
M.cala
M.obs
Arminin 1a-C
KPWRFRRAIRRVRWRKVAPYIPFVVKTVGKK–NH
31
3,895.8
3,896.6
13
12.41
0.315
0.205
Notes:
Molecular weight was calculated, and the isoelectric point (pI) of Arminin 1a-C was estimated by http://web.expasy.org/compute_pi/.
The mean hydrophobicity and hydrophobic moment (µH) of Arminin 1a-C were calculated using the consensus scale of hydrophobicity proposed by Eisenberg and Mclachlan.27
Notes: The secondary structure of Arminin 1a-C was predicted by the website (http://heliquest.ipmc.cnrs.fr/). The red N represents N-terminal of the peptide sequence. The red C represent the C-terminal of the peptide sequence.
Cell proliferation inhibition activity of Arminin 1a-C against different cells
The proliferation inhibition activity of Arminin 1a-C against a panel of leukemia cells as well as normal cell lines was detected by the MTT assay. The results showed that Arminin 1a-C exhibited proliferation inhibition activity against a wide range of leukemia cell lines (Figure 2). The multidrug-resistant phenotype is not expressed in K562 cells, but it is overexpressed in K562/ADM cells, which is reflected by the different expression levels of P-glycoprotein (P-gp) in K562/ADM and K562 cells, respectively (Figure S3). As shown in Figure 1, both the proliferation of K562 and its drug-resistant cell line K562/ADM were inhibited by Arminin 1a-C. For other different leukemia cell lines, Arminin 1a-C also showed significant suppressive activity despite some differences in degrees between cell lines. All the proliferation inhibition activity occurred in a peptide concentration-dependent manner. For the normal cell lines, although Arminin 1a-C also exhibited a minor inhibition effect, the IC50 values of the normal cell lines were higher than the IC50 values of leukemia cell lines (Table 2). These results indicated that Arminin 1a-C may be considered as an efficient candidate against leukemia cells whether they were multidrug resistant or not, and they indicated selectivity between normal cells and leukemia cells.
Figure 2
Proliferation inhibition effects of Arminin 1a-C on leukemia cell lines and normal cell lines.
Notes: Cells were incubated with Arminin 1a-C (final concentrations were 1.25 µM, 2.5 µM, 5 µM, 10 µM and 20 µM) for 24 hours, and then the MTT assay was conducted. Error bars represent mean ± SEM determined by three independent experiments. (A) Leukemia cell lines; (B) normal cell lines.
Abbreviations: ADM, adriamycin; HEK293, human embryonic kidney cell line; HUVECs, human umbilical vein endothelial cells; PBMCs, peripheral blood mononuclear cells; SEM, standard error of the mean.
Table 2
In vitro anti-proliferation activity of Arminin 1a-C against different leukemia cell lines and normal cell lines
Cell proliferation assay, IC50 (μM)
Cell lines
K562/ADM
K562
HL-60
THP-1
Jurkat
HUVEC
HEK293
PBMCs
Arminin 1a-C
14.10
17.20
11.48
17.13
32.19
61.02
50.58
275.4
Notes:
IC50: peptide concentration at which cell viability was reduced to 50% compared with untreated cells.
Abbreviations: ADM, adriamycin; HEK293, human embryonic kidney cell line; HUVECs, human umbilical vein endothelial cells; PBMCs, peripheral blood mononuclear cells.
Arminin 1a-C showed negligible hemolytic activity against human erythrocytes
The cell selectivity of this peptide was checked by human erythrocyte lysis. As shown in Figure 3, although Arminin 1a-C displayed antileukemia activity at the concentration of 10 µM, it did not show any apparent hemolytic activity at this concentration. Even at concentrations up to 300 µM, only 15% lysis was observed. Therefore, the hemolytic activity may be negligible at its effective concentration. In comparison, LL-37, a well-studied AMP,29 showed approximately 35% hemolysis at the concentration of 300 µM. This result indicated that Arminin 1a-C showed specific cytotoxicity for leukemia cells relative to normal human erythrocytes.
Figure 3
The hemolytic activity of Arminin 1a-C was investigated by hemoglobin release assay. Fresh human erythrocyte suspension (100 µL) was incubated with Arminin 1a-C and LL-37 (final concentrations were 10 µM, 25 µM, 50 µM, 75 µM, 100 µM, 150 µM, 200 µM, 300 µM) for 60 minutes at 37°C.
Notes: Hemoglobin release was measured after centrifugation (1,000 ×g, 10 minutes) by a microplate reader at 490 nm. PBS and 0.2% Triton-X 100 were used as negative and positive controls, respectively.
Cytotoxicity of Arminin 1a-C against different cell lines
Potential cytotoxicity effects of Arminin 1a-C were also examined by assessing the activity of the cytoplasmic enzyme LDH in the culture medium of peptide-treated cells. According to the LDH assay, Arminin 1a-C caused a concentration-dependent increase in LDH release in the tested leukemia cell lines. By contrast, normal cell lines showed apparently much lower LDH release. As shown in Figure 4, significant differences were observed between the leukemia cell lines and the normal cell lines tested. This result was consistent with the hemolytic assay conducted previously, confirming the selective antileukemia activities of Arminin 1a-C.
Figure 4
Cytotoxicity effects of Arminin 1a-C on leukemia cell lines and normal cell lines.
Notes: Cells were treated with Arminin 1a-C and LL-37 (final concentrations were 1.25 µM, 2.5 µM, 5 µM, 10 µM, 20 µM and 40 µM) for 4 hours. Then, 100 µL of the cell culture supernatant was transferred to another microplate after centrifugation. After a 15-minute reaction with the LDH reaction mixture, the absorbances at 490 nm were recorded. (A) leukemia cell lines and (B) represents normal cell lines.
Arminin 1a-C induced PI permeation by disturbing multidrug-resistant leukemia cell membrane
As we know that PI is a fluorescent dye that can penetrate into cells, intercalate with their DNA and make the cells red when they die or when their membranes are compromised.30 The K562/ADM cell lines were incubated with Arminin 1a-C and then were stained with PI. Most K562/ADM cells treated with Arminin 1a-C turned to red, while the cells treated only with PBS did not show any fluorescence (Figure 5). These results showed that Arminin 1a-C disturbed the multidrug-resistant leukemia cell membrane, which led to PI passing through the membrane and binding to DNA.
Figure 5
Arminin 1a-C induced fluorescent dye PI permeation by disturbing multidrug-resistant leukemia cell membranes.
Notes: Multidrug-resistant K562/ADM cells were treated with 10 µM Arminin 1a-C or PBS alone for 30 minutes. PI dye was added to the cells for 10 minutes in the dark at room temperature. After washing the excessive dye, fluorescence images were taken by a fluorescence microscope. (A, B) K562/ADM cells were incubated with PBS alone. (C, D) K562/ADM cells were incubated with Arminin 1a-C.
Membrane morphological alterations induced by Arminin 1a-C
We speculated that Arminin 1a-C disturbed the multidrug-resistant leukemia cell membrane according to the PI uptake assay results. To give a more intuitive visualization, SEM was used to observe the effect of Arminin 1a-C on K562/ADM cell membranes. After treatment with 10 µM Arminin 1a-C, remarkable differences in the morphology between untreated and treated leukemia cells were discovered. As shown in Figure 5, untreated leukemia cells displayed a regular smooth surface, and cells were integrated (Figure 6A–C); however, the treated leukemia cells presented a cell membrane that was destroyed by pore formation (Figure 6D–F).
Figure 6
Morphological alteration of K562/ADM cell membranes after Arminin 1a-C treatment.
Notes: K562/ADM cells were treated with PBS or 10 µM of Arminin 1a-C for 30 minutes. Then, the cells were harvested and prepared to undergo SEM, which was used to compare the membrane alterations. (A–C) K562/ADM cells were incubated with PBS alone. (D–F) K562/ADM cells were incubated with 10 µM of Arminin 1a-C for 30 minutes.
Abbreviations: ADM, adriamycin; SEM, scanning electron microscopy.
Flow cytometry
To evaluate the affinity of Arminin 1a-C with multidrug-resistant leukemia cells, Arminin 1a-C was labeled with the fluorescent dye FITC and was analyzed by flow cytometry. Flow cytometry revealed a significant fluorescence shifting when K562/ADM cells were treated with different concentrations of FITC-labeled Arminin 1a-C (Figure 7). This result demonstrated that Arminin 1a-c showed a strong affinity with the cell membrane of multidrug-resistant cells, and this effect was concentration dependent with the peptide concentration increment. Meanwhile, the binding process occurred very quickly and was almost complete in a few minutes.
Figure 7
Affinity of Arminin 1a-C with multidrug-resistant cells. 106/mL K562/ADM cells were treated with FITC-labeled Arminin 1a-C for 15 minutes at 37°C in the dark. Then, a flow cytometer was utilized to monitor the fluorescence alteration.
As mentioned earlier, we predicted the secondary structure of Arminin 1a-C using a prediction software program, and it showed that Arminin 1a-C adopted an α-helix structure. To verify the accuracy of this prediction, CD spectroscopy was used to analyze the secondary structure of Arminin 1a-C. We analyzed the secondary structures of this peptide in two absolutely different environments: one was in PBS (to mimic a benign condition) and the other was in 50% TFE (mimicking the hydrophobic environment of the membrane). Our data exhibited that, in the benign condition, Arminin 1a-C adopted a typical random coil structure (Figure 8). In contrast, it exhibited two negative bands at 208 nm and 222 nm in 50% TFE. These results indicated that Arminin 1a-C took a typical α-helical structure in the membrane-mimicking environment, just as the prediction. Meanwhile, the α-helix contents of Arminin 1a-C in these two different environments were calculated and are summarized in Table 3.
Figure 8
The secondary structure of Arminin 1a-C in different environments was analyzed by CD spectra.
Notes: Arminin 1a-C (50 µM) was dissolved in 10 mM PBS or 50% TFE, respectively. PBS was used to mimic a benign condition, and 50% TFE was used to mimic the hydrophobic environment of the membrane.
With the recent developments in treatment strategies, complete remission of leukemia can be induced up to 60%–80% of new cases. However, a large proportion of patients still eventually die of this disease, and one of the most important reasons is the emergence of MDR.31 Under this background, new antileukemia drugs with different action mechanisms are urgently needed to cope with this problem. In this study, we investigated the in vitro activity of Arminin 1a-C, a novel AMP from ancient metazoan Hydra, against several leukemia cell lines, including both multidrug-sensitive and multidrug-resistant cell lines. The mechanism of its antileukemia activity was also preliminarily studied.Previous studies have shown that the mechanisms of gradual development of cancer cell resistance to chemotherapy involve altered interactions between the drug and its target, enhancement of the DNA damage repair ability, increment of drug transporters or drug detoxifying enzymes expression, and attenuation in the cellular machinery that mediates apoptosis.32,33 For example, the most studied MDR mechanisms are induced by the expression of a 170 kDa membrane glycoprotein (P-gp) that normally acts as a drug-efflux pump.34 Therefore, in this study, we first detected the P-gp expression between K562 and K562/ADM as given in the “Supplementary materials” section and found that P-gp was highly expressed in K562/ADM cells (Figure S3), and then we performed the following experiments. ADM, a traditional chemotherapy agent utilized to treat tumors (such as acute lymphocytic leukemia, lymphoma and breast cancer), has an IC50 against K562 cells and K562/ADM cells of 14 nM and 2,820 nM, respectively.35 In contrast, our results showed that the IC50 of Arminin 1a-C against K562 cells and K562/ADM cells was 17.20 µM and 14.10 µM, respectively. Arminin 1a-C not only inhibited the growth of multidrug-sensitive but also multidrug-resistant leukemia cells. It showed similar (LDH assay) or even better anti-proliferation activity (MTT assay) against K562/ADM cells compared with the sensitive leukemia cell lines, which suggested that this peptide was not affected by the P-gp-related mechanism of resistance. Moreover, Arminin 1a-C also exhibited obvious selectivity between noncancerous cells and the leukemia cells. LL-37 was the most studied AMP in host defense. Our previous study showed that LL-37 also had proliferation inhibition activity against leukemia cell lines.21 Its antileukemia activity was comparable with that of Arminin 1a-C. While its IC50 against PBMCs was 16.97 µM, which is much lower than that of Arminin 1a-C. Meanwhile, the hemolytic activity and cytotoxicity of LL-37 against noncancerous cells were higher than those of Arminin 1a-C, which are very important evaluation factors for potential anticancer agents. Taking all of these results into consideration, we speculated that the regular mechanism of P-gp-related resistance would not impact the action of Arminin 1a-C. It will be outstanding in the treatment of multidrug-resistant leukemia when compared with traditional chemotherapy drugs.P-gp transports endogenous phosphatidylserine (PS) to the outer leaflet of the cell membrane among a variety of substrates. This transport may contribute to the net negative charge of the cell membrane.34 According to the references, cancer cells consist of comparatively more PS in the outer leaflet of the membrane.35 In contrast, noncancerous plasma membranes do not have this characteristic.36,37 Therefore, increased exposure of negatively charged PS is one of the main differences between cancerous and noncancerous cells. This result has been demonstrated in our previous research. It showed that K562 and its resistant cell line K562/ADM express a much higher level of PS.38 This might be the reason why positively charged Arminin 1a-C not only showed higher inhibition activity against K562/ADM cells but also showed selectivity between leukemia and normal cells. Most of the currently used clinical antitumor chemotherapies show not only antitumor activity but also severe side effects. Compared with this, a main advantage of Arminin 1a-C is its cellular selectivity for leukemia cells. Therefore, it is expected to be an excellent candidate as a novel effective antileukemia agent that shows selective cytotoxicity.To date, most of the studied AMPs would disturb or interact with the target cell membrane, inducing cell death.4,39,40 It is not easy for tumor cells to develop resistance against AMPs since these processes need a total change of the cell membrane, which is related to multiple biochemical pathways and signaling pathways.33,41 Our results showed that Arminin 1a-C interacts with multidrug-resistant K562/ADM cells in a very rapid manner to form pores in the cell membrane. This process might induce the cytoplasm of K562/ADM leakage and finally cause death. Because this whole process happened in a few minutes, we speculated that it is difficult for K562/ADM cells to develop resistance against Arminin 1a-C.
Conclusion
We have first shown that the marine-derived α-helical AMP Arminin 1a-C exhibited growth inhibitory activity against different human leukemia cells regardless of whether it was multidrug resistant or not. Moreover, it did not have any obvious adverse effects on the viability of normal human cells and exhibited selectivity between noncancerous and cancerous cells. Arminin 1a-C acted quickly to disrupt the membrane of multidrug-resistant leukemia cells and formed pores in it. This process was finished in minutes, indicating that it was not easy for K562/ADM cells to develop resistance. All this information demonstrated that Arminin 1a-C possesses great potential and needs further studies to define its possible role as a therapeutic molecule in treatment of leukemia to counteract the MDR phenomenon.
Supplementary materials
Methods
P-glycoprotein (P-gp) protein test by flow cytometry
The expression level of P-gp is one of the parameters to consider whether it is a drug resistance or not in leukemic cells.1 To analyze the expression level of P-gp in K562 and K562/ADM cells, flow cytometry was used before other studies. K562 and K562/ADM cells were cultured as previously described. Then, the cells were harvested and incubated with the P-phycoerythrin (PE)-conjugated monoclonal antibody for surface expression of P-gp (Beckman Coulter, Inc., Brea, CA, USA) for 15 minutes. After that, cells were washed with PBS and analyzed using flow cytometry (Beckman Coulter).The HPLC chromatogram of Arminin 1a-C.Abbreviation: Conc, concentration.The MS of Arminin 1a-C.Abbreviations: ESI, electrospray ionization; MS, mass spectrometry; MW, molecular weight.The P-gp expression in K562 and K562/ADM cells analyzed by flow cytometry.Notes: Green A represents the percentage of positive fluorescence in K562 cells. Red B represents the percentage of positive fluorescence in K562/ADM cells.Abbreviations: ADM, adriamycin; P-gp, P-glycoprotein.
Authors: Rebecca L Siegel; Kimberly D Miller; Stacey A Fedewa; Dennis J Ahnen; Reinier G S Meester; Afsaneh Barzi; Ahmedin Jemal Journal: CA Cancer J Clin Date: 2017-03-01 Impact factor: 508.702
Authors: Vânia Vilas-Boas; Renata Silva; A Rita Gaio; Ana Margarida Martins; Sofia Costa Lima; Anabela Cordeiro-da-Silva; Maria de Lourdes Bastos; Fernando Remião Journal: Cytometry A Date: 2011-09-08 Impact factor: 4.355
Authors: Gergely Szakács; Jill K Paterson; Joseph A Ludwig; Catherine Booth-Genthe; Michael M Gottesman Journal: Nat Rev Drug Discov Date: 2006-03 Impact factor: 84.694