Literature DB >> 30400851

Genome sequence of the potato pathogenic fungus Alternaria solani HWC-168 reveals clues for its conidiation and virulence.

Dai Zhang1, Jia-Yu He1, Parham Haddadi2, Jie-Hua Zhu3, Zhi-Hui Yang4, Lisong Ma5.   

Abstract

BACKGROUND: Alternaria solani is a known air-born deuteromycete fungus with a polycyclic life cycle and is the causal agent of early blight that causes significant yield losses of potato worldwide. However, the molecular mechanisms underlying the conidiation and pathogenicity remain largely unknown.
RESULTS: We produced a high-quality genome assembly of A. solani HWC-168 that was isolated from a major potato-producing region of Northern China, which facilitated a comprehensive gene annotation, the accurate prediction of genes encoding secreted proteins and identification of conidiation-related genes. The assembled genome of A. solani HWC-168 has a genome size 32.8 Mb and encodes 10,358 predicted genes that are highly similar with related Alternaria species including Alternaria arborescens and Alternaria brassicicola. We identified conidiation-related genes in the genome of A. solani HWC-168 by searching for sporulation-related homologues identified from Aspergillus nidulans. A total of 975 secreted protein-encoding genes, which might act as virulence factors, were identified in the genome of A. solani HWC-168. The predicted secretome of A. solani HWC-168 possesses 261 carbohydrate-active enzymes (CAZy), 119 proteins containing RxLx[EDQ] motif and 27 secreted proteins unique to A. solani.
CONCLUSIONS: Our findings will facilitate the identification of conidiation- and virulence-related genes in the genome of A. solani. This will permit new insights into understanding the molecular mechanisms underlying the A. solani-potato pathosystem and will add value to the global fungal genome database.

Entities:  

Keywords:  Alternaria solani; Conidiation; Genome sequence; Secretome; Virulence

Mesh:

Substances:

Year:  2018        PMID: 30400851      PMCID: PMC6219093          DOI: 10.1186/s12866-018-1324-3

Source DB:  PubMed          Journal:  BMC Microbiol        ISSN: 1471-2180            Impact factor:   3.605


Background

Alternaria, a genus of ascomycete fungi, causes various disease symptoms, including root and stem rot, blight, and wilt on most economically important plants [1]. Alternaria solani is known as the causal agent of early blight of potato and tomato. Early blight of potato is a major foliar disease that is considered one of the most destructive diseases of potato worldwide, resulting in severe yield losses in many potato growing regions [1]. Understanding the factors influencing spore formation and identification of a wide range of secondary metabolites produced by A. solani have been the subject of extensive studies in the past many years. For example, Brian et al. first reported that Alternaric acid is a biologically active product of the fungus Alternaria solani [2, 3]. In addition, A. solani is capable of producing extracellular polysaccharides, carbohydrases, proteases, the new zinniol-related phytotoxins [4, 5], and other secondary metabolites during infection [6, 7]. It has been documented that sporulation of A. solani depends upon many factors such as mycelial wounding, temperature, visible light, water treatment, ozone and ultraviolet [8-11]. Growth characteristics, genetic and pathogenic variations of A. solani have been studied as well [12-17]. Based on these successful and progressive studies on A. solani, the interaction between A. solani and its host represents an excellent system that will enable researchers to study the pathogenic mechanisms between Alternaria species and their hosts. Conidiation (asexual sporulation) in filamentous ascomycetous fungi is a complex process involving the formation of conidia on conidiophores [18]. Many studies have been conducted to investigate the sporulation process, resulting in the identification of various environmental factors influencing sporulation, such as light, salt and nutrients and endogenous biological rhythms, but the light is regarded as one of the key environmental factors for regulating sporulation [19]. The molecular basis underlying the conidiation of Aspergillus nidulans and Neurospora crassa has been well studied, leading to the identification of a set of genetic regulators controlling the asexual sporulation in A. nidulans [20-22]. Activation of the transcription factor brlA gene by light has been demonstrated as an essential step of conidiation in A. nidulans [22, 23]. abaA gene is activated by BrlA and loss of abaA results in the formation of supernumerary tiers of cells with abacus-like structures [18, 24]. wetA gene induced by AbaA during the late stage of conidiation activates a set of genes responsible for the synthesis of cell wall layers and spore specific functions [25, 26]. These three sequentially expressed genes including brlA, abaA and wetA comprise a central regulatory pathway that controls the sporulation in A. nidulans [18, 24]. In addition to these three genes, six upstream developmental activators (fluG, flbA, flbB, flbC, flbD and flbE) have been identified by genetic studies on recessive mutations to cause defective conidiation [27]. StuA regulates transcription of the brlA gene and plays a key role in the structure and cell morphogenesis during the sexual and asexual phases of reproduction in A. nidulans [28, 29]. Previous studies have reported that nutrition, light spectrum and temperature are major factors that influence the sporulation of A. solani in vitro; however, the production of conidiospores is limited and variable among distinct isolates of A. solani and there is no a common practical protocol developed for the species. Therefore, understanding the molecular mechanism underlying the conidiation of A. solani is urgently required. Advances in next-generation sequencing (NGS) technologies are transforming biology research. The large-scale studies of fungal genome sequence have facilitated the discovery of molecular mechanisms underlying the virulence in plant fungal pathogens. Recently, several genome sequences of A. solani isolates have been reported including BMP0185, CBS109157 and altNL03003 [30-32]. Interestingly, the genome of A. solani altNL03003 isolated from a Dutch potato field has been sequenced using the long-read Pacific Biosciences (PacBio) sequencing technology. This has provided a gapless genome assembly and produced a genome size of 32.8 Mb [32]. The available Alternaria genome sequence database provides a useful resource to browse and visualize whole genome alignments, genome annotations, and identify homologous genes within the important saprophytic and plant/human pathogenic fungal genus [18, 33–36]. However, a detailed genome annotation and prediction of genes encoding secreted proteins remain unknown for A. solani, especially in the genome of A. solani isolate from China. Here, we present an accurate genome annotation and provide a prediction of conidiation and effector candidate genes from A. solani HWC-168, which holds the potential to advance our understanding of pathogenic mechanisms of A. solani.

Results

Genome sequencing and assembly

To gain a better understanding of A. solani genome, we generated a high-quality genome sequence of A. solani HWC-168 using an Illumina HiSeq 2000 sequencing platform. The high quality of genomic DNA isolated from the mycelium of A. solani HWC-168 was used to prepare libraries. Two independent DNA libraries were constructed: one with insert size 500 bp and second one with 5 kb insert size. Total 21.9 Gb and 33.7 Gb of high quality reads were generated from 500 bp library and 5 kb library, respectively. The genome coverage was 200-fold in the library containing insert size 500 bp and 308-fold in the library with 5 kb insert size. The reads generated from both libraries were assembled into 209 contigs and 61 scaffolds, among which the size of the longest scaffold was 5,423,972 bp and scaffold N50 having the size of 2,613,338 bp. The assembled genome size achieved was 32,838,780 bp, which agrees favorably with the reported genome size of A. solani of 32.6 to 32.9 Mb [31, 32]. The GC content of the genome was 51.20% of the total bases (Table 1).
Table 1

Summary of genome assembly and annotation features of A. solani, A. arborescens and A.brassicicola

A. arborescens EGS39–128 A. brassicicola ATCC 96836 A. solani HWC-168 A. Solani altNL03003
Genome
 IsolateEGS 39–128ATCC 96836HWC-168altNL03003
 Coverage (fold)906.4508> 150
 Genome size33,889,384 bp29,536,471 bp32,838,780 bp32,779,142 bp
 No. of contigs1332403920910
 Largest contig length1,056,452 bp87,976 bp1,075,562 bp7,235,174 bp
 N50 contig length310,86918,835564,368
 G + C content (%)50.950.751.251.2
Genes
 Number of genes11,04210,51410,358
 Gene density(genes/Mb)325356323
 Number of specific genes168918831632
Summary of genome assembly and annotation features of A. solani, A. arborescens and A.brassicicola

Repeat content in A. solani HC-168

To characterize the assembled genome, the repetitive elements were identified using the CENSOR prediction. In total, 24,896 repeat elements including DNA transposon, endogenous retrovirus, LTR retrotransposon, non-LTR retrotransposon, pseudogene, satellite and integrated virus were identified in the genome (Table 2). Our analysis revealed that the repeat content accounted for 6.95% of the gnome in length, which differs with that of A. solani CBS109157 [31]. The distribution of LTR retrotransposon was heavily dominant (3.3% of the entire genome) but DNA transposon (2.43%), Non-LTR retrotransposon (0.91%) and endogenous retrovirus (0.21%) were also highly represented. Based on the superfamily types, most common types of repetitive elements were represented in the A. solani genome with the dominant family being Gypsy (2.7% of the genome) and the most abundant family being Copia (0.67%) and EnSpm/CACTA (0.60%) and Mariner/Tc1 (0.45%).
Table 2

Summary of repetitive elements present in the genome of A. solani HWC-168

Repeat elementSuperfamiliesNumber of elementsLength occupied% of assembled genome
DNA transposon7633798,1982.43
EnSpm/CACTA1640198,0770.60
Hobo-Activator (hAT)1139100,7720.31
Mariner/Tc1901148,2180.45
MuDR75460,3320.18
Harbinger68752,7480.16
Polinton47659,1210.18
Helitron37427,3010.08
Kolobok23333,7320.10
Sola21020,0910.06
Crypton14610,0370.03
piggyBac13285750.03
Dada11692190.03
Endogenous Retrovirus106969,6200.21
ERV141427,7880.08
ERV236023,6100.07
ERV310266500.02
ERV47343850.01
LTR Retrotransposon11,8141,074,4793.30
Gypsy6875745,8382.27
Copia3378220,0000.67
BEL98958,9240.18
DIRS33921,7810.07
Non-LTR Retrotransposon4109297,6770.91
L1104966,6950.20
CR153844,4510.14
R131824,5130.07
Jockey28721,2780.06
RTE23215,2180.05
Tx121114,1760.04
I17511,3610.03
Tad116111,5740.04
L212181250.02
RTEX10681590.02
Pseudogene9416,5660.05
rRNA5713,6590.04
tRNA3729070.01
Satellite14514,7740.04
MSAT4065290.02
SAT6349700.01
Integrated Virus3217600.005
Caulimoviridae2915160.004
DNA Virus32440.001
TOTAL24,8962,273,0746.95
Summary of repetitive elements present in the genome of A. solani HWC-168

Comparison of genome assembly features within Alternaria species

The genome size of A. solani HWC-168 (32.8 Mb) was small compared to A. arborescens (33.9 Mb) but larger than A. brassicicola (29.5 Mb) [30]. It has approximately the same size as reported for A. solani altNL03003 (32.8 Mb) [32]. The average gene density in A. solani HWC-168 genome was 323 genes per Mb, which remains lower than that in A. brassicicola (356 genes per Mb) and A. arborescens (325 genes per Mb). Next, we compared the whole genome assembly features of A. solani HWC-168 with those of sequenced A. arborescens EGS 39–128, A. brassicicola ATCC 96836 and A. solani altNL03003 genomes (Table 1). Compared to A. arborescens and A. brassicicola, our genome assembly was superior because it featured the greatest genome coverage, the minimum number of contigs and largest N50 contig length (Table 1). However, compared to A. solani altNL03003, a large number of contigs was observed in our assembly (Table 1). In addition, we compared the gene distribution in the three annotated A. brassicicola, A. arborescens and A. solani HWC-168 genomes by calculating the intergenic distance between adjacent genes. Figure 1 showed that the distributions of intergenic distances in A. solani HWC-168 genome were similar to those in the genome of A. brassicicola. However, the distributions of intergenic distances in A. arborescens genome were less variable and genes in A. arborescens genome were more closely spaced than the analyzed A. solani and A. brassicicola genomes (Fig. 1).
Fig. 1

Distribution of intergenic distances of all predicted genes present in the genome of A. solani HWC-168 compared with A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. Scatterplot representing 5′ and 3′ intergenic distances for all genes present in the genome. Red circles indicate the predicted genes

Distribution of intergenic distances of all predicted genes present in the genome of A. solani HWC-168 compared with A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. Scatterplot representing 5′ and 3′ intergenic distances for all genes present in the genome. Red circles indicate the predicted genes

Gene prediction and functional annotation

To predict complete genes in A. solani HWC-168 genome, we used the Augustus version 2.5.5 [53]. The analysis resulted in 10,358 complete genes in the genome of A. solani HWC-168. PanOCT analysis was employed to examine the orthologous gene clusters among predicted genes of A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. The total number of predicted genes, core genes, clusters of orthologous groups (COGs) and shared COGs were summarized in the Venn diagram for ortholog clusters in these three genomes (Additional file 1). The three genomes shared a core set of 3460 COGs and 6879 core genes. In addition, there were 8304 genes shared between A. solani HWC-168 and A. arborescens EGS 39–128, which was higher than that between A. solani HWC-168 and A. brassicicola ATCC 96836 (7301), and also higher than that between A. arborescens EGS 39–128 and A. brassicicola ATCC 96836 (7204). Taken together, these observations strongly indicate that significant gene variations including gene numbers and COGs exist in these closely related Alternaria strains, suggesting that these three Alternaria strains might have diverged in the genome evolution. To annotate the predicted genes and assign Gene Ontology (GO) functions to them, predicted proteins from A. arborescens EGS39–128, A. brassicicola ATCC 96836 and A. solani HWC-168 were searched for homology to entries in the NCBI Ref Seq protein database, GO and InterPro databases using Blast2Go-PRO, respectively. As shown in Fig. 2, annotated genes contributing to the general function, amino acid transport and metabolism and carbohydrate transport and metabolism were predominant within the comparison of GO terms of three Alternaria genomes. However, further comparison of GO terms between these three Alternaria isolates revealed that the number of genes from each GO category was similar between A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. In addition, we analyzed the GO functions of core genes and species-specific genes between A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. A functional GO analysis determined that core genes and species-specific genes involved in general function dominated and that the second most abundant genes were related to translation, ribosomal structure and biogenesis (Fig. 3).
Fig. 2

Gene Ontology (GO) classification of genes predicted from the genome of A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. Predicted genes are assigned to 24 categories in the GO classification. The x-axis legend shows a description of the 24 functional categories and the y-axis indicates the number of genes in a specific function cluster. Among the 24 categories, the cluster of ‘general function prediction’ has the highest number of genes, followed by amino acid transport and metabolism and carbohydrate transport and metabolism

Fig. 3

Gene Ontology (GO) classification of core and species-specific genes identified from comparison of A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836 genomes. Predicted core and species-specific genes are assigned to 24 categories in the GO classification. The x-axis legend shows a description of the 24 functional categories and the y-axis indicates the number of genes in a specific function cluster. Among the 24 categories, the cluster of ‘general function prediction’ contains the highest number of core and species-specific genes, followed by translation, ribosomal structure and biogenesis

Gene Ontology (GO) classification of genes predicted from the genome of A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836. Predicted genes are assigned to 24 categories in the GO classification. The x-axis legend shows a description of the 24 functional categories and the y-axis indicates the number of genes in a specific function cluster. Among the 24 categories, the cluster of ‘general function prediction’ has the highest number of genes, followed by amino acid transport and metabolism and carbohydrate transport and metabolism Gene Ontology (GO) classification of core and species-specific genes identified from comparison of A. solani HWC-168, A. arborescens EGS 39–128 and A. brassicicola ATCC 96836 genomes. Predicted core and species-specific genes are assigned to 24 categories in the GO classification. The x-axis legend shows a description of the 24 functional categories and the y-axis indicates the number of genes in a specific function cluster. Among the 24 categories, the cluster of ‘general function prediction’ contains the highest number of core and species-specific genes, followed by translation, ribosomal structure and biogenesis

Secretome of A. solani HWC-168

By using SignalPv4.0, TMHMM-2.0, TargetPv1.01, and big-PI Predictor, we searched the genome of A. solani HWC-168 for secreted protein-encoding genes, which might act as effector candidate genes. Nine hundred seventy five secreted protein-encoding genes were identified, which accounted for 9.4% of the total predicted genes.

Cell wall degrading enzymes

The majority of the secreted proteins were identified as cell wall degrading enzymes (CWDEs) involved in plant cell degradation. In addition, other enzymes that participate in various cellular metabolisms and non-enzyme proteins that maintain cellular energy and transport were also identified among these secreted proteins. Interestingly, we found that some secreted proteins identified from the secretome of A. solani HWC-168 were assigned to the same functional annotation but had differing functional classification (Additional file 2), suggesting that these secreted proteins may play important roles in various cellular activities.

Carbohydrate-active enzymes and proteins with other predicted functions

The A. solani HWC-168 secretome possessed 261 secreted carbohydrate-active enzymes (CAZymes) with predicted activities (Fig. 4). One protease and one SnodProt elicitor belonging to the cerato-platanin protein (CPP) family were identified within the secretome of A. solani HWC-168. Surprisingly, a secreted protein exhibiting sequence homology to a superoxide dismutase was identified in the secretome of A. solani HWC-168. It has been reported that the superoxide dismutase is involved in inhibiting oxidative damage of pathogens and plant resistance [37, 38]. Furthermore, three trihydrophobins that are commonly found in the surface of aerial hyphae or fruiting body in fungi were predicted to be secreted [14, 15]. The presence of trihydrophobins in the secretome of A. solani HWC-168 suggests their potential roles in fungal development, morphological differentiation and pathogenicity.
Fig. 4

Graphical representation of predicted carbohydrate-active enzymes encoding genes in the genome of A. solani HWC-168. Total 261 predicted CAZymes are identified and they are divided into six sub-groups including 65 auxiliary activity (AA), 17 polysaccharide lyase (PL), 9 glycosyl transferase (GT), 94 glucoside hydrolase (GH), 33 carbohydrate esterases (CE) and 17 carbohydrate-binding molecules (CBM). Glucoside hydrolase is predominant in all predicted CAZymes

Graphical representation of predicted carbohydrate-active enzymes encoding genes in the genome of A. solani HWC-168. Total 261 predicted CAZymes are identified and they are divided into six sub-groups including 65 auxiliary activity (AA), 17 polysaccharide lyase (PL), 9 glycosyl transferase (GT), 94 glucoside hydrolase (GH), 33 carbohydrate esterases (CE) and 17 carbohydrate-binding molecules (CBM). Glucoside hydrolase is predominant in all predicted CAZymes

RxLx[EDQ] effector candidates

The RxLx[EDQ] motif functions as a host-targeting signal to deliver virulence proteins of Plasmodia falciparum into host cells [39]. The secretome of A. solani HWC-168 contained 119 secreted proteins possessing the RxLx[EDQ] motif (where x represents any amino acid). One of important criteria for effector prediction appears to be protein size less than 300 amino acids. Based on this criterion, 12 effector candidate proteins carrying RxLx[EDQ] motif within 120 amino acids downstream of N-terminal signal peptide were identified (Table 3). WEBLOGO analysis revealed that amino acids Arginine (R) in position 1 and Leucine (L) in positon 3 and glutamic acid (E)/ aspartic acid (D)/glutamine(Q) in the 5 position were highly conserved in the RxLx [EDQ] motif. By contrast, bilateral amino acid sequences surrounding the RxLx[EDQ] motif were not conserved and tended to be highly variable (Fig. 5a). In addition, we found that the continuous aspartic acid (D), glutamic acid (E) and glutamine (Q) residues were present in the downstream of the RxLx[EDQ] motif but with variable locations (Fig. 5b). Due to the important roles of RxLR effectors in the pathogenicity of Phytophthora infestans, functional analysis of the RxLx[EDQ] motif-containing proteins in the secretome of A. solani HWC-168 will be the focus for future research.
Table 3

List of predicted effector candidates carrying the RxLx[EDQ] motif

NameSizeStart of sequence
ASLO_253148MKFTLAIVALASVATTALANREWTYNDSHRAAVTAILKQITAKHAHLCKR
ASLO_323134MKLAIAALFASITAAAPTATPDVHGDPFETVTISNFVYVGVNGYPQIDFH
ASLO_2101114MQIMNLAVLAATLATVGAWTLDDYGKWVANNAWRDNLNGVHKVHESCAER
ASLO_4082266MKFLAIIVAAQLATALPVAKEACSSTDITCSATKANPQIFDVASQQLDNS
ASLO_5583205MVSFRNLFTAAMALSVPVAAVLTPAQIVDNIRILTQKSQALQAPAQSITI
ASLO_5663199MASSIPDHWLWLGLGVFTFIAVQQVSHGLHTIRALTEIRNPQNMPQQRRA
ASLO_6610169MLGRTVFAATFFALAQFAMASPPSCLLGAVNQYEDPSDIKAVCKARNLSE
ASLO_6668183MFLPTALLALVHLALPALSHASPQPALVSSDWEMSLVPRHQLFLRQLSDL
ASLO_8389252MYSKTAIVTFFAGFAAAQIHAPVGEPSGNPITRPLNEVVPTCEQFTITWQ
ASLO_8909270MAKLIDLSTEVLFLIVAYFTSGDASDVQALLHLCRTSRMLVAVAQPALYT
ASLO_9385163MHFSVIFSAVFAATAMAAPASLDSRGDEDCVPDSYTISDYTLITSPTSGS
ASLO_10144244MLSNLMNRFALPLAILAFFLSFANGLPHDALIARRTTNLRILPLGDSITW
Fig. 5

Schematic representation of amino acid sequences alignment of 12 RxLx-motif containing effector candidates. a. Sequence logo derived from 12 predicted secreted effector candidates carrying the RxLx[EDQ] motif located within the region of 120 amino acids downstream of the N-terminal signal peptide. b. the conserved amino acids in the RxLx[EDQ] motif are highlighted and the downstream EDQ amino acids are marked with a red rectangle

List of predicted effector candidates carrying the RxLx[EDQ] motif Schematic representation of amino acid sequences alignment of 12 RxLx-motif containing effector candidates. a. Sequence logo derived from 12 predicted secreted effector candidates carrying the RxLx[EDQ] motif located within the region of 120 amino acids downstream of the N-terminal signal peptide. b. the conserved amino acids in the RxLx[EDQ] motif are highlighted and the downstream EDQ amino acids are marked with a red rectangle

Unique secreted proteins

We observed that 27 predicted genes encoding secreted proteins were completely absent in the genome of A. arborescens and A. brassicicola (Additional file 3). As a consequence, the function of these secreted proteins remains unknown due to the lack of homology with known proteins. Interestingly, from 27 species-specific genes we identified 3 pairs of neighbor genes that reside on three different scaffolds: scaffold 18, scaffold 21 and scaffold 8, respectively (Additional file 4). These findings suggest that the presence of these species-specific secreted protein-encoding genes in the genome of A. solani HWC-168 may have originated by two possibilities: either the genome of A. solani HWC-168 possesses a large genomic fragment that is missing in other Alternaria genomes or the genomic databases of A. arborescens and A. brassicicola are incomplete because only their draft genomes are reported, which has resulted in the absence of these secreted proteins. Functional analysis of these species-specific secreted proteins in A. solani HWC-168 is under way in our laboratory.

Prediction of conidiation-related genes

Our earlier studies revealed that it was difficult to induce conidiation in our A. solani isolates under artificial culturing condition. However, A. solani HWC-168 is capable of yielding copious conidiospores when its mycelia are radiated by ultraviolet (UV light) (Additional file 5). To identify genes involved in conidiation, we retrieved the central regulatory genes participating in the conidiation from the genome of Aspergillus nidulans and blasted the brlA sequence and other sporulation related genes, such as abaA, wetA, stuA, fluG, flbA, flbC, flbD, flbE, medA and fadA, to the predicted protein database of A. solani. Our results showed that homologous genes including fluG, flbA, flbC, flbE, brlA, stuA, abaA, wetA, medA and fadA existed in the genome of A. solani-HWC168. Based on the proposed conidiation model in Aspergillus nidulans and the identified conidiation-related genes in A. solani HWC-168, we propose a potential conidiation pathway in A. solani HWC-168 (Fig. 6).
Fig. 6

Schematic representation of a proposed model illustrating the regulatory pathway of asexual sporulation in A. solani

Schematic representation of a proposed model illustrating the regulatory pathway of asexual sporulation in A. solani

Discussion

Pathogenic A. solani strains are increasingly posing a critical threat to world food security. Sequencing the whole genome of A. solani is a key step to facilitate the study of the molecular mechanisms underlying the interaction between potato and A. solani. Here, we presented the completed genome sequence and annotation of A. solani HWC-168 generated by advanced next-generation Illumina sequencing technology. The quality of the genome sequence was guaranteed by using two individual sequencing libraries. The genome sequence data of A. solani HWC-168 has the potential to facilitate a future study on the molecular basis of A. solani virulence. Genomes of three A. solani isolates have been sequenced in the past [30-32]. The assembled genome size of A. solani ranges from 32.6 to 32.9 Mb. Our sequenced A. solani HWC-168 produced a genome size of 32.8 Mb, which compares favorably with the reported genome size of A. solani altNL03003 (Table 1). The genome of A. solani altNL03003 had been sequenced using the long-read Pacific Biosciences (PacBio) sequencing technology, which provided a gapless genome assembly. Although we sequenced the genome of A. solani HWC-168 using the second-generation sequencing technology, the same genome size was produced with A. solani altNL03003 but the assembled contig number of A. solani HWC-168 being higher than that of A. solani altNL03003. This suggests a high-quality genome assembly of altNL03003 has been obtained. However, we were not able to compare our predicted genes with those of A. solani altNL03003 because of the lack of annotation data of A. solani altNL03003. By searching our predicted RxLx[EDQ] effector candidates and conidiation-related genes in the genome of A. solani altNL03003, we found that all of them were present in the genome of A. solani altNL03003 (Additional file 3 and unpublished data). This observation strongly suggests that the genome annotation of A. solani HWC-168 is accurate. It has been reported that the repeat content in the genome of A. solani CBS109157 is relatively low with only 1.5% [31]. Surprisingly, we found that the percentage of repeat content of A. solani HWC-168 was relatively high with 6.95% although both of them have similar genome size. This apparent discrepancy requires future study to identify repeat contents from the gapless assembled genome of A. solani altNL03003. Asexual sporulation is a common reproduction strategy in filamentous fungi. Although they vary in morphology and function, conidia in higher fungi are developed from specialized sporogenous cells or asexual propagules. The conidiation-related processes are complicated, including the space-time regulation of conidiation-related genes, cell specialization and cell signal transduction, etc. The genetic mechanism of conidiation in Aspergillus nidulans has been well studied [40, 41]. However, the molecular basis underlying conidiation in A. solani remains unclear. Elucidation of genes regulating the conidiation process is essential to our understanding of asexual reproduction in A. solani species. Here, we first presented the evidence that the central regulatory factors of conidiation identified from Aspergillus. nidulans including abaA, wetA, StuA, FluG and FlbA genes are present in the genome of A. solani HWC-168. This suggests a similar molecular mechanism of sporulation is employed by A. solani; however, these homologous conidiation-related genes in A. solani are putative and functional confirmation is required. We are examining the expression profiles of predicted conidiation-related genes (unpublished data). We are confident that future studies designed to elucidate the molecular basis of conidiation will provide the impetus to develop novel strategies to prevent sporulation in order to control disease development caused by A. solani on potato. The secreted fungal enzymes in pathogenic fungi play important roles in pathogenicity. Here, we found that the secreted enzymes in A. solani HWC-168 contain a large number of cellulases and pectinases. Previous studies showed that cellulases and pectinases in Alternaria species play key roles in degrading the plant cell wall during infection [42-44]. Thus, we proposed that cellulases and pectinases in A. solani play important roles in infecting the host and causing degradation of host cell wall. In our work, a total of 975 predicted secreted proteins were identified in the genome of A. solani HWC-168, comprising 261 CAZymes, 119 RxLx[EDQ] motif containing secreted proteins and 27 species-specific secreted proteins. It remains unknown how these species-specific secreted proteins contribute to the pathogenicity of A. solani HWC-168. However, we speculate that some of the proteins might function inside plant cells, which has been widely reported in the effector proteins of rust and oomycete plant pathogens [45-48]. Translocation of rust and oomycete effector proteins into plant cell largely depends on the conserved RxLx-motif [46, 47]. In the secretome of A. solani HWC-168, 12 RxLx-motif containing effector candidate proteins were found, which indicates that they might serve as virulence factors during A. solani infection. Recent reports showed that RxLR effectors from various fungal pathogens are involved in virulence, which will broaden the implications of our findings [49]. The RxLx-motif containing effectors involving in the pathogenicity during the interaction between A. solani HWC-168 and potato will be further investigated.

Conclusions

In this study we developed and annotated the complete genome sequence of A. solani HWC-168, and predicted the conidiation-related genes and the secretome that contains the virulence-related genes. To our best knowledge, this is the first time that the effector candidate genes and conidiation-related genes have been predicted in the genome of A. solani, which will facilitate the identification and functional analysis of conidiation- and virulence-related genes in A. solani. Availability of the genome sequence of A. solani HWC-168 and its host potato coupled with advanced genetic and molecular approaches will enable an understanding of the molecular mechanisms underlying the A. solani-potato pathosystem.

Methods

Strain and culture conditions

The strain A. solani HWC-168 was isolated from the infected leaves of potato in Weichang County Hebei province in China. All Alternaria isolates were cultured on potato dextrose agar (PDA). Mycelia were obtained by growing the isolate for at least 7 days on PDA plates.

Genomic DNA preparation and library construction

The mycelia were harvested by filtration and frozen at − 20 °C. DNA was extracted from the mycelia according to a modified etyltrimethylammonium bromide procedure (CTAB) [50]. Following DNA fragmentation, we constructed two genomic sequencing libraries: one is a paired-end library with 500 bp inserts and another is a mate-pair library with 5 kp insertion fragments. The paired-end library was constructed using the Paired-End DNA sample Prep Kit (Illumina, USA) following the protocols provided by the manufacturer. The mate-pair library was constructed using the Nexera Mate Pair Library Prep Kit (Illumina, USA) following the protocols provided by the manufacturer. Two constructed libraries were sequenced by using the Illumina GA II technology (Illumina, USA) Hiseq 2000 platforms at the Beijing Genomics Institute using the WGS (whole genome sequencing) method. The read length is 150 bp. Low-quality data containing a quality value of less than 20 and short reads (length 35 bp) were filtered from raw data by Dynamic Trim and Length Sort Perl program in the SolexaQA software [51]. SOAPdenovo software (http://soap.genomics.org.cn) was used to assembly sequences and gaps were immerged by SOAP Gap Closer software (http://soap.genomics.org.cn) [52]. ORFs (open reading frames) were predicted by Augustus 2.5.5 software [53], and were aligned with homologous proteins in the NCBI database (http://www.ncbi.nlm.nih.gov/). All confirmed ORFs were aligned with COG (Clusters of Orthologous Groups) in the NCBI database, and were classified by function based on alignment results and classification standards of COG. Repetitive elements were identified by CENSOR (http://www.girinst.org/censor) following the default parameters.

Genome comparison

The genome comparison was performed among A. solani HWC-168, A. arborescens and A. brassicicola. Multiple sequence alignments of genomes were performed with Mugsy [54]. The homologous genes were aligned using PanOCT software [55] by designating the parameter values: protein sequence with > 60% identity, aligned length > 30% and E value less than 1e-5, the Intergenic distance was calculated using the method described previously [56].

Secreted protein annotation and prediction

The secreted proteins putatively encoded in the genome of A. solani HWC-168 were predicted by SignalPv4.0 (http://www.cbs.dtu.dk/services/SignalP/), TMHMM-2.0 (http://www.cbs.dtu.dk/services/TMHMM-2.0/), TagetPV1.01 (http://www.cbs.dtu.dk/services/TargetP/), and Big-pi (http://mendel.imp.ac.at/gpi/fungi_server.html). In detail, we followed the effector prediction pipeline described previously [57]. We first searched the ones with the presence of an N-terminal signal peptide through signalIP4.1. Then, we excluded the ones with a predicted transmembrane domains using TMHMM-2.0. Next, we detected the presence of subcellular localization signals using TargetP and glycosylphophatidylinositol (GPI) anchor to the membrane and filtered out the ones with mitochondrial localization and then the ones with GPI. The secreted proteins in A. arborescens and A. brassicicola were predicted by using the same method. The secreted proteins in A. solani HWC-168 were used as inquiring sequences to search against the secretomes of A. arborescens and A. brassicicola by BLASTP. The parameter values were designated as E-value < 10− 5 and identity > 30%. The secreted proteins with no homologous ones in A. arborescens and A. brassicicola were defined as species-specific proteins in A. solani HWC-168.

Carbohydrate-active enzyme annotation

All putative proteins of A. solani HWC-168 were searched against entries in the CAZy database by using CAZymes Analysis Toolkit [58] using the Carbohydrate Active Enzymes (CAZy) database (http://www.cazy.org). The parameter values were in default on the website. All identified proteins were then manually retrieved.

Prediction of proteins with a RxLx[EDQ]

The predicted secreted proteins in A. solani HWC-168 were examined with the presence of the conserved host-targeting motif RxLx[EDQ]by using the MEME prediction server (http://meme-suite.org/tools/meme) with default parameters. The amino acids in the conserved RxLx[EDQ] motif were aligned by WEBLOGO software [59]. Venn-diagram showing the cluster of orthologous group (COGs) genes for related three strains including A. solani, A. arborescens and A. brassicicola. Ortholog clusters were computed by using PanOCT with set parameter cutoffs (E value < 10− 5; match length > 30%; identity > 60%). (DOCX 137 kb) Representative enzymes with the same function but involving in different biological activities. (DOCX 14 kb) Twenty seven species-specific secreted proteins based on the prediction. (DOCX 17 kb) Three pairs of specific neighbor genes reside on three different scaffolds. (DOCX 14 kb) Conidia and conidiophores formed by A. solani HWC-168 were visualized under microscopy. (DOCX 154 kb)
  50 in total

1.  Aspergillus asexual reproduction and sexual reproduction are differentially affected by transcriptional and translational mechanisms regulating stunted gene expression.

Authors:  J Wu; B L Miller
Journal:  Mol Cell Biol       Date:  1997-10       Impact factor: 4.272

2.  Aspergillus nidulans wetA activates spore-specific gene expression.

Authors:  M A Marshall; W E Timberlake
Journal:  Mol Cell Biol       Date:  1991-01       Impact factor: 4.272

3.  Inducing sporulation in Alternaria solani. II. Effect of light.

Authors:  B Prasad; B L Dutt
Journal:  Mycopathol Mycol Appl       Date:  1974-10-15

4.  Production of exocellular polysaccharides by Alternaria solani.

Authors:  J L Goatley
Journal:  Can J Microbiol       Date:  1968-10       Impact factor: 2.419

5.  Inducing sporulation in different strains of Alternaria solani. II. Effect of ultraviolet light.

Authors:  B M Singh
Journal:  Mycopathol Mycol Appl       Date:  1967-07-13

6.  Conidium differentiation in Aspergillus nidulans wild-type and wet-white (wetA) mutant strains.

Authors:  T C Sewall; C W Mims; W E Timberlake
Journal:  Dev Biol       Date:  1990-04       Impact factor: 3.582

7.  SOAPdenovo2: an empirically improved memory-efficient short-read de novo assembler.

Authors:  Ruibang Luo; Binghang Liu; Yinlong Xie; Zhenyu Li; Weihua Huang; Jianying Yuan; Guangzhu He; Yanxiang Chen; Qi Pan; Yunjie Liu; Jingbo Tang; Gengxiong Wu; Hao Zhang; Yujian Shi; Yong Liu; Chang Yu; Bo Wang; Yao Lu; Changlei Han; David W Cheung; Siu-Ming Yiu; Shaoliang Peng; Zhu Xiaoqian; Guangming Liu; Xiangke Liao; Yingrui Li; Huanming Yang; Jian Wang; Tak-Wah Lam; Jun Wang
Journal:  Gigascience       Date:  2012-12-27       Impact factor: 6.524

8.  AbaA regulates conidiogenesis in the ascomycete fungus Fusarium graminearum.

Authors:  Hokyoung Son; Myung-Gu Kim; Kyunghun Min; Young-Su Seo; Jae Yun Lim; Gyung Ja Choi; Jin-Cheol Kim; Suhn-Kee Chae; Yin-Won Lee
Journal:  PLoS One       Date:  2013-09-10       Impact factor: 3.240

9.  Alternaria section Alternaria: Species, formae speciales or pathotypes?

Authors:  J H C Woudenberg; M F Seidl; J Z Groenewald; M de Vries; J B Stielow; B P H J Thomma; P W Crous
Journal:  Stud Mycol       Date:  2015-08-25       Impact factor: 16.097

10.  Draft Genome Sequence of Alternaria alternata Isolated from Onion Leaves in South Africa.

Authors:  Wubetu Bihon; Michele Cloete; Abe Shegro Gerrano; Dean Oelofse; Patrick Adebola
Journal:  Genome Announc       Date:  2016-09-22
View more
  1 in total

1.  Mechanism of a Volatile Organic Compound (6-Methyl-2-Heptanone) Emitted From Bacillus subtilis ZD01 Against Alternaria solani in Potato.

Authors:  Dai Zhang; Ran Qiang; Jing Zhao; Jinglin Zhang; Jianing Cheng; Dongmei Zhao; Yaning Fan; Zhihui Yang; Jiehua Zhu
Journal:  Front Microbiol       Date:  2022-01-13       Impact factor: 5.640

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.