Literature DB >> 30387827

Hepatitis B virus core protein dimer‑dimer interface is critical for viral replication.

Chang-Long Zheng1, Yong-Mei Fu1, Zhan-Xue Xu2, Yong Zou3, Kai Deng4.   

Abstract

Hepatitis B virus (HBV) core protein (HBc) serves pivotal roles in the viral life cycle, particularly serving as the basic unit for capsid assembly, and is closely associated with HBV genome replication and progeny virion production. Previous studies have demonstrated that HBc has at least two functional interfaces; two HBc monomers form a homodimer via an intradimer interface, and then 90 or 120 homodimers form an icosahedral capsid via a dimer‑dimer interface. In the present study, the role of the HBc dimer‑dimer interface in HBV replication was investigated. A panel of residues located at the dimer‑dimer interface were identified based on the crystal structure of HBc. Native gel electrophoresis and western blotting revealed that, despite mutations in the dimer‑dimer interface, HBc formed a capsid‑like structure, whereas mutations at amino acid residues 23‑39 completely disrupted capsid assembly. Using denaturing gel electrophoresis, Southern and Northern blotting, and quantitative polymerase chain reaction, it was demonstrated that none of the mutations in the dimer‑dimer interface supported pregenomic RNA encapsidation or DNA replication. In addition, these mutants interacted with the wild-type (WT) HBc monomer and inhibited WT genome replication and virion production in a dose‑dependent manner. However, the quantity of covalently closed circular DNA in the nucleus was not affected. The present study highlighted the importance of the HBc dimer‑dimer interface for normal capsid function and demonstrated that the HBc dimer‑dimer interface may be a novel antiviral target.

Entities:  

Mesh:

Substances:

Year:  2018        PMID: 30387827      PMCID: PMC6297743          DOI: 10.3892/mmr.2018.9620

Source DB:  PubMed          Journal:  Mol Med Rep        ISSN: 1791-2997            Impact factor:   2.952


Introduction

Hepatitis B virus (HBV) infects ~350 million people worldwide and is one of the most serious public health problems (1). The virus belongs to the Hepadnaviridae family and contains a 3.2-kb partially double-stranded circular genome; HBV may be one of the smallest of microbial pathogens affecting humans (2). HBV replication is highly dependent on the accurate assembly of the capsid, which is also associated with the covalently closed circular DNA (cccDNA) reservoir for persistent infection (3,4). Following translation from full-length pregenomic RNA (pgRNA), hepatitis B virus core (HBc) protein interacts with pgRNA, reverse transcriptase, and host factors to form icosahedral-shaped capsids and initiate viral replication (5). The HBV capsid is closely associated with genome replication (3). A few small molecules, including GLS4, Huntingtin-associated protein 1 and AT130, disrupt capsid formation and inhibit viral replication (6–9). These molecules alter the structure and disrupt the function of capsids (7). In addition, capsids have been considered to mediate the regulation of HBV replication (10). The secreted hepatitis B e-antigen, which has a structure similar to that of HBc, may interact with HBc monomers and form aberrant capsids that do not support the pgRNA package (10). HBc, which forms the icosahedral shell of capsids, consists of 183 or 185 amino acid residues (aa), depending on genotype (11). The primary structure of the core protein can be divided into two domains, namely, the N-terminal, which consists of 149 or 151 aa, depending upon the genotype, and directs HBc self-assembly (12,13); the C-terminal constitutes 34 aa and is rich in arginine residues, essential for capsid formation. The deletion of the C-terminal domain inhibits pgRNA encapsidation (14). Capsid assembly consists of two steps, in which HBc monomers initially associate to yield a dimer intermediate via an intradimer interface (15). Numerous dimers subsequently form an intact capsid via a dimer-dimer interface. Whether higher-order HBc oligomers exist remains controversial (16). Several studies have proposed that aa 113–143 of HBc form the main dimer-dimer interface (17,18). In the present study, the aim was to identify a panel of residues located at the dimer-dimer interface based on the HBc crystal structure, and to investigate their effect on capsid function and viral replication. The results demonstrated that the HBc dimer-dimer interface was required for capsid assembly and viral replication. Targeting the dimer-dimer interface may be a novel and powerful antiviral strategy.

Materials and methods

HBc crystal structure

The crystal structure of HBc was downloaded from the PDB (1QGT, http://www.rcsb.org/pdb/home/home.do). The dimer-dimer interface domains were visualized and mapped using Swiss-PdbViewer v4.0 software (http://www.expasy.org/spdbv/).

Plasmids

The 1.2-length (3,215 bp) HBV adw genome (GenBank accession no. AY518556; http://www.ncbi.nlm.nih.gov/genbank/) was obtained from the pHBV1.2 plasmid and inserted into pUC18 vector (Thermo Fisher Scientific, Inc., Waltham, MA, USA) under the control of the lac promoter, and was employed in the present study. Plasmid pHBV1.2-core− was derived from pHBV1.2 by introducing a stop codon (TAT→TAG) into the C gene at the Y38 position and ligating to pUC18 vector by HindIII and PshAI digestion, thereby preventing HBc production. In addition, the plasmid 1–183 flag, which directs the expression of the HBc gene under the control of the cytomegalovirus promoter, was generated using XbaI and EcoRI enzymes, the pcDNA3.1 vector, along with a FLAG tag (N-DYKDDDDK-C) fused to the C-terminus.

Site-directed mutagenesis

All HBc mutant plasmids (pHBc14-18M, pHBc120-135M, pHBc23-39M and pHBc122-139M) were derived from the 1–183 flag plasmid. The altered residues of each domain were presented in Table I. Acidic amino acids were mutated into basic amino acids and vice versa, and amino acids with long side chains were mutated into glycine, to abolish the hydrophobic effect of the four domains. All point mutations generated within the core protein expression vector 1–183 flag were similarly generated according to a previously described polymerase chain reaction (PCR)-based method and the plasmid sequences were analyzed with BioEdit version 7.0.5 (http://www.mbio.ncsu.edu/BioEdit/page2.html) (19). PCR reactions were performed using Invitrogen™ PCR SuperMix (Thermo Fisher Scientific, Inc.) according to the manufacturer's instructions. In order to establish the 1–183 flag plasmid, a template pHBV1.2 plasmid, and 1–183 flag forward (For) and 1–183 flag reverse (Rev) primers were used. The pHBC14-18 plasmid was established using 1–183 flag as a template, and aa14-18 For and 1–183 flag Rev primers. pHBc23-39M, pHBc120-135M and pHBc122-139M plasmids were established via two cycles of PCR. For example, for pHBc120-135M plasmids, aa120-135 For and 1–183 flag Rev, and 1–183 flag For, and aa120-135 Rev primers were used for the first round of PCR, and pHBV1.2 was used as a template; the two products from the first round of PCR were subsequently mixed and annealed at 72°C, and used as the template for the second round of PCR, where 1–183 flag For and 1–183 flag Rev primers were used. All PCR products were cloned into pcDNA3.1 vectors (Thermo Fisher Scientific, Inc., Waltham, MA, USA) using XbaI and EcoRI enzymes for digestion and ligation, respectively. The pHBV1.2-core− was generated using the aforementioned method but instead using HindIII For and Y38 Rev, and Y38 For and PshAI Rev primers for the first round of PCR; the two products from the first round of PCR were annealed and used as a template for the second round of PCR, where HindIII For and PshAI Rev primers were used. The PCR products were introduced to pUC18 vector by HindIII and PshAI digestion and ligation.
Table I.

HBc mutants of the dimer-dimer interface.

HBcWild-typeMutant
14-18ELLSFKLLSG
120-135VSFGVWIRTPPAYRPPGSFGGWIDTGPAARGG
23-39FFPSIRDLLDTASALYRGFGSIRKLLDTASAGYD
122-139FGVWIRTPPAYRPPNAPIGGVWIRTPPAYRPPNAPG

The corresponding residues of mutation are marked in bold. HBc, hepatitis B virus core.

Cell culture and transfection

Human hepatoma HepG2 cells (American Type Culture Collection, Manassas, VA, USA) were cultured in Dulbecco's modified Eagle's medium (DMEM)-F12 (Invitrogen; Thermo Fisher Scientific, Inc.) containing 10% (v/v) fetal bovine serum (Gibco; Thermo Fisher Scientific, Inc.) at 37°C under 5% CO2. HepG2 cells were co-transfected with HBc mutant plasmids and wild-type (WT) pHBV1.2. 1–183 flag and pcDNA3.1 were also transfected into HepG2 cells to establish control groups. All transfections were conducted using FuGENE HD transfection reagent (Promega Corporation, Madison, WI, USA) according to the manufacturer's protocols. The day prior to transfection, 5×105 cells were seeded into a 6-well plate and cultured at 37°C. After 20 h, 6 µl FuGENE HD reagent and 2 µg HBc mutant plasmid or different amounts of HBc mutant plasmids (0.2–3.2 µg) together with 1 µg pHBV1.2 were used for transfection. According to preliminary experiments using a pCMV-GFP plasmid, ~35% of target HepG2 cells were successfully transfected. Five days post-transfection, cells were harvested for further analysis.

Viral particle assays

The secreted virion and intracellular capsid were assayed as previously described with some modifications (20). Briefly, after 5 days post-transfection, 1 ml cell culture DMEM-F12 was harvested from the 6-well plate and secreted HBV virion was precipitated by adding dry PEG 8000 (Sigma-Aldrich; Merck KGaA, Darmstadt, Germany) to a final concentration of 10% (w/v), and then incubated at 4°C for 1 h. The precipitate was collected by centrifugation (1,000 × g, 20 min at 4°C) and dissolved in 40 µl DMEM-F12. For the extraction of the intracellular capsid, cells from each well were washed three times with PBS and resuspended in 500 µl lysis buffer [150 mM NaCl, 50 mM Tris-HCl (pH 7.5), 5 mM MgCl2, 0.2% (v/v) Nonidet P-40] on ice for 10 min. The supernatant of the cell lysate was collected by centrifugation at 12,000 × g for 10 min at 4°C, precipitated with PEG 8000 (final concentration 10%, w/v) for 1 h at 4°C, and then dissolved in 60 µl DMEM-F12. A total of 10 µl secreted virions and intracellular capsids were fractionated via electrophoresis on a non-denaturing 1% agarose gel and transferred onto a nitrocellulose membrane overnight by blotting with 20X SSC buffer [3 M NaCl, 300 mM sodium citrate (pH 7)]. To detect the secreted virions and intracellular capsids, the membrane was blocked at room temperature for 1 h with Tris-buffered saline supplemented with 5% non-fat dry milk and 0.2% Tween-20. Subsequently, the virions were probed with monoclonal anti-envelope antibodies (1:2,000; cat. no. 18-0023; Invitrogen; Thermo Fisher Scientific, Inc.) or with a polyclonal antibody against core antigen (1:1,000; cat. no. B0586; Dako; Agilent Technologies, Inc., Santa Clara, CA, USA) for 3 h at room temperature. Bound antibodies were detected using horseradish peroxidase-labeled secondary antibodies for 3 h at room temperature (goat anti-mouse; 1:5,000; cat. no. RM3001 and goat anti-rabbit; 1:4,000; cat. no. RM3002; both Beijing Ray Antibody Biotech, Beijing, China; http://www.rayantibody.com/). Proteins were visualized using an ECL Plus chemiluminescence kit (Amersham Pharmacia Biotech; GE Healthcare, Chicago, IL, USA). Densitometry was performed using Quantity One® software version 4.6.3 (Bio-Rad Laboratories, Inc., Hercules, CA, USA).

SDS-PAGE and western blotting

Five days post-transfection, cells were treated with lysis buffer. Protein concentration was determined using the Pierce™ BCA Protein Assay kit (Thermo Fisher Scientific, Inc.) and adjusted to 5 µg/µl with lysis buffer. A total of 50 µg/10 µl cell lysate was separated by 12% SDS-PAGE and transferred onto a polyvinylidene fluoride membrane. The membrane was blocked with 5% non-fat milk in Tris-buffered saline for 0.5 h at room temperature, and incubated with primary anti-flag (1:2,000; cat. no. PM020; MBL International Co., Woburn, MA, USA), polyclonal rabbit anti-core (1:1,000; cat. no. B0586; Dako; Agilent Technologies, Inc.) and monoclonal mouse anti-GAPDH (1:3,000; cat. no. RM 2002; Beijing Ray Antibody Biotech) antibodies for 2 h at room temperature. Bound antibodies were detected with horseradish peroxidase-labeled secondary antibodies for 3 h at room temperature (goat anti-rabbit; 1:4,000; cat. no. RM3002 and goat anti-mouse; 1:5,000; cat. no. RM3001; both Beijing Ray Antibody Biotech) and visualized using an ECL Plus chemiluminescence kit (Amersham Pharmacia Biotech; GE Healthcare). The density of each band was analyzed using Quantity One software version 4.6.3 (Bio-Rad Laboratories, Inc.).

Southern blotting

To detect capsid-associated HBV DNA, a digoxigenin (DIG)-labeled double-stranded specific full-length HBV probe was synthesized from pHBV1.2 with a PCR DIG Probe Synthesis Kit (Roche Diagnostics, Indianapolis, IN, USA) according to the manufacturer's protocols. Primers (P1, 5′-CCGGAAAGCTTGAGCTCTTCTTTTTCACCTCTGCCTAATCA-3′ and P2, 5′-CCGGAAAGCTTGAGCTCTTCAAAAAGTTGCATGGTGCTGG-3′) were used to synthesize the HBV probe. Extraction of intracellular capsid-associated HBV DNA and Southern blot analysis were conducted as previously described (21) using a DIG DNA Labeling and Detection Kit (Sigma-Aldrich; Merck KGaA, Darmstadt, Germany). In brief, 15 µg of capsid-associated HBV DNA per lane was electrophoresed on a 1% agarose gel. Nucleic acids were then transferred onto a positively charged nylon membrane (GE Healthcare). These blots were hybridized with a DIG-labeled double-stranded specific full-length HBV probe overnight at room temperature.

Quantification of HBV DNA and cccDNA using quantitative (q)PCR

The nuclear cccDNA and virion HBV DNA in the culture medium were quantified by qPCR on a LightCycler® 480 system (Roche Diagnostics, Indianapolis, IN, USA). Total DNA was extracted using the QIAamp DNA Mini kit (Qiagen GmbH, Hilden, Germany) according to the manufacturer's instructions. Isolated DNA was treated with 10,000 U/ml T5 exonuclease (New England BioLabs, Inc., Ipswich, MA, USA) for 30 min at 37°C in 10 µl reaction volume followed by heat inactivation at 95°C for 5 min and 4-fold dilution with distilled water. Two different primer and TaqMan probe sets were synthesized by Sangon Biotech Co., Ltd. (Shanghai, China) for the detection of HBV-DNA and HBV cccDNA in the culture medium. The primers and probe design were according to a previous study (22). The PCR primers for the amplification of cccDNA were: For, 5′-GGGGCGCACCTCTCTTTA-3′ and Rev, 5′-AGGCACAGCTTGGAGGC-3′. The TaqMan hydrolysis probe for the detection of the amplified 367 bp DNA fragment was as follows: 5′-FAM-TTCTCATCTGCCGGACCGTG-BHQ-3′. The PCR primers for the amplification of total DNA were: For, 5′-GCCAAAATTCGCAGTCC-3′ and Rev, 5′-AAACTGAGCCAGGAGAAA-3′. The Taqman hydrolysis probe for the detection of the amplified 376 bp DNA fragment was as follows: 5′-FAM-TTCCTCTTCATCCTGCTGCTATGCC-BHQ-3′. The amplification program consisted of an initial denaturing step at 94°C for 10 min, followed by 45 cycles of 95°C for 10 sec, 55°C for 20 sec and 72°C for 20 sec. The pHBV1.2 plasmid, which contained 1.2 copies of the HBV genome, was extracted using the QIAGEN Plasmid Mini kit (Qiagen GmbH), according to the manufacturer's instructions. The plasmid concentration (mg/ml) was measured at 260 nm using a spectrophotometer. The copy number of the plasmid was calculated using the following formula: Copies/ml = C/M xA (where C is the plasmid concentration, M is the molecular weight and A is the Avogadro constant). Ten-fold serial dilutions of pHBV1.2 plasmid stock (109−102 copies/ml) were used to establish qPCR standard curves for detecting HBV cccDNA and HBV total DNA. The primers and probe are the same as when the samples were tested. Each experiment was performed in triplicate.

RNA extraction and northern blotting

Total cellular RNA was extracted from transfected cells with TRIzol reagent (Invitrogen; Thermo Fisher Scientific., Inc.). Total RNA (5 µg) per lane was separated on a 1% agarose gel containing 2.2 M formaldehyde and transferred onto a positively charged nylon membrane (GE Healthcare) with 20X SSC buffer. The probe and hybridization procedure was conducted in accordance with that for Southern blot analysis.

Conservation analysis of capsid residues

A total of 9,386 HBc sequences were downloaded from HBVdb (https://hbvdb.ibcp.fr/HBVdb/HBVdbIndex) (23) and submitted to Clustal Omega (https://www.ebi.ac.uk/Tools/msa/clustalo/; version 1.2.4) for alignment (24).

Statistical analysis

SPSS 16.0 software (SPSS, Inc., Chicago, IL, USA) was employed to analyze the experimental data, which are presented as the mean ± standard error of the mean. A Mann-Whitney U test was performed to compare the levels of viruses between HBc mutant and control groups. P<0.05 was considered to indicate a statistically significant difference. All experiments were performed in triplicate.

Results

Identification of HBc dimer-dimer interface

The crystal structure of HBc has been reported previously (18). HBc is mainly a helical protein; the hydrophobic effect is the main force that directs its assembly (Fig. 1A). HBc monomers form a dimer via the intradimer interface to initiate assembly, and then several dimers are assembled to form an icosahedral capsid via the dimer-dimer interface (15). Based on its crystal structure, 16 aa located at the dimer-dimer interface were identified using Swiss-PdbViewer v4.0: i) 14E, 18F, 120V, 124V, 127R, 129P, 132Y, 134P and 135P; and ii) 23F, 25P, 29D, 37L, 39R, 122F, and 139I (Fig. 1B). These residues were classified into four domains based on the HBc primary sequences and spatial structure as follows: HBc14-18, HBc23-39, HBc120-135, and HBc122-139 (Table I). To determine the role of each of these domains in capsid assembly and function, all 16 residues were mutated in accordance with the following principles to abolish the hydrophobic effect of the four domains: Acidic amino acids were mutated into basic amino acids and vice versa, and amino acids with long side chains were mutated into glycine. Of note, two mutants with similar primary structures, HBc120-135 and HBc122-139, were generated in the present study as the residues were located within different dimer units in the HBc crystal structure. The two domains were presented in Fig. 1B as green and blue; the map of the plasmids employed in the present study were presented in Fig. 1C.
Figure 1.

HBV capsid assembly and dimer-dimer interface. (A) Capsid assembly procedure. Upper panel, two α-helical HBc monomers form a dimer via the intradimer interface, and numerous dimers subsequently form an icosahedral capsid via the dimer-dimer interface. Lower panel, HBc with mutations at the dimer-dimer interface may interact with WT HBc monomer via the intradimer interface to form an aberrant dimer, but disrupts the capsid structure or function. (B) Orthogonal perspectives of HBc (1QGT, Protein Data Bank) viewed normal to the local 2-fold axis (right) and along the 2-fold axis from the outside of the HBc (left); 4 HBc monomer units are indicated by four different colors (red, green, blue and yellow). Residues at the dimer-dimer interface are presented as ribbons, indicated in green (14E, 18F, 120V, 124V, 127R, 129P, 132Y, 134P and 135P) and blue (23F, 25P, 29D, 37L, 39R, 122F and 139I), respectively. (C) Map of plasmids. For the expression of the HBV genome, 1.2 units of the HBV genome was inserted at the 3′ end of the lac promoter in pUC18 to construct the pHBV1.2 plasmid. The open reading frames of the viral C, P, E and X genes are indicated by dark grey boxes. The C gene of pHBV1.2core− contained a point mutation of a stop codon at codon 38 (arrow). For the expression of WT and mutant HBc, the pcDNA3.1 vector was used. A FLAG tag was fused to the C-terminus of HBc. Each HBc mutant is indicated by a white box. HBV, hepatitis B virus; HBc, HBV core protein; WT, wild-type.

The HBV sequence alignment results demonstrated that residues 14E and 18F are relatively conserved, whereas 29D and 132Y are highly conserved, and 25P and 139I are completely conserved across all 9,386 sequences (Fig. 2).
Figure 2.

Conservation analysis of HBc sequences. A total of 9,386 HBc sequences were downloaded from the HBVdb database and analyzed with the Clustal Omega sequence aligning program. As the hydrophobic effect is the main force that directs capsid assembly, acidic residues, basic residues and those with long side chains were mutated (labeled in red). ‘.’ Denotes relatively conserved; ‘:’ denotes highly conserved and ‘*’ denotes completely conserved across 9,386 sequences. HBc, hepatitis B virus core protein.

Capsid-like structure formed by HBc mutants

To determine whether all HepG2 cells were successfully transfected with HBc mutants, a FLAG tag was fused to the C-terminus of WT HBc (1–183 flag) and all mutant plasmids (Fig. 1C). After 5 days post-transfection, an anti-FLAG antibody was used in western blotting to detect its expression. A 21 kDa band was observed in all mutant and 1–183 flag-transfected groups, indicating that all HBc mutants exhibited normal expression (Fig. 3A).
Figure 3.

Capsid formed by HBc with dimer-dimer mutations. (A) HepG2 cells were transfected with 2 µg HBc mutant or 1–183 flag (control) using FuGENE HD transfection reagent according to the manufacturer's instructions. After 5 days post-transfection, cells lysates were isolated, resolved with SDS-PAGE and probed with anti-GAPDH or -flag antibody. (B) HepG2 cells were co-transfected with an equal amount of HBc mutant and pHBV1.2core−; 5 days post-transfection, cell lysates were analyzed on a native agarose gel (for capsid detection) or subjected to SDS-PAGE (for core protein detection), and then detected with a polyclonal antibody against the core antigen. The major epitope of the antibody is at the tip of the spike on the capsid surface (amino acid residues 78–83), which were unaltered in mutants. Under native conditions, the spike epitope emerging from the capsid should be exposed and accessible to the anti-HBc antibody. (C) HepG2 cells were co-transfected with equal amounts of HBc mutant and pHBV1.2core−. After 5 days post-transfection, the capsid-associated 3.5 kb pregenomic RNA was detected with a specific HBV DNA probe. The positive and negative controls were 1–183 flag and pcDNA3.1, respectively. (D) After 5 days post co-transfection, capsid-associated HBV DNA was purified and subjected to Southern blot analysis with a specific HBV DNA probe. HBV, hepatitis B virus; HBc, HBV core protein; DS, double-stranded DNA; RC, relaxed circular DNA.

To determine whether mutations of the dimer-dimer interface affect capsid formation, HepG2 cells were co-transfected with each HBc mutant and pHBV1.2-core−. A total of 5 days post-transfection, the intracellular capsid was isolated and analyzed on an agarose gel (native condition) or subjected to SDS-PAGE (denaturing and reducing conditions), and then detected with an anti-HBc antibody (Fig. 3B). The major epitope of the antibody is at the tip of the spike on the capsid surface (aa 78–83), which appeared to remain unaltered in the mutants. In the capsid structure, the spike epitope is exposed and accessible to the anti-HBc antibody (18). Following SDS-PAGE, 1–183 flag and all mutants were detected with the anti-core antibody, which indicated that the plasmids were successfully generated; however, under native conditions, pHBc23-39M was not detected via an anti-HBc antibody, suggesting that the spike epitope was not properly exposed, thereby preventing the formation of capsid-like structures. Conversely, the three mutants, pHBc14-18M, pHBc120-135M and pHBc122-139M, assembled a capsid-like structure that could be detected with the corresponding antibody under native conditions (Fig. 3B). As some of the mutants assembled capsid-like structures, whether these supported normal capsid function was investigated in the present study. To address this issue, each HBc mutant was respectively co-transfected into cells with pHBV1.2-core−, and the capsid-associated 3.5 kb pgRNA and HBV DNA were isolated 5 days post-transfection and detected with a specific HBV probe via northern and Southern blotting. None of the HBc mutants supported the assembly of the pgRNA package or viral replication (Fig. 3C and D). These findings indicated that these residues at the dimer-dimer interface are critical for capsid structure and function. Mutations within these regions may completely disrupt HBV replication.

Effect of HBc mutants on WT viral replication

As all the mutations were situated within the dimer-dimer interface, the mutants should remain to possess intact intradimer interfaces. The present study hypothesized that these interact with the WT HBc monomer to form aberrant dimers, which in turn may affect WT virus capsid assembly and function (Fig. 1A, lower panel). To validate this hypothesis, HepG2 cells were co-transfected with an equal amount of HBc mutant plasmid and WT pHBV1.2; after 5 days post-transfection, capsid-associated HBV DNA was extracted and identified by Southern blot analysis (Fig. 4A). The results demonstrated that pHBc14-18M significantly inhibited WT viral replication as presented by a 36.8% reduction in the expression levels of capsid-associated HBV DNA compared with in the 1–183 flag control; pHBc120-135M and pHBc122-139M significantly inhibited HBV DNA production by 62.4 and 49.3%, respectively, compared with the control (Fig. 4B). However, pHBc23-39M did not exhibit an inhibitory effect on WT viral replication. The present study proposed that pHBc23-39M could not form a capsid by itself, indicating that mutations within this domain may also inhibit HBc monomer interactions. Thus, pHBc23-39M may not interact with WT HBc to affect capsid function and viral replication.
Figure 4.

HBc dimer-dimer mutants inhibit WT replication. (A) HepG2 cells were co-transfected with an equal amount of HBc mutant and pHBV1.2. After 5 days post-transfection, the capsid-associated HBV DNA was isolated and detected with a specific HBV DNA probe. (B) Relative density of the RC and DS bands of each group in (A) was analyzed using Quantity One software (version 4.6.3). The experiment was repeated in triplicate. Date are presented as the mean ± standard error of the mean. *P<0.05 vs. 1–183 flag control group. (C) After 5 days post co-transfection, the cell medium was collected and then purified with a 0.45-µm filter; the nuclear cccDNA was also purified. Nuclear cccDNA and virion HBV DNA in the culture medium were quantified by qPCR on a LightCycler® 480 system. The experiment was repeated in triplicate. Date are presented as the mean ± standard error of the mean. *P<0.05 vs. 1–183 flag control group. DS, double-stranded DNA; HBV, hepatitis B virus; HBc, HBV core protein; RC, relaxed circular DNA.

In addition, whether the mutants affect cccDNA and virion-associated HBV DNA in the medium was investigated in the present study. After 5 days post-transfection, the nuclear cccDNA and HBV DNA in the medium were isolated and quantitated using qPCR. The results revealed that HBc mutants exhibited no significant effect on the levels of cccDNA; however, the number of viruses in the medium of the pHBc14-18M, pHBc120-135M, and pHBc122-139M groups was significantly decreased compared with in the 1–183 flag control, which coincided with alterations in capsid-associated HBV DNA (Fig. 4C).

Effect of HBc mutants on WT virion production

In addition, how the HBc mutants affect WT virion production was investigated. After 5 days post co-transfection, virions in the media were collected and detected using an anti-envelope antibody. Since it was confirmed that pHBc23-39M could not form capsids by itself or inhibit WT HBV replication, its effect on HBV virion production was not analyzed. The results revealed that pHBc14-18M, pHBc120-135M and pHBc122-139M significantly inhibited WT virion production by >50% compared with in the 1–183 flag control (Fig. 5; P<0.05). pHBc14-18M significantly decreased capsid-associated HBV DNA by 36.8% compared with the 1–183 flag control (Fig. 4B; P<0.05), indicating that this domain may also participate in the late events of the HBV life cycle and virion formation.
Figure 5.

HBc dimer-dimer mutants inhibit virion production. (A) HepG2 cells were co-transfected with an equal amount of HBc mutant and pHBV1.2. After 5 days post-transfection, the virions were collected, purified with a 0.45-µm filter, analyzed on a native agarose gel and then detected with an anti-HBsAg antibody. (B) Density of each band in (A) was analyzed using Quantity One software (version 4.6.3). The experiment was repeated in triplicate. Date are presented as the mean ± standard error of the mean. *P<0.05 vs. 1–183 flag control group. HBV, hepatitis B virus; HBc, HBV core protein; HBsAg, HBc antigen.

HBc mutants inhibit WT replication and virion production in a dose-dependent manner

To further confirm the effect of HBc dimer-dimer mutations on WT replication and virion production, different amounts of HBc mutant plasmids (0.2–3.2 µg) together with 1 µg pHBV1.2 were transfected into HepG2 cells. After 5 days post-transfection, the production of HBV DNA and virions in the culture medium was detected as aforementioned (Fig. 6). HBc mutants, including pHBc14-18M, pHBc120-135M and pHBc122-139M significantly inhibited HBV DNA and virion production in a dose-dependent manner (Fig. 6; P<0.05). pHBc120-135 exhibited the most potent antiviral effect, as it inhibited WT replication and virion production by 84 and 83.1%, when co-transfected with a plasmid ratio of 3.2:1 and 1.6:1 µg, respectively.
Figure 6.

HBc dimer-dimer mutants inhibit capsid-associated HBV DNA and virion production in a dose-dependent manner. HepG2 cells were co-transfected with different ratios of HBc mutants (0.2, 0.4, 0.8, 1.6 and 3.2 µg) to pHBV1.2 (1 µg). After 5 days post-transfection, the (A) capsid-associated HBV DNA and (B) virions in the medium were purified; the amounts produced were determined. The experiment was repeated in triplicate. Date are presented as the mean ± standard error of the mean. *P<0.05 vs. pcDNA3.1.

Discussion

The aim of the present study was to identify the role of the HBc dimer-dimer interface in capsid assembly and function. HBV consists of an outer lipidic envelope protein shell and inner icosahedral capsid, which is crucial for pgRNA packing, genome replication, and viral envelopment. A previous study demonstrated that capsid assembly is strongly associated with the presence of supplementary cccDNA (25). Dysregulation of capsid assembly could be a powerful tool for inhibiting viral replication. A variety of agents that inhibit capsid assembly, including intracellular single-chain antibody (26), peptide aptamers (27), N-nonyl-deoxy-galactonojirimycin (28), and bis-ANS (29) demonstrated potent antiviral effects in vitro and in vivo. In the present study, it was reported that some domains of the dimer-dimer interface are may be essential for capsid function and virus viability. The successful identification of the HBc crystal structure provides insight to improve understanding of its assembly and function. In the present study, four domains of the HBc dimer-dimer interface were identified based on its crystal structure; two of the domains (HBc14-18 and HBc23-39) were located at the N-terminus of HBc, whereas the two other domains (HBc120-135 and HBc122-139) encompassed aa 113–143, which have been proposed to comprise the key dimer-dimer interaction site (18,19). The present study demonstrated that mutations involving HBc23-39 completely disable capsid assembly, and pHBc23-39 could not interact with WT HBc to interfere with its replication. These findings indicated that HBc23-39 may be associated with the intradimer interface, which is critical for HBc monomer interactions. In addition, P25 and D29 of HBc23-39 are absolutely and highly conserved, respectively across 9,386 HBc sequences. The mutation of these two residues may account for failure in capsid assembly. Conversely, pHBc14-18M formed a capsid-like structure, but it did not support pgRNA packaging or HBV DNA replication in the present study. The S17 and F18 mutations, which were introduced in pHBc14-18M, allow capsid assembly but inhibit mature virion formation (20,21). Similarly, HBc120-135 and HBc122-139 formed capsid-like structures, but did not support replication. The V124 mutation only permitted the assembly of non-capsid polymers as observed by electron microscopy (30). Collectively, these findings suggested that the HBc dimer-dimer interface serves pivotal roles in maintaining normal capsid structure and function. Interestingly, HBc23-39 may be a potential antiviral target as minor alterations of its residues efficiently inhibited capsid formation. As the approved nucleotide analogs could not eradicate nuclear cccDNA, the main source of persistent infection, further investigation and evaluation of novel antiviral agents is warranted. HBc is recruited to the cccDNA minichromosome in vivo and maintains the permissive epigenetic state in the critical region of cccDNA (4,31). The present study demonstrated that pHBc14-18M, pHBc120-135M and pHBc122-139M do not support viral replication. Furthermore, these mutants interacted with WT HBc, and inhibited viral replication and virion production. Therefore, these domains may be utilized as anti-HBc targets; once bound to small molecules, these domains are prevented from participating in capsid assembly and may also interfere with WT capsid formation and function (7). In the present study, pHBc14-18M significantly inhibited HBV replication by 36.8%, but effectively inhibited virion formation by 75.1%. F18 of pHBc14-18M was reported to also inhibit particle envelopment (19) which may explain the observed differences in the effects on viral replication and virion production. pHBc120-135M exhibited the most efficient antiviral effect. Y132 of pHBc120-135 is a highly conserved residue of HBc and is almost fully buried in the capsid crystal structure (18). Whether Y132 or other residues, or their combined synergistic effect is responsible for the potent antiviral effect of pHBc120-135M requires further study; the generation of a series of single point mutants may further elucidate these associations. In the present study pHBc122-139M contains only two mutated residues, F122 and I139; however, effective inhibition of WT viral replication was observed, indicating the importance of these two residues in capsid function. A single mutation of F122 has been reported to inhibit pgRNA packaging (20). The present study also determined whether dimer-dimer mutations affect the quantity of nuclear cccDNA. No significant alterations in the quantity of cccDNA were observed after 5 days post-co-transfection. The results of the present study revealed that HBc dimer-dimer mutants inhibited WT replication in a dose-dependent manner, thereby excluding the possibility of nonspecific interaction between mutants and WT HBc. Our study demonstrated that the HBc dimer-dimer interface is required for capsid assembly and viral replication. Targeting the dimer-dimer interface may be a novel and powerful antiviral strategy. The findings of the present study provide an improved understanding of the HBV life cycle and may contribute to the development of novel antiviral treatments.
  31 in total

1.  Structural organization of the hepatitis B virus minichromosome.

Authors:  C T Bock; S Schwinn; S Locarnini; J Fyfe; M P Manns; C Trautwein; H Zentgraf
Journal:  J Mol Biol       Date:  2001-03-16       Impact factor: 5.469

2.  Mapping of amino acid side chains on the surface of hepatitis B virus capsids required for envelopment and virion formation.

Authors:  Dirk Ponsel; Volker Bruss
Journal:  J Virol       Date:  2003-01       Impact factor: 5.103

3.  A heteroaryldihydropyrimidine activates and can misdirect hepatitis B virus capsid assembly.

Authors:  Stephen J Stray; Christina R Bourne; Sreenivas Punna; Warren G Lewis; M G Finn; Adam Zlotnick
Journal:  Proc Natl Acad Sci U S A       Date:  2005-05-31       Impact factor: 11.205

4.  Intracellular single-chain antibody against hepatitis B virus core protein inhibits the replication of hepatitis B virus in cultured cells.

Authors:  M Yamamoto; N Hayashi; T Takehara; K Ueda; E Mita; T Tatsumi; Y Sasaki; A Kasahara; M Hori
Journal:  Hepatology       Date:  1999-07       Impact factor: 17.425

5.  A small molecule inhibits and misdirects assembly of hepatitis B virus capsids.

Authors:  Adam Zlotnick; Pablo Ceres; Sushmita Singh; Jennifer M Johnson
Journal:  J Virol       Date:  2002-05       Impact factor: 5.103

6.  Functional surfaces of the hepatitis B virus capsid.

Authors:  Alexander Pairan; Volker Bruss
Journal:  J Virol       Date:  2009-08-26       Impact factor: 5.103

7.  Hepatitis B virus capsid particles are assembled from core-protein dimer precursors.

Authors:  S Zhou; D N Standring
Journal:  Proc Natl Acad Sci U S A       Date:  1992-11-01       Impact factor: 11.205

8.  Phenylpropenamide derivatives AT-61 and AT-130 inhibit replication of wild-type and lamivudine-resistant strains of hepatitis B virus in vitro.

Authors:  William E Delaney; Ros Edwards; Danni Colledge; Tim Shaw; Phil Furman; George Painter; Stephen Locarnini
Journal:  Antimicrob Agents Chemother       Date:  2002-09       Impact factor: 5.191

9.  A eukaryotic cytosolic chaperonin is associated with a high molecular weight intermediate in the assembly of hepatitis B virus capsid, a multimeric particle.

Authors:  J R Lingappa; R L Martin; M L Wong; D Ganem; W J Welch; V R Lingappa
Journal:  J Cell Biol       Date:  1994-04       Impact factor: 10.539

10.  Variability and conservation in hepatitis B virus core protein.

Authors:  Benjamin M Chain; Richard Myers
Journal:  BMC Microbiol       Date:  2005-05-27       Impact factor: 3.605

View more
  4 in total

1.  Conservation and variability of hepatitis B core at different chronic hepatitis stages.

Authors:  Marçal Yll; Maria Francesca Cortese; Mercedes Guerrero-Murillo; Gerard Orriols; Josep Gregori; Rosario Casillas; Carolina González; Sara Sopena; Cristina Godoy; Marta Vila; David Tabernero; Josep Quer; Ariadna Rando; Rosa Lopez-Martinez; Rafael Esteban; Mar Riveiro-Barciela; Maria Buti; Francisco Rodríguez-Frías
Journal:  World J Gastroenterol       Date:  2020-05-28       Impact factor: 5.742

Review 2.  Impact of the Interaction of Hepatitis B Virus with Mitochondria and Associated Proteins.

Authors:  Md Golzar Hossain; Sharmin Akter; Eriko Ohsaki; Keiji Ueda
Journal:  Viruses       Date:  2020-02-04       Impact factor: 5.048

3.  Prolyl Isomerase Pin1 Regulates the Stability of Hepatitis B Virus Core Protein.

Authors:  Mayuko Nishi; Kei Miyakawa; Satoko Matsunaga; Hajera Khatun; Yutaro Yamaoka; Koichi Watashi; Masaya Sugiyama; Hirokazu Kimura; Takaji Wakita; Akihide Ryo
Journal:  Front Cell Dev Biol       Date:  2020-01-31

4.  Insights into the genetic diversity, recombination, and systemic infections with evidence of intracellular maturation of hepadnavirus in cats.

Authors:  Chutchai Piewbang; Sabrina Wahyu Wardhani; Surangkanang Chaiyasak; Jakarwan Yostawonkul; Poowadon Chai-In; Suwimon Boonrungsiman; Tanit Kasantikul; Somporn Techangamsuwan
Journal:  PLoS One       Date:  2020-10-23       Impact factor: 3.240

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.