| Literature DB >> 30234073 |
Narjes Shahsavani1, Mohammad Hasan Sheikhha1, Hassan Yousefi2, Fatemeh Sefid3.
Abstract
Neisseria meningitidis is a facultative pathogen bacterium which is well founded with a number of adhesion molecules to facilitate its colonization in human nasopharynx track. Neisseria meningitidis is a major cause of mortality from severe meningococcal disease and septicemia. Neisseria meningitidis adhesion, NadA, is a trimeric autotransporter adhesion molecule which is involved in cell adhesion, invasion, and antibody induction. It is identified in approximately 50% of N. meningitidis isolates, and is established as a vaccine candidate due to its antigenic effects. In the present study, we exploited bioinformatics tools to better understand and determine the 3D structure of NadA and its functional residues to select B cell epitopes, and provide information for elucidating the biological function and vaccine efficacy of NadA. Therefore, this study provided essential data to close gaps existing in biological areas. The most appropriate model of NadA was designed by SWISS MODEL software and important residues were determined using the subsequent epitope mapping procedures. Locations of important linear and conformational epitopes were determined and conserved residues were identified to broaden our knowledge of efficient vaccine design to reduce meningococcal infectioun in population. These data now provide a theme to design more broadly cross-protective antigens.Entities:
Keywords: 3D structure; NadA; Neisseria meningitidis; epitope prediction
Year: 2018 PMID: 30234073 PMCID: PMC6134420 DOI: 10.22088/IJMCM.BUMS.7.1.53
Source DB: PubMed Journal: Int J Mol Cell Med ISSN: 2251-9637
Fig. 1NadA conserved domain. YadA- anchor superfamily is shown
physical and chemical parameters of NadA
|
| 362 | |||||||
|
| 37753.74 | |||||||
|
| 4.79 | |||||||
|
| Ala (A) | 71 | 19.6%/ | Arg (R) | 5 | 1.4% | ||
| Asn (N) | 24 | 6.6%/ | Asp (D) | 29 | 8.0% | |||
| Cys (C) | 1 | 0.3%/ | Gln (Q) | 8 | 2.2% | |||
| Glu (E) | 28 | 7.7%/ | Gly (G) | 22 | 6.1% | |||
| His (H) | 3 | 0.8%/ | Ile (I) | 16 | 4.4% | |||
| Leu (L) | 19 | 5.2%/ | Lys (K) | 36 | 9.9% | |||
| Met (M) | 1 | 0.3%/ | Phe (F) | 11 | 3.0% | |||
| Pro (P) | 2 | 0.6%/ | Ser (S) | 14 | 3.9% | |||
| Thr (T) | 38 | 10.5%/ | Trp (W) | 1 | 0.3% | |||
| Tyr (Y) | 6 | 1.7%/ | Val (V) | 27 | 7.5% | |||
| Pyl (O) | 0 | 0.0%/ | Sec (U) | 0 | 0.0% | |||
|
| 57 | |||||||
|
| 41 | |||||||
|
| Carbon | C | 1634 | |||||
| Hydrogen | H | 2640 | ||||||
| Nitrogen | N | 452 | ||||||
| Oxygen | O | 567 | ||||||
| Sulfur | S | 2 | ||||||
|
|
| |||||||
|
| 14440 | |||||||
|
| The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro). | |||||||
|
| This classifies the protein as stable | |||||||
|
| 78.95/ -0.337 | |||||||
Fig. 22D topology model of NadA predicted by TMBBPred server. Residues from 34-42, 89-97, 104-110 and 217-223 are transmembrane regions
Fig. 3Graphical representation of the most likely topology predicted by SPOCTOPUS. Network output: The two diagrams show the estimated preference for each residue to be located in different structural regions. The top diagram shows the preference of being either in (1) the hydrophobic part of the membrane, 0–13 A ° from the membrane center (M), (2) the membrane water-interface, 11–18 A ° from the membrane center (I), (3) a close loop region, 13–23 A ° from the membrane center (L), (4) a globular region, further than 23 A ° from the membrane (G). The bottom diagram shows the estimated preference of a particular residue to be located either on the inside (i) or on the outside (o) of the membrane. The raw data underlying these two plots can be found in the OCTOPUS network file
Fig. 4NadA 3D structure model predicted by SWISS MODEL
Fig. 5Model validations. Both global and local estimation of the quality of the obtained model are reasonable
Fig. 6Model evaluation. (a) Ramachandran plot of final NadA model. Number of residues in favored region: 177 (93.7%). Number of residues in allowed region: 9 (4.6%). Number of residues in outlier region: 3 (1.8%). (b)- Prosa protein structure anlysis results. Z score = -4.75. Overall quality of the ultimate model is acceptable
Fig. 7NadA ligand binding sites predicted by COFACTOR. NadA structure in contact with peptide ligand from lateral view. Ligand in the space filling model
Fig. 8Functional and structural critical residues. (a) Colored illustration of conserved functional and structural residues predicted by conSeq server. The evolutionary rate of the sequence is obvious by color scale (see legend). Burial status of the location is labeled by b (buried) and e (exposed). Functionally or structurally importance of the residues were shown by f and s respectively. (b) Different direction of functional residues at the protein structure surface predicted by interproSurf
Bcepred hydrophilicity, accessibility, antigenicity, flexibility and beta turn secondary structure prediction in the protein sequence
| Sequence | MKHFPSKVLTTAILATFCSGALAATSDDDVKKAATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQKDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALADTDAALDETTNALNKLGENITTFAEETKTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQTAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKADIAKNSARIDSLDKNVANLRKETRQGLAEQAALSGLFQPYNVGRFNVTAAVGGYKSESAVAIGTGFRFTENFAAKAGVAVGTSSGSSAAYHVGVNYEW362 |
| Hydrophilicity | MKHFPSKVLTTAILATFCSGAL |
| Flexibility | MKHFPSKVLTTAILATFCSGALAATSDDDVKKAATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQKDATAADVEADDFKGLGLKKVVTNLT |
| Accessibility |
|
| Turns | MKHFPSKVLTTAILATFCSGALAATSDDDVKKAATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQKDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALADTDAALDETTNALNKLGENITTFAEETKTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQTAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKADIAKNSARIDSLDKNVANLRKETRQGLAEQAALSGLFQPYNVGRFNVTAAVGGYKSESAVAIGTGFRFTENFAAKAGVAVGTSSGSSAAYHVGVNYEW362 |
| Exposed Surface | MKHFPSKVLTTAILATFCSGALAAT |
| Polarity |
|
| Antigenic Propensity | MK |
Bold sequences indicate mentioned characteristics in protein sequence.
Fig. 9Linear B cell epitopes predicted by Bepipred server
Predicted linear epitopes (Linear B cell epitope predicted by ABCpred server).
|
|
|
|
|
|---|---|---|---|
| 1 | TITQKDATAADVEADD | 65 | 0.95 |
| 2 | GETIYDIGEDGTITQK | 54 | 0.94 |
| 3 | DETNTKADEAVKTANE | 190 | 0.92 |
| 4 | IVKIDEKLEAVADTVD | 161 | 0.90 |
| 5 | TVAIVAAYNNGQEING | 35 | 0.87 |
| 6 | SGLFQPYNVGRFNVTA | 298 | 0.87 |
| 7 | AVAIGTGFRFTENFAA | 323 | 0.86 |
| 8 | YNNGQEINGFKAGETI | 42 | 0.85 |
| 9 | TTAILATFCSGALAAT | 10 | 0.84 |
| 10 | DAKVKAAESEIEKLTT | 105 | 0.80 |
Linear Epitopes Predicted by Ellipro
|
|
|
|
|
|
|
|---|---|---|---|---|---|
| 1 | 108 | 134 | VKAAESEIEKLTTKLADTDAALADTDA | 27 | 0.748 |
| 2 | 267 | 271 | AKNSA | 5 | 0.718 |
| 3 | 172 | 184 | ADTVDKHAEAFND | 13 | 0.651 |
| 4 | 221 | 254 | VKAAETAAGKAEAAAGTANTAADKAEAVAAKVTD | 34 | 0.630 |
| 5 | 155 | 158 | EETK | 4 | 0.51 |
Discontinuous Epitopes Predicted by Ellipro
|
|
|
|
|
|---|---|---|---|
| 1 | A:V108, A:K109, A:A110, A:A111, A:E112, A:S113, A:E114, A:I115, A:E116, A:K117, A:L118, A:T119, A:T120, A:K121, A:L122, A:A123, A:D124, A:T125, A:D126, A:A127, A:L129, A:A130, A:D131, A:T132, A:D133, A:A134, A:D137, A:T140, A:N141, A:N144, A:A172, A:D173, A:T174, A:V175, A:D176, A:K177, A:H178, A:A179, A:E180, A:A181, A:F182, A:N183, A:D184 | 43 | 0.722 |
| 2 | A:A264, A:A267, A:K268, A:N269, A:S270, A:A271 | 6 | 0.702 |
| 3 | A:A219, A:V221, A:K222, A:A223, A:A224, A:E225, A:T226, A:A227, A:A228, A:G229, A:K230, A:A231, A:E232, A:A233, A:A234, A:A235, A:G236, A:T237, A:A238, A:N239, A:T240, A:A241, A:A242, A:D243, A:K244, A:A245, A:E246, A:A247, A:V248, A:A249, A:A250, A:K251, A:T253, A:D254, A:Q289, A:G290, A:L291, A:A292, A:E293, A:Q294, A:A295, A:A296, A:L297, A:S298 | 44 | 0.676 |
| 4 | A:G147, A:E148, A:I150 | 3 | 0.564 |
Fig10B cell epitopes with the highest PI score. 2 linear (a) and 2 discontinuous (b) predicted epitopes are represented. Epitopes were mapped on 3D models using Discovery Studio Visualizer 2.5.5 software
Fig 11GHECOM results for NadA Pocket detection.