Literature DB >> 30091701

Targeting light-gated chloride channels to neuronal somatodendritic domain reduces their excitatory effect in the axon.

Jessica E Messier1,2, Hongmei Chen1,2, Zhao-Lin Cai1,2, Mingshan Xue1,2,3.   

Abstract

Light-gated chloride channels are emerging as promising optogenetic tools for inhibition of neural activity. However, their effects depend on the transmembrane chloride electrochemical gradient and may be complex due to the heterogeneity of this gradient in different developmental stages, neuronal types, and subcellular compartments. Here we characterized a light-gated chloride channel, GtACR2, in mouse cortical neurons. We found that GtACR2 activation inhibited the soma, but unexpectedly depolarized the presynaptic terminals resulting in neurotransmitter release. Other light-gated chloride channels had similar effects. Reducing the chloride concentrations in the axon and presynaptic terminals diminished the GtACR2-induced neurotransmitter release, indicating an excitatory effect of chloride channels in these compartments. A novel hybrid somatodendritic targeting motif reduced the GtACR2-induced neurotransmitter release while enhancing the somatic photocurrents. Our results highlight the necessity of precisely determining the effects of light-gated chloride channels under specific experimental conditions and provide a much-improved light-gated chloride channel for optogenetic inhibition.
© 2018, Messier et al.

Entities:  

Keywords:  axonal chloride; iC++; iChloC; mouse; neuroscience; optogenetic inhibition; potassium channel Kv2.1; telencephalin

Mesh:

Substances:

Year:  2018        PMID: 30091701      PMCID: PMC6130974          DOI: 10.7554/eLife.38506

Source DB:  PubMed          Journal:  Elife        ISSN: 2050-084X            Impact factor:   8.140


Introduction

Targeted manipulation of neural activity is a powerful approach in neuroscience that has provided fundamental insights into the roles of specific neurons in nervous system functions. Genetically encoded actuators such as light-gated ion channels or pumps enable control of neural activity with unprecedented spatiotemporal specificity and are transforming neuroscience research (Boyden et al., 2005; Han and Boyden, 2007; Li et al., 2005; Nagel et al., 2003; Zhang et al., 2007). Actuators that enable neuronal activation are frequently used, but inhibitory optogenetic tools are increasingly crucial because reversible and temporally precise suppression of neuronal activity is key to revealing the causal roles of specific neurons in network dynamics and behavior. The widely used light-driven inward chloride pumps and outward proton pumps, such as Natronomonas pharaonis halorhodopsin (NpHR) and Halorubrum sodomense archaerhodopsin (Arch), can hyperpolarize membrane potentials, independent of the electrochemical gradients, to inhibit action potentials with millisecond precision (Chow et al., 2010; Chuong et al., 2014; Han and Boyden, 2007; Han et al., 2011; Zhang et al., 2007). However, their efficacies are limited because only one ion is transported per absorbed photon, and their activation does not decrease membrane resistance. Light-gated chloride channels, such as Guillardia theta anion channelrhodopsin 1 and 2 (GtACR1 and GtACR2), iC++, and iChloC, overcome these limitations (Berndt et al., 2014; Govorunova et al., 2015, 2017b; Wietek et al., 2014). They are highly sensitive to light, allow multiple ions to cross the membrane per photocycle, and reduce membrane resistance, thereby potently inhibiting action potentials. Thus, light-gated chloride channels are emerging as promising optogenetic tools for suppressing neuronal activity (Govorunova et al., 2017a). Determining the precise effects of light-gated ion channels or pumps under defined conditions is a prerequisite to use them for interrogating the functions of specific neurons and circuits. This is due to the possibility that these channels or pumps not only modulate membrane potentials but also may affect other processes such as ion homeostasis or neurotransmitter release. For example, activation of a light-driven inward chloride pump, eNpHR3.0, can transiently change the reversal potential of GABAA receptors and alter the inhibitory synaptic inputs (Raimondo et al., 2012). Prolonged activation of a light-driven outward proton pump, eArch3.0, can increase presynaptic calcium concentrations and spontaneous neurotransmitter release (Mahn et al., 2016). Despite these potential confounds, these inhibitory optogenetic molecules become increasingly important tools for targeted silencing of neuronal populations, as long as these confounds are understood and controlled (Allen et al., 2015). Therefore, it is also crucial to thoroughly characterize light-gated chloride channels, as their effect depends on the difference between the membrane potential and the reversal potential for chloride, both of which can vary in different neuronal types and subcellular compartments (Marty and Llano, 2005; Trigo et al., 2008). To this end, we investigated the effects of activating GtACR2 in mouse cortical excitatory and inhibitory neurons. Much to our surprise, wide-field light activation of GtACR2 not only inhibited the soma, but also caused neurotransmitter release onto neighboring neurons. A similar phenomenon was observed with GtACR1, iC++, and iChloC. We further showed that GtACR2 activation in the axon and presynaptic terminals directly depolarized the membrane to induce neurotransmitter release due to high chloride concentrations in these compartments. These data explain the recent observations that photostimulation of neurons expressing GtACR1 or GtACR2 can paradoxically release neurotransmitters or generate action potentials (Mahn et al., 2016; Malyshev et al., 2017). To reduce the excitatory effect of GtACR2, we screened a panel of somatodendritic targeting motifs to reduce the trafficking of GtACR2 to the axon and presynaptic terminals. We created a hybrid motif (Kv2.1C-linker-TlcnC) that is most effective in concentrating GtACR2 in the somatodendritic domain. Activation of somatodendritically targeted GtACR2 resulted in larger photocurrents at the soma and less neurotransmitter release than wild type GtACR2. Thus, restricting the localization of light-gated chloride channels to the somatodendritic domain improves the inhibitory efficacy of these optogenetic tools. Our results also suggest that light-gated chloride channels can be a useful tool for studying the physiological functions of chloride electrochemical gradients in specific brain regions, cell types, or subcellular domains that are otherwise difficult to access, such as small axons and presynaptic terminals.

Results

Light activation of GtACR2 in mouse cortical neurons causes neurotransmitter release

To examine the efficacy of GtACR2 in mouse cortical excitatory neurons, we expressed a GtACR2-EYFP fusion protein (referred to as GtACR2 below) together with a red fluorescent protein, tdTomato, in layer 2/3 pyramidal neurons of the mouse visual or somatosensory cortex by in utero electroporation of plasmids at embryonic day 14.5–15.5. We obtained acute coronal brain slices from 3 to 8 week-old mice and observed that GtACR2 was present in the soma, dendrites, and axon (Figure 1A). We performed whole-cell patch clamp recordings at the soma of neurons expressing GtACR2 (GtACR2+ neurons) with a K+-based pipette solution (Figure 1B). As previously reported (Govorunova et al., 2015), activation of GtACR2 by wide-field blue light (455 nm) potently inhibited current-induced spiking in these neurons (Figure 1C). However, when we voltage clamped the neurons to record GtACR2-mediated photocurrents, we unexpectedly found an inward current that was superimposed on the photocurrent. This inward current resembled an excitatory postsynaptic current (EPSC; Figure 1D). To further investigate this phenomenon, we recorded layer 2/3 pyramidal neurons that did not express GtACR2 (GtACR2– neurons) with a Cs+-based pipette solution (Figure 1E). Activation of GtACR2 with a short light pulse (0.5–10 ms) generated inward currents in all recorded GtACR2– neurons that were voltage clamped at the reversal potential for GABAergic inhibition (−60 mV). The onsets of these inward currents followed the onset of the blue light by 3.19 ± 0.26 ms (mean ± s.e.m., n = 25). These currents were abolished by the glutamatergic receptor antagonists, NBQX and CPP (Figure 1F), or the voltage-gated sodium channel blocker, tetrodotoxin (TTX; Figure 1G), indicating that they were indeed monosynaptic EPSCs caused by the glutamate transmitter released from GtACR2+ neurons. Activation of GtACR2 also produced inhibitory postsynaptic currents (IPSCs) in GtACR2– neurons that were voltage clamped at the reversal potential for glutamatergic excitation (+10 mV). These IPSCs were disynaptic because they were abolished by NBQX and CPP (Figure 1—figure supplement 1), indicating that activating GtACR2 in pyramidal neurons can release sufficient glutamate to recruit inhibitory interneurons.
Figure 1.

Light activation of GtACR2 causes excitatory and inhibitory neurons to release neurotransmitters.

(A) A representative fluorescent image of the visual cortex showing GtACR2-EYFP and tdTomato expression in a subset of layer 2/3 pyramidal neurons. Note the strong EYFP fluorescence in layer 5 that contains the axons of layer 2/3 pyramidal neurons. L, layer; WM, white matter. (B) Schematic of slice experiments in (C,D). GtACR2 in a subset of layer 2/3 pyramidal neurons. (C) Membrane potentials (upper panel) in response to somatic current injections (lower panel) from a GtACR2+ neuron. Blue light activation of GtACR2 suppressed the action potentials evoked by current injections (n = 5 neurons). (D) Blue light-induced membrane currents recorded at the membrane potentials of −75, –77, −78, –79, and −80 mV from the same GtACR2+ neuron in (C). Note the EPSC-like inward currents (arrows) superimposed on the GtACR2-mediated photocurrents (n = 2 neurons). (E) Schematic of slice experiments in (F,G). GtACR2 in a subset of layer 2/3 pyramidal neurons. (F) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were abolished by the glutamate receptor antagonists, NBQX and CPP. Right, summary graph of similar experiments (n = 17, p<0.0001). (G) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were abolished by the voltage-gated sodium channel blocker, TTX. Right, summary graph of similar experiments (n = 8, p=0.02). (H) A representative fluorescent image of the visual cortex showing GtACR2-EYFP expression in Pv neurons. (I,J,K) As in (E,F,G), but for GtACR2 in Pv neurons. GtACR2 activation-induced IPSCs were abolished by the GABAA receptor antagonist, Gabazine (J, n = 7, p=0.02) or TTX (K, n = 10, p=0.002).

Left, schematic of slice experiments. GtACR2 in a subset of layer 2/3 pyramidal neurons. Right, photoactivation of GtACR2 generated an EPSC (inward current) recorded at the membrane potential of −60 mV and an IPSC (outward current) recorded at the membrane potential of +10 mV in a GtACR2– neuron. The IPSC was abolished by the glutamatergic receptor antagonists, NBQX and CPP (red trace), indicating its disynaptic nature (n = 3 neurons).

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, a 20 Hz train of blue-light pulses activated GtACR2 to generate EPSCs in a GtACR2– neuron. Right, summary graph of similar experiments (n = 12) showing the EPSC amplitudes normalized to the first response. (C,D) As in (A,B), but for GtACR2 in Pv neurons. A 20 Hz train of blue-light pulses activated GtACR2 to generate IPSCs in GtACR2– neurons (n = 14).

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Photoactivation of GtACR2 by a 2-s light pulse generated photocurrents in a GtACR2+ neuron (top panel, recorded at the membrane potential of +10 mV) and EPSCs in a simultaneously recorded GtACR2– neuron (middle panel, recorded at the membrane potential of −60 mV). A segment of the trace from the GtACR2– neuron was expanded to show the EPSCs (bottom panel). Note the sustained photocurrent throughout the light pulse and the large EPSC at the onset of the light pulse. (C,D) Summary graphs of similar experiments (n = 6) as in (B). (C) The cumulative charge transfers of EPSCs from GtACR2– neurons during 2-s light pulses were plotted as a function of time to show the time course of neurotransmitter release. Each curve was normalized by the mean of its last 100 ms of the 2-s light pulse. (D) The durations from the onset of the light pulse to the time when the cumulative charge transfer reached 50% and 90%. The orange line and symbol correspond to the experiment in (B). (E,F,G) As in (A,B), but for GtACR2 in Pv neurons. Two experiments were shown in (F,G). The traces from the GtACR2– neurons were expanded to show IPSCs (bottom panels). Note the sustained photocurrents throughout the light pulses and the large IPSCs at the onset of the light pulses followed by smaller IPSCs. (H,I) As in (C,D), but for GtACR2 in Pv neurons (n = 7). The orange and magenta lines and symbols correspond to the experiments in (F,G), respectively.

Figure 1—figure supplement 1.

Recruitment of inhibitory neurons by activating GtACR2 in excitatory neurons.

Left, schematic of slice experiments. GtACR2 in a subset of layer 2/3 pyramidal neurons. Right, photoactivation of GtACR2 generated an EPSC (inward current) recorded at the membrane potential of −60 mV and an IPSC (outward current) recorded at the membrane potential of +10 mV in a GtACR2– neuron. The IPSC was abolished by the glutamatergic receptor antagonists, NBQX and CPP (red trace), indicating its disynaptic nature (n = 3 neurons).

Light activation of GtACR2 causes excitatory and inhibitory neurons to release neurotransmitters.

(A) A representative fluorescent image of the visual cortex showing GtACR2-EYFP and tdTomato expression in a subset of layer 2/3 pyramidal neurons. Note the strong EYFP fluorescence in layer 5 that contains the axons of layer 2/3 pyramidal neurons. L, layer; WM, white matter. (B) Schematic of slice experiments in (C,D). GtACR2 in a subset of layer 2/3 pyramidal neurons. (C) Membrane potentials (upper panel) in response to somatic current injections (lower panel) from a GtACR2+ neuron. Blue light activation of GtACR2 suppressed the action potentials evoked by current injections (n = 5 neurons). (D) Blue light-induced membrane currents recorded at the membrane potentials of −75, –77, −78, –79, and −80 mV from the same GtACR2+ neuron in (C). Note the EPSC-like inward currents (arrows) superimposed on the GtACR2-mediated photocurrents (n = 2 neurons). (E) Schematic of slice experiments in (F,G). GtACR2 in a subset of layer 2/3 pyramidal neurons. (F) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were abolished by the glutamate receptor antagonists, NBQX and CPP. Right, summary graph of similar experiments (n = 17, p<0.0001). (G) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were abolished by the voltage-gated sodium channel blocker, TTX. Right, summary graph of similar experiments (n = 8, p=0.02). (H) A representative fluorescent image of the visual cortex showing GtACR2-EYFP expression in Pv neurons. (I,J,K) As in (E,F,G), but for GtACR2 in Pv neurons. GtACR2 activation-induced IPSCs were abolished by the GABAA receptor antagonist, Gabazine (J, n = 7, p=0.02) or TTX (K, n = 10, p=0.002).

Recruitment of inhibitory neurons by activating GtACR2 in excitatory neurons.

Left, schematic of slice experiments. GtACR2 in a subset of layer 2/3 pyramidal neurons. Right, photoactivation of GtACR2 generated an EPSC (inward current) recorded at the membrane potential of −60 mV and an IPSC (outward current) recorded at the membrane potential of +10 mV in a GtACR2– neuron. The IPSC was abolished by the glutamatergic receptor antagonists, NBQX and CPP (red trace), indicating its disynaptic nature (n = 3 neurons).

Neurotransmitter release induced by repetitive activation of GtACR2.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, a 20 Hz train of blue-light pulses activated GtACR2 to generate EPSCs in a GtACR2– neuron. Right, summary graph of similar experiments (n = 12) showing the EPSC amplitudes normalized to the first response. (C,D) As in (A,B), but for GtACR2 in Pv neurons. A 20 Hz train of blue-light pulses activated GtACR2 to generate IPSCs in GtACR2– neurons (n = 14).

Neurotransmitter release induced by prolonged activation of GtACR2.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Photoactivation of GtACR2 by a 2-s light pulse generated photocurrents in a GtACR2+ neuron (top panel, recorded at the membrane potential of +10 mV) and EPSCs in a simultaneously recorded GtACR2– neuron (middle panel, recorded at the membrane potential of −60 mV). A segment of the trace from the GtACR2– neuron was expanded to show the EPSCs (bottom panel). Note the sustained photocurrent throughout the light pulse and the large EPSC at the onset of the light pulse. (C,D) Summary graphs of similar experiments (n = 6) as in (B). (C) The cumulative charge transfers of EPSCs from GtACR2– neurons during 2-s light pulses were plotted as a function of time to show the time course of neurotransmitter release. Each curve was normalized by the mean of its last 100 ms of the 2-s light pulse. (D) The durations from the onset of the light pulse to the time when the cumulative charge transfer reached 50% and 90%. The orange line and symbol correspond to the experiment in (B). (E,F,G) As in (A,B), but for GtACR2 in Pv neurons. Two experiments were shown in (F,G). The traces from the GtACR2– neurons were expanded to show IPSCs (bottom panels). Note the sustained photocurrents throughout the light pulses and the large IPSCs at the onset of the light pulses followed by smaller IPSCs. (H,I) As in (C,D), but for GtACR2 in Pv neurons (n = 7). The orange and magenta lines and symbols correspond to the experiments in (F,G), respectively. To determine if the phenomenon of GtACR2-induced neurotransmitter release also occurs in GABAergic inhibitory neurons, we expressed GtACR2 in parvalbumin-expressing (Pv) neurons by injecting a Flpo recombinase-dependent adeno-associated virus (AAV) into the visual cortex of Pvalb-2A-Flpo mice (Pvalb) (Madisen et al., 2015) at postnatal day 1 (Figure 1H). Using acute brain slices from 3 to 6 week-old mice, we found that activation of GtACR2 in Pv neurons generated IPSCs in all recorded GtACR2– layer 2/3 pyramidal neurons, and the IPSCs were abolished by Gabazine, a GABAA receptor antagonist, or TTX (Figure 1I–K). The onsets of the IPSCs followed the onset of the blue light by 2.47 ± 0.15 ms (mean ± s.e.m., n = 17), indicating that they were monosynaptic IPSCs caused by the GABA transmitter released from GtACR2+ Pv neurons. We next determined how repetitive or prolonged activation of GtACR2 would affect neurotransmitter release. We activated GtACR2 in layer 2/3 pyramidal neurons or Pv neurons with a high-frequency train of light pulses and found that each light pulse produced reliable EPSCs or IPSCs, respectively (Figure 1—figure supplement 2). Interestingly, continuous activation of GtACR2 in layer 2/3 pyramidal neurons or Pv neurons with a long pulse of light (e.g., 2 s) transiently generated large EPSCs or IPSCs, respectively, followed by various amounts of smaller synaptic responses (Figure 1—figure supplement 3A,B,E,F,G). Typically, more than 50% of the neurotransmitter release occurred within the first 100–200 ms of the light pulse (Figure 1—figure supplement 3C,D,H,I).
Figure 1—figure supplement 2.

Neurotransmitter release induced by repetitive activation of GtACR2.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, a 20 Hz train of blue-light pulses activated GtACR2 to generate EPSCs in a GtACR2– neuron. Right, summary graph of similar experiments (n = 12) showing the EPSC amplitudes normalized to the first response. (C,D) As in (A,B), but for GtACR2 in Pv neurons. A 20 Hz train of blue-light pulses activated GtACR2 to generate IPSCs in GtACR2– neurons (n = 14).

Figure 1—figure supplement 3.

Neurotransmitter release induced by prolonged activation of GtACR2.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Photoactivation of GtACR2 by a 2-s light pulse generated photocurrents in a GtACR2+ neuron (top panel, recorded at the membrane potential of +10 mV) and EPSCs in a simultaneously recorded GtACR2– neuron (middle panel, recorded at the membrane potential of −60 mV). A segment of the trace from the GtACR2– neuron was expanded to show the EPSCs (bottom panel). Note the sustained photocurrent throughout the light pulse and the large EPSC at the onset of the light pulse. (C,D) Summary graphs of similar experiments (n = 6) as in (B). (C) The cumulative charge transfers of EPSCs from GtACR2– neurons during 2-s light pulses were plotted as a function of time to show the time course of neurotransmitter release. Each curve was normalized by the mean of its last 100 ms of the 2-s light pulse. (D) The durations from the onset of the light pulse to the time when the cumulative charge transfer reached 50% and 90%. The orange line and symbol correspond to the experiment in (B). (E,F,G) As in (A,B), but for GtACR2 in Pv neurons. Two experiments were shown in (F,G). The traces from the GtACR2– neurons were expanded to show IPSCs (bottom panels). Note the sustained photocurrents throughout the light pulses and the large IPSCs at the onset of the light pulses followed by smaller IPSCs. (H,I) As in (C,D), but for GtACR2 in Pv neurons (n = 7). The orange and magenta lines and symbols correspond to the experiments in (F,G), respectively.

The finding of GtACR2-induced neurotransmitter release was unexpected, because the Nernst equilibrium potential of chloride becomes lower than the action potential threshold in rodent cortical neurons after the second postnatal week, and activation of chloride channels should inhibit, not promote, neurotransmitter release onto neighboring cells (Ben-Ari, 2002; Owens et al., 1996). We thus sought to identify the cause of this paradoxical neurotransmitter release and considered three possibilities. First, GtACR2 may conduct cations to depolarize neurons. Second, an increase in the intracellular chloride or strong hyperpolarization induced by GtACR2 activation may lead to rebound spikes. Third, GtACR2-mediated chloride currents may be excitatory.

A GtACR2-mediated excitatory chloride conductance causes neurotransmitter release

First, it was reported that GtACR2 did not conduct physiological cations (Govorunova et al., 2015), but some other light-gated chloride channels retained certain cation conductance (Berndt et al., 2014; Wietek et al., 2014). Thus, we sought to verify that in cortical neurons, GtACR2 has a similar reversal potential as a known chloride channel. To accomplish this, we determined the reversal potential of GtACR2-mediated photocurrents in comparison with that of IPSCs mediated by the endogenous GABAA receptors. We used in utero electroporation to express GtACR2 in layer 2/3 pyramidal neurons and a Cre recombinase-dependent AAV to express a red light-gated cation channelrhodopsin, ReaChR, in Pv neurons of Pvalb-2A-Cre mice (Pvalb) (Madisen et al., 2010). We performed whole-cell voltage clamp recordings at the soma of a GtACR2+ layer 2/3 pyramidal neuron and a nearby GtACR2– pyramidal neuron simultaneously (Figure 2—figure supplement 1A). In the GtACR2+ neuron, we sequentially recorded the IPSCs induced by activating ReaChR in Pv neurons via 617 nm light and the GtACR2-mediated photocurrents activated by 455 nm light. Both IPSCs and photocurrents were recorded at different membrane potentials to determine their reversal potentials in the same neuron (Figure 2—figure supplement 1B,C). 617 nm light does not activate GtACR2 (Govorunova et al., 2015), whereas 455 nm light partially activates ReaChR (Lin et al., 2013). Thus, to avoid Pv neuron-mediated IPSCs contaminating GtACR2-mediated photocurrents, we monitored the IPSCs in the GtACR2– neuron at the membrane potential of +10 mV to ensure that the intensity of the 455 nm light was not sufficient to activate Pv neurons and generate IPSCs (Figure 2—figure supplement 1B). We found that the reversal potentials of GtACR2-mediated photocurrents and GABAergic IPSCs were similar for each neuron and well below the action potential threshold (Figure 2—figure supplement 1D), indicating that GtACR2 does not conduct cations to cause neurotransmitter release.
Figure 2—figure supplement 1.

The reversal potential of GtACR2 at the soma is similar to that of GABAA receptors.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons and ReaChR in Pv neurons. (B) In a GtACR2+ neuron, GABAergic IPSCs induced by activating ReaChR in Pv neurons (left panel) and GtACR2-mediated photocurrents (right panel) were sequentially recorded at different membrane potentials. The example traces show the currents at the membrane potentials of −50, −60, −65, −66, −68, −70, and −75 mV. A GtACR2– neuron was simultaneously recorded at the membrane potential of +10 mV to ensure that the blue light did not generate IPSCs (right panel). (C) The amplitudes of IPSCs and GtACR2 photocurrents were plotted as a function of the membrane potentials for the GtACR2+ neuron in (B). Each set of data were fit with linear regression and the reversal potentials were determined by the V-axis intercepts. (D) Summary graph of similar experiments in (B,C) where the reversal potential of IPSCs was plotted against that of GtACR2 photocurrents for each GtACR2+ neuron. All data points fall close to the dotted unity line, and there is no significant difference between the reversal potentials of IPSCs and photocurrents (n = 8, p=0.4).

Second, we tested if GtACR2-induced neurotransmitter release could be due to rebound depolarization. An increase in the intracellular chloride caused by GtACR2 activation may trigger rapid efflux of chloride after the blue light illumination terminates. However, this possibility is unlikely because when GtACR2 was activated by a long pulse of blue light, neurotransmitter release occurred before the light illumination ended (see examples in Figure 1F,G and Figure 1—figure supplement 3). Another possibility is that the strong hyperpolarization induced by GtACR2 activates hyperpolarization-activated Ih currents, which may depolarize the membrane potential above the action potential threshold. However, pharmacological inhibition of Ih currents slightly increased the amplitudes of GtACR2-induced EPSCs (Figure 2—figure supplement 2A,B), most likely because inhibiting Ih currents increases neuronal membrane resistances (Robinson and Siegelbaum, 2003). Thus, GtACR2-induced neurotransmitter release is not caused by rebound depolarization.
Figure 2—figure supplement 2.

GtACR2-induced neurotransmitter release is not due to rebound depolarization or its long-term expression throughout development.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were not decreased by blocking the Ih current with ZD7288 (20 μM). Right, summary graph of similar experiments showing that the EPSC amplitudes were slightly increased by ZD7288 (n = 12, p=0.03). (C) Schematics of conditional expression of GtACR2 in a subset of layer 2/3 pyramidal neurons. A Flpo-dependent plasmid (FRT-FLEX-GtACR2) was electroporated at embryonic day 15 (E15) and AAV9-hSyn-Flpo was injected into the electroporated mice at different postnatal days (P23, P60, or P64). Green bars indicate the approximate GtACR2 expression time windows. (D) Left, representative fluorescent images of the visual cortex obtained at postnatal day 78 showing that, without injection of AAV9-hSyn-Flpo, transfected neurons (labeled by tdTomato) did not express GtACR2-EYFP (left panel, n = 6 mice, postnatal day 51–150). Right, representative fluorescent images of the visual cortex obtained at postnatal day 40 showing that the expression of GtACR2-EYFP in transfected neurons was turned on by the injection of AAV9-hSyn-Flpo at postnatal day 23 (right panel, n = 7 mice, postnatal day 40–86). L, layer; WM, white matter. (E) Photoactivation of GtACR2 generated EPSCs in GtACR2– neurons when GtACR2 was expressed during 3 different time windows as indicated in (C). Bumetanide was applied in a subset of experiments and the EPSCs were diminished (n = 12, p=0.0005).

Third, although GtACR2-mediated photocurrents are inhibitory at the soma, it is possible that the chloride concentrations are higher in some other cellular compartments, such that the electrochemical gradient causes chloride to exit the cell upon GtACR2 channel opening, resulting in depolarization of the membrane potential. To test this hypothesis, we pharmacologically inhibited the activity of Na+-K+-2Cl– cotransporter 1 (NKCC1) with bumetanide (50 or 100 µM) to decease the intracellular chloride concentrations, as NKCC1 is responsible for transporting chloride into neurons (Ben-Ari, 2017). When we activated GtACR2 in layer 2/3 pyramidal neurons, the resulting EPSCs in GtACR2– pyramidal neurons were diminished by bath application of bumetanide (Figure 2A,B), indicating that GtACR2-induced neurotransmitter release requires high concentrations of intracellular chloride. An alternative interpretation of this result would be that bumetanide blocks GtACR2 itself. To test this possibility, we simultaneously recorded the photocurrents and EPSCs in GtACR2+ and GtACR2– pyramidal neurons, respectively. While bumetanide diminished the EPSCs in GtACR2– neurons, it had no effect on the photocurrents in GtACR2+ neurons (Figure 2—figure supplement 3A,B), thereby ruling out the possibility that bumetanide affects GtACR2 itself. Furthermore, when a cation channel, channelrhodopsin-2 (ChR2) (Boyden et al., 2005; Li et al., 2005; Nagel et al., 2003), was expressed and activated in layer 2/3 pyramidal neurons, the resulting EPSCs in ChR2– neurons were not affected by bumetanide (Figure 2C,D), indicating that reducing the intracellular chloride concentration only affects chloride-mediated, and not cation-mediated, EPSCs. Finally, bumetanide also diminished the IPSCs resulting from GtACR2 activation in Pv neurons (Figure 2E,F). Together, these results demonstrate that light activation of GtACR2 generates an excitatory chloride conductance in certain neuronal compartments to trigger neurotransmitter release.
Figure 2.

Reducing intracellular chloride concentrations diminishes the neurotransmitter release induced by activation of GtACR2 or iC++.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were diminished by decreasing intracellular chloride concentrations with an NKCC1 blocker, bumetanide. Right, summary graph of similar experiments (n = 10, p=0.002). (C,D) As in (A,B), but for ChR2. ChR2 activation-induced EPSCs were not affected by bumetanide (n = 8, p=0.9). (E,F) As in (A,B), but for GtACR2 in Pv neurons. GtACR2 activation-induced IPSCs were diminished by bumetanide (n = 9, p=0.004). (G,H) As in (A,B), but for iC++. iC++-induced EPSCs were diminished by bumetanide (n = 6, p=0.009). (I,J) As in (E,F), but for iC++. iC++-induced IPSCs were diminished by bumetanide (n = 8, p=0.008).

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons and ReaChR in Pv neurons. (B) In a GtACR2+ neuron, GABAergic IPSCs induced by activating ReaChR in Pv neurons (left panel) and GtACR2-mediated photocurrents (right panel) were sequentially recorded at different membrane potentials. The example traces show the currents at the membrane potentials of −50, −60, −65, −66, −68, −70, and −75 mV. A GtACR2– neuron was simultaneously recorded at the membrane potential of +10 mV to ensure that the blue light did not generate IPSCs (right panel). (C) The amplitudes of IPSCs and GtACR2 photocurrents were plotted as a function of the membrane potentials for the GtACR2+ neuron in (B). Each set of data were fit with linear regression and the reversal potentials were determined by the V-axis intercepts. (D) Summary graph of similar experiments in (B,C) where the reversal potential of IPSCs was plotted against that of GtACR2 photocurrents for each GtACR2+ neuron. All data points fall close to the dotted unity line, and there is no significant difference between the reversal potentials of IPSCs and photocurrents (n = 8, p=0.4).

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were not decreased by blocking the Ih current with ZD7288 (20 μM). Right, summary graph of similar experiments showing that the EPSC amplitudes were slightly increased by ZD7288 (n = 12, p=0.03). (C) Schematics of conditional expression of GtACR2 in a subset of layer 2/3 pyramidal neurons. A Flpo-dependent plasmid (FRT-FLEX-GtACR2) was electroporated at embryonic day 15 (E15) and AAV9-hSyn-Flpo was injected into the electroporated mice at different postnatal days (P23, P60, or P64). Green bars indicate the approximate GtACR2 expression time windows. (D) Left, representative fluorescent images of the visual cortex obtained at postnatal day 78 showing that, without injection of AAV9-hSyn-Flpo, transfected neurons (labeled by tdTomato) did not express GtACR2-EYFP (left panel, n = 6 mice, postnatal day 51–150). Right, representative fluorescent images of the visual cortex obtained at postnatal day 40 showing that the expression of GtACR2-EYFP in transfected neurons was turned on by the injection of AAV9-hSyn-Flpo at postnatal day 23 (right panel, n = 7 mice, postnatal day 40–86). L, layer; WM, white matter. (E) Photoactivation of GtACR2 generated EPSCs in GtACR2– neurons when GtACR2 was expressed during 3 different time windows as indicated in (C). Bumetanide was applied in a subset of experiments and the EPSCs were diminished (n = 12, p=0.0005).

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated photocurrents in a GtACR2+ neuron (top panel, recorded at the membrane potential of +10 mV) and EPSCs in a simultaneously recorded GtACR2– neuron (bottom panel, recorded at the membrane potential of −60 mV). Bumetanide diminished the EPSCs (circle symbols) without affecting the photocurrents (square symbols). Right, summary graph of similar experiments (n = 6; EPSCs, p=0.03; photocurrents, p=0.3). (C,D) As in (A,B), but for iC++. Bumetanide diminished the EPSCs without affecting the photocurrents (n = 3; EPSCs, p=0.03; photocurrents, p=0.7).

Figure 2—figure supplement 3.

Bumetanide does not affect GtACR2 and iC++-mediated photocurrents.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated photocurrents in a GtACR2+ neuron (top panel, recorded at the membrane potential of +10 mV) and EPSCs in a simultaneously recorded GtACR2– neuron (bottom panel, recorded at the membrane potential of −60 mV). Bumetanide diminished the EPSCs (circle symbols) without affecting the photocurrents (square symbols). Right, summary graph of similar experiments (n = 6; EPSCs, p=0.03; photocurrents, p=0.3). (C,D) As in (A,B), but for iC++. Bumetanide diminished the EPSCs without affecting the photocurrents (n = 3; EPSCs, p=0.03; photocurrents, p=0.7).

Reducing intracellular chloride concentrations diminishes the neurotransmitter release induced by activation of GtACR2 or iC++.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were diminished by decreasing intracellular chloride concentrations with an NKCC1 blocker, bumetanide. Right, summary graph of similar experiments (n = 10, p=0.002). (C,D) As in (A,B), but for ChR2. ChR2 activation-induced EPSCs were not affected by bumetanide (n = 8, p=0.9). (E,F) As in (A,B), but for GtACR2 in Pv neurons. GtACR2 activation-induced IPSCs were diminished by bumetanide (n = 9, p=0.004). (G,H) As in (A,B), but for iC++. iC++-induced EPSCs were diminished by bumetanide (n = 6, p=0.009). (I,J) As in (E,F), but for iC++. iC++-induced IPSCs were diminished by bumetanide (n = 8, p=0.008).

The reversal potential of GtACR2 at the soma is similar to that of GABAA receptors.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons and ReaChR in Pv neurons. (B) In a GtACR2+ neuron, GABAergic IPSCs induced by activating ReaChR in Pv neurons (left panel) and GtACR2-mediated photocurrents (right panel) were sequentially recorded at different membrane potentials. The example traces show the currents at the membrane potentials of −50, −60, −65, −66, −68, −70, and −75 mV. A GtACR2– neuron was simultaneously recorded at the membrane potential of +10 mV to ensure that the blue light did not generate IPSCs (right panel). (C) The amplitudes of IPSCs and GtACR2 photocurrents were plotted as a function of the membrane potentials for the GtACR2+ neuron in (B). Each set of data were fit with linear regression and the reversal potentials were determined by the V-axis intercepts. (D) Summary graph of similar experiments in (B,C) where the reversal potential of IPSCs was plotted against that of GtACR2 photocurrents for each GtACR2+ neuron. All data points fall close to the dotted unity line, and there is no significant difference between the reversal potentials of IPSCs and photocurrents (n = 8, p=0.4).

GtACR2-induced neurotransmitter release is not due to rebound depolarization or its long-term expression throughout development.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were not decreased by blocking the Ih current with ZD7288 (20 μM). Right, summary graph of similar experiments showing that the EPSC amplitudes were slightly increased by ZD7288 (n = 12, p=0.03). (C) Schematics of conditional expression of GtACR2 in a subset of layer 2/3 pyramidal neurons. A Flpo-dependent plasmid (FRT-FLEX-GtACR2) was electroporated at embryonic day 15 (E15) and AAV9-hSyn-Flpo was injected into the electroporated mice at different postnatal days (P23, P60, or P64). Green bars indicate the approximate GtACR2 expression time windows. (D) Left, representative fluorescent images of the visual cortex obtained at postnatal day 78 showing that, without injection of AAV9-hSyn-Flpo, transfected neurons (labeled by tdTomato) did not express GtACR2-EYFP (left panel, n = 6 mice, postnatal day 51–150). Right, representative fluorescent images of the visual cortex obtained at postnatal day 40 showing that the expression of GtACR2-EYFP in transfected neurons was turned on by the injection of AAV9-hSyn-Flpo at postnatal day 23 (right panel, n = 7 mice, postnatal day 40–86). L, layer; WM, white matter. (E) Photoactivation of GtACR2 generated EPSCs in GtACR2– neurons when GtACR2 was expressed during 3 different time windows as indicated in (C). Bumetanide was applied in a subset of experiments and the EPSCs were diminished (n = 12, p=0.0005).

Bumetanide does not affect GtACR2 and iC++-mediated photocurrents.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons. (B) Left, photoactivation of GtACR2 generated photocurrents in a GtACR2+ neuron (top panel, recorded at the membrane potential of +10 mV) and EPSCs in a simultaneously recorded GtACR2– neuron (bottom panel, recorded at the membrane potential of −60 mV). Bumetanide diminished the EPSCs (circle symbols) without affecting the photocurrents (square symbols). Right, summary graph of similar experiments (n = 6; EPSCs, p=0.03; photocurrents, p=0.3). (C,D) As in (A,B), but for iC++. Bumetanide diminished the EPSCs without affecting the photocurrents (n = 3; EPSCs, p=0.03; photocurrents, p=0.7).

Expression and activation of GtACR2 in adult neurons cause neurotransmitter release

Since we expressed GtACR2 by in utero electroporation or neonatal AAV injection, we sought to determine if the excitatory effect of GtACR2 was caused by the long-term expression of GtACR2 throughout development that somehow altered the chloride homeostasis. To selectively express GtACR2 in adult neurons, we in utero electroporated a Flpo-dependent plasmid into layer 2/3 pyramidal neurons that will express GtACR2 only if Flpo is present (Figure 2—figure supplement 2C,D). A Flpo-expressing AAV was then injected into the electroporated mice at postnatal week 4 or 9 to turn on the GtACR2 expression. We obtained acute coronal brain slices 1–3 weeks after injecting Flpo-expressing AAV and found that light activation of GtACR2, again, produced bumetanide-sensitive EPSCs in GtACR2– neurons (Figure 2—figure supplement 2E). Thus, it is unlikely that GtACR2 expression during neuronal development alters the chloride homeostasis to render GtACR2 excitatory, as acute expression of GtACR2 in mature neurons had the same effect.

Activation of other light-gated chloride channels causes neurotransmitter release

To determine if activation of other light-gated chloride channels can trigger neurotransmitter release, we examined iC++ and iChloC, two engineered blue light-gated chloride channels that were converted from cation channelrhodopsins (Berndt et al., 2016; Wietek et al., 2015), and GtACR1, another natural anion channelrhodopsin from Guillardia theta (Govorunova et al., 2015). We in utero electroporated plasmids to express iC++ in layer 2/3 pyramidal neurons of the visual cortex and obtained acute coronal brain slices from 3 to 9 week-old mice. Similar to GtACR2, light activation of iC++ generated EPSCs in iC++– layer 2/3 pyramidal neurons that were abolished by NBQX and CPP (amplitude reduced by 97.3 ± 0.9%, mean ± s.e.m., n = 4). Bumetanide diminished the iC++-induced EPSCs (Figure 2G,H) without affecting the iC++-mediated photocurrents (Figure 2—figure supplement 3C,D). We also expressed iC++ in Pv neurons by injecting a Cre-dependent AAV into Pvalb mice and found that light activation of iC++ caused bumetanide-sensitive IPSCs in iC++– layer 2/3 pyramidal neurons (Figure 2I,J). Similarly, when we expressed iChloC in Pv neurons, light activation of iChloC resulted in IPSCs in 10 out of 17 recorded iChloC– layer 2/3 pyramidal neurons (183 ± 42 pA, mean ± s.e.m., n = 10), presumably because iChloC generated smaller photocurrents than iC++ (iChloC, 292 ± 62 pA, n = 7; iC++, 2182 ± 291 pA, n = 15; recorded at the membrane potential of +10 mV; mean ± s.e.m., p<0.0001, t test with Welch’s correction). Finally, activation of GtACR1 in layer 2/3 pyramidal neurons produced EPSCs onto all recorded GtACR1– pyramidal neurons (149 ± 47 pA, mean ± s.e.m., n = 11). Altogether, these results demonstrate that activation of different light-gated chloride channels in neurons can trigger neurotransmitter release.

GtACR2 activation directly depolarizes the presynaptic terminals

We hypothesized that the most likely neuronal compartments rendering GtACR2 excitatory were the distal axon and presynaptic terminals because of the following previous findings. First, activation of presynaptic GABAA or glycine receptors enhanced neurotransmitter release at several synapses of the hippocampus, cerebellum, and brainstem (Jang et al., 2006; Pugh and Jahr, 2011; Ruiz et al., 2010; Stell et al., 2007; Turecek and Trussell, 2001; Zorrilla de San Martin et al., 2017). Second, the chloride concentrations were 4–5 times higher in the presynaptic terminals of the Calyx of Held than the parent soma (Price and Trussell, 2006). Third, there appeared to be an axo-somato-dendritic gradient in which the reversal potentials of GABA from the axon to the soma and dendrites of cortical neurons become progressively more negative (Khirug et al., 2008). To test our hypothesis, we expressed GtACR2 in layer 2/3 pyramidal neurons of the visual cortex in one hemisphere as described above and obtained acute coronal slices from the contralateral hemisphere (Figure 3A). GtACR2 was present in the long-range callosal projections in the contralateral hemisphere (Figure 3—figure supplement 1A), which enabled us to activate GtACR2 in the axon and presynaptic terminals that were severed from their parent somas. Light activation of GtACR2 in the callosal projections generated EPSCs in layer 2/3 pyramidal neurons of the contralateral cortex, which were diminished by TTX (Figure 3—figure supplement 1B,C) or bumetanide (Figure 3B). These results demonstrate that activation of GtACR2 in the axon and presynaptic terminals is sufficient to trigger neurotransmitter release.
Figure 3.

GtACR2 activation directly depolarizes the distal axon and presynaptic terminals and can result in antidromic spikes.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (B) Left, photoactivation of GtACR2 in the callosal axons, severed from their somas, generated EPSCs in a GtACR2– neuron, which were diminished by bumetanide. Right, summary graph of similar experiments (n = 15, p<0.0001). (C) Schematic of slice experiments in (D). GtACR2 in a subset of layer 2/3 pyramidal neurons. (D) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were abolished by TTX, but partially recovered by the addition of voltage-gated potassium channel blockers, 4-AP (1.5 mM) and TEA (1.5 mM). Right, summary graph of similar experiments (n = 10; TTX vs. control, p=0.02, average EPSC amplitude in TTX was 2% of control; TTX + 4-AP + TEA vs. TTX, p=0.0004, average EPSC amplitude in TTX + 4-AP + TEA was 35% of control). (E,F) As in (C,D), but for Pv neurons. GtACR2 activation-induced IPSCs were abolished by TTX, but partially recovered by 4-AP and TEA (n = 9; TTX vs. control, p=0.006, average IPSC amplitude in TTX was 0.9% of control; TTX + 4-AP + TEA vs. TTX, p=0.008, average IPSC amplitude in TTX + 4-AP + TEA was 23% of control). (G) Schematic of slice experiments in (H). GtACR2 in a subset of layer 2/3 pyramidal neurons. (H) Photoactivation of GtACR2 generated antidromic spikes in GtACR2+ pyramidal neurons, which were not affected by NBQX and CPP, but were abolished by TTX in both loose-patch (left panel) and whole-cell (right panel) recordings. In the whole-cell recordings, the resting membrane potentials of those neurons that generated antidromic spikes were −68.1 ± 1.7 mV (mean ± s.e.m., n = 21). (I,J) As in (G,H), but for Pv neurons. The antidromic spikes in GtACR2+ Pv neurons were abolished by TTX. In the whole-cell recordings, the resting membrane potentials of those neurons that generated antidromic spikes were −60.0 ± 2.4 mV (mean ± s.e.m., n = 7).

(A) GtACR2-EYFP and tdTomato were expressed in a subset of layer 2/3 pyramidal neurons in the visual cortex of one hemisphere. Representative fluorescent images of the contralateral hemisphere showing GtACR2-EYFP (left panel) in the callosal projections labeled by tdTomato (right panel). L, layer; WM, white matter. (B) Schematic of slice experiments in (C). GtACR2-EYFP in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (C) Left, photoactivation of GtACR2 in the callosal axons generated EPSCs in a GtACR2– neuron, which were abolished by TTX. Right, summary graph of similar experiments (n = 9, p=0.004).

Figure 3—figure supplement 1.

Activation of GtACR2 in the callosal axons causes neurotransmitter release.

(A) GtACR2-EYFP and tdTomato were expressed in a subset of layer 2/3 pyramidal neurons in the visual cortex of one hemisphere. Representative fluorescent images of the contralateral hemisphere showing GtACR2-EYFP (left panel) in the callosal projections labeled by tdTomato (right panel). L, layer; WM, white matter. (B) Schematic of slice experiments in (C). GtACR2-EYFP in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (C) Left, photoactivation of GtACR2 in the callosal axons generated EPSCs in a GtACR2– neuron, which were abolished by TTX. Right, summary graph of similar experiments (n = 9, p=0.004).

GtACR2 activation directly depolarizes the distal axon and presynaptic terminals and can result in antidromic spikes.

(A) Schematic of slice experiments in (B). GtACR2 in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (B) Left, photoactivation of GtACR2 in the callosal axons, severed from their somas, generated EPSCs in a GtACR2– neuron, which were diminished by bumetanide. Right, summary graph of similar experiments (n = 15, p<0.0001). (C) Schematic of slice experiments in (D). GtACR2 in a subset of layer 2/3 pyramidal neurons. (D) Left, photoactivation of GtACR2 generated EPSCs in a GtACR2– neuron, which were abolished by TTX, but partially recovered by the addition of voltage-gated potassium channel blockers, 4-AP (1.5 mM) and TEA (1.5 mM). Right, summary graph of similar experiments (n = 10; TTX vs. control, p=0.02, average EPSC amplitude in TTX was 2% of control; TTX + 4-AP + TEA vs. TTX, p=0.0004, average EPSC amplitude in TTX + 4-AP + TEA was 35% of control). (E,F) As in (C,D), but for Pv neurons. GtACR2 activation-induced IPSCs were abolished by TTX, but partially recovered by 4-AP and TEA (n = 9; TTX vs. control, p=0.006, average IPSC amplitude in TTX was 0.9% of control; TTX + 4-AP + TEA vs. TTX, p=0.008, average IPSC amplitude in TTX + 4-AP + TEA was 23% of control). (G) Schematic of slice experiments in (H). GtACR2 in a subset of layer 2/3 pyramidal neurons. (H) Photoactivation of GtACR2 generated antidromic spikes in GtACR2+ pyramidal neurons, which were not affected by NBQX and CPP, but were abolished by TTX in both loose-patch (left panel) and whole-cell (right panel) recordings. In the whole-cell recordings, the resting membrane potentials of those neurons that generated antidromic spikes were −68.1 ± 1.7 mV (mean ± s.e.m., n = 21). (I,J) As in (G,H), but for Pv neurons. The antidromic spikes in GtACR2+ Pv neurons were abolished by TTX. In the whole-cell recordings, the resting membrane potentials of those neurons that generated antidromic spikes were −60.0 ± 2.4 mV (mean ± s.e.m., n = 7).

Activation of GtACR2 in the callosal axons causes neurotransmitter release.

(A) GtACR2-EYFP and tdTomato were expressed in a subset of layer 2/3 pyramidal neurons in the visual cortex of one hemisphere. Representative fluorescent images of the contralateral hemisphere showing GtACR2-EYFP (left panel) in the callosal projections labeled by tdTomato (right panel). L, layer; WM, white matter. (B) Schematic of slice experiments in (C). GtACR2-EYFP in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (C) Left, photoactivation of GtACR2 in the callosal axons generated EPSCs in a GtACR2– neuron, which were abolished by TTX. Right, summary graph of similar experiments (n = 9, p=0.004). If GtACR2-mediated chloride currents are excitatory in the presynaptic terminals, then GtACR2 should be similar to ChR2, whose activation can directly depolarize the presynaptic membrane in the absence of action potentials to trigger neurotransmitter release (Petreanu et al., 2009). To test this prediction, we recorded EPSCs or IPSCs in GtACR2– neurons while activating GtACR2 in layer 2/3 pyramidal neurons or Pv neurons, respectively (Figure 3C,E). As described above, bath application of TTX abolished the EPSCs and IPSCs. However, when we further blocked voltage-gated potassium channels by 4-aminopyridine (4-AP) and tetraethylammonium (TEA) to prolong membrane depolarization (Petreanu et al., 2009), the EPSCs and IPSCs were partially recovered (Figure 3D,F). These results indicate that in the absence of action potentials, light activation of GtACR2 is sufficient to depolarize the presynaptic membrane to open voltage-gated calcium channels and trigger neurotransmitter release. We further tested if GtACR2-induced axonal depolarization could evoke antidromic action potentials by performing extracellular loose-patch or whole-cell current clamp recordings at the somas of GtACR2+ pyramidal neurons. We observed antidromic spikes in 9 out of 88 neurons recorded in loose-patch configuration and 21 out of 56 neurons recorded in whole-cell configuration in response to blue light stimulation (Figure 3G,H). In the whole-cell current clamp recordings, although the chloride concentration in the patch pipette solution sets the Nernst equilibrium potential of chloride around −85 mV (see Materials and methods), blue light induced a depolarization following the initial hyperpolarization. This observation is consistent with the notion that the depolarization antidromically propagated from the distal axon to the soma (Figure 3H). The antidromic spikes were not affected by NBQX and CPP, but were abolished by TTX (Figure 3H), indicating that the spikes were generated within the GtACR2+ neurons, rather than by excitatory inputs from other neurons. Antidromic spikes were only observed in a subset of neurons, likely because the GtACR2 expression levels are heterogeneous in different neurons, and the hyperpolarization initiated at the soma can orthodromically propagate to counteract the antidromic spikes. Similarly, TTX-sensitive antidromic spikes were observed in a subset of GtACR2+ Pv neurons (3 out of 11 neurons in loose-patch configuration and 7 out of 17 neurons in whole-cell configuration, Figure 3I,J). These results show that GtACR2-induced axonal depolarization can be sufficient to elicit antidromic action potentials.

Targeting GtACR2 to the somatodendritic domain reduces light-induced neurotransmitter release

Activating GtACR2 and other light-gated chloride channels inhibits the soma but depolarizes the presynaptic terminals to release neurotransmitters. This dichotomic effect can confound the utilization of these channels as inhibitory optogenetic tools for suppressing neuronal activity. We reasoned that reducing the trafficking of light-gated chloride channels into the axon and presynaptic terminals should reduce or eliminate their depolarizing action. Thus, we sought to restrict GtACR2 within the somatodendritic domain of neurons by fusing GtACR2 with a number of reported somatodendritic targeting motifs including a 26-amino acid Myosin Va-binding domain of Melanophilin (MBD) (Lewis et al., 2009), a 32-amino acid cytoplasmic C-terminal motif of Neuroligin 1 (Nlgn1C) (Rosales et al., 2005), a 16-amino acid dileucine-containing motif of potassium channel Kv4.2 (Kv4.2LL) (Rivera et al., 2003), the N-terminal 150 residues of kainate receptor subunit 2 (KA2N) (Shemesh et al., 2017), the C-terminal 17 residues of Telencephalin (TlcnC) (Mitsui et al., 2005), and a 65-amino acid cytoplasmic C-terminal motif of potassium channel Kv2.1 (Kv2.1C) (Lim et al., 2000; Wu et al., 2013). Each of these GtACR2 variants (Table 1), along with tdTomato, were expressed in layer 2/3 pyramidal neurons of the visual cortex by in utero electroporation (Figure 4A). Since GtACR2 was tagged with EYFP or EGFP, we compared the EYFP or EGFP fluorescence in layer 5, which only contains the axons of layer 2/3 pyramidal neurons, with the EYFP or EGFP fluorescence in layer 2/3 to estimate the distribution of GtACR2 between the axon and somatodendritic domain. We normalized the EYFP or EGFP fluorescence ratio between layer 5 and layer 2/3 by the tdTomato fluorescence ratio between layer 5 and layer 2/3 to control for variations in the collateral axons. Among tested motifs, TlcnC and Kv2.1C were most effective in targeting GtACR2 to the soma and dendrites (Figure 4D). As these two motifs may engage different trafficking mechanisms, we combined them to create two hybrid motifs, Kv2.1C-TlcnC and Kv2.1C-linker-TlcnC. Kv2.1C-linker-TlcnC turned out to be the best in restricting GtACR2 within the somatodendritic domain (Figure 4A,D). Interestingly, GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC showed less intracellular aggregation than wild type GtACR2 (Figure 4B), suggesting that the somatodendritic targeting motifs also enhance the surface expression of GtACR2. Finally, the EYFP fluorescence of the callosal projections in the contralateral hemisphere was also reduced for GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC as compared to GtACR2-EYFP (Figure 4C,E), demonstrating that both somatodendritic targeting motifs decreased the trafficking of GtACR2 into the distal axon.
Table 1.

Amino acid sequences of somatodendritic targeting motifs.

Black bold, amino acid sequences of somatodendritic targeting motifs; blue, GtACR2; red, EYFP or EGFP; purple, linker.

MotifSequence
MBDGtACR2-EYFP-GSGSGTRGSGS-RDQPLNSKKKKRLLSFRDVDFEEDSD
Nlgn1CGtACR2-EYFP-VVLRTACPPDYTLAMRRSPDDIPLMTPNTITM
Kv4.2LLGtACR2-EYFP-FETQHHHLLHCLEKTT
KA2NGtACR2-GGSGGTGGSGGT-MPAELLLLLIVAFANPSCQVLSSLRMAAILDDQ TVCGRGERLALALAREQINGIIEVPAKARVEVDIFELQRDSQYETTDTMCQIL PKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPS NEDVSLAVS-GASGGT-EGFP
TlcnCGtACR2-EYFP-AESPADGEVFAIQLTSS
Kv2.1CGtACR2-EYFP-QSQPILNTKEMAPQSKPPEELEMSSMPSPVAPLPARTEGVID MRSMSSIDSFISCATDFPEATRF
Kv2.1C-TlcnCGtACR2-EYFP-QSQPILNTKEMAPQSKPPEELEMSSMPSPVAPLPARTEGVID MRSMSSIDSFISCATDFPEATRF-AESPADGEVFAIQLTSS
Kv2.1C-linker-TlcnCGtACR2-EYFP-QSQPILNTKEMAPQSKPPEELEMSSMPSPVAPLPARTEGVID MRSMSSIDSFISCATDFPEATRF-GSGSGSGSGS-AESPADGEVFAIQLTSS
Figure 4.

Targeting GtACR2 to neuronal somatodendritic domain.

(A) Wild type (WT) GtACR2 and its variants tagged with EYFP or EGFP were expressed along with tdTomato in a subset of layer 2/3 pyramidal neurons. Representative fluorescent images of the cortices showing the distribution of GtACR2. Note the strong EYFP fluorescence in layer 5 for WT GtACR2 and weak EYFP fluorescence in layer 5 for some somatodendritically targeted GtACR2 variants (e.g., Kv2.1C-linker-TlcnC). L, layer; WM, white matter. (B) Representative fluorescent images of electroporated neurons showing that GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC were more concentrated on the membranes at the soma and proximal dendrites (arrows) than GtACR2-EYFP. Note the intracellular aggregation of GtACR2-EYFP (arrow head). (C) Representative fluorescent images of the contralateral hemisphere showing less GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC in the callosal projections than GtACR2-EYFP. The callosal projections were labeled by tdTomato. (D) Summary data of the experiments in (A). The EYFP or EGFP fluorescence ratio between layer 5 and layer 2/3 was normalized by the tdTomato fluorescence ratio between layer 5 and layer 2/3. A reduction in the normalized EYFP or EGFP fluorescence ratio indicates a shift of the EYFP or EGFP distribution from the axon to somatodendritic domain. (E) Summary data of the experiments in (C). The ratio of EYFP fluorescence to tdTomato fluorescence of the callosal projections in the contralateral hemisphere. A reduction in the ratio indicates less EYFP in the callosal axons. The numbers of analyzed slices were indicated in the panels. The columns and error bars are mean ± s.e.m. **p<0.01, ****p<0.0001.

Targeting GtACR2 to neuronal somatodendritic domain.

(A) Wild type (WT) GtACR2 and its variants tagged with EYFP or EGFP were expressed along with tdTomato in a subset of layer 2/3 pyramidal neurons. Representative fluorescent images of the cortices showing the distribution of GtACR2. Note the strong EYFP fluorescence in layer 5 for WT GtACR2 and weak EYFP fluorescence in layer 5 for some somatodendritically targeted GtACR2 variants (e.g., Kv2.1C-linker-TlcnC). L, layer; WM, white matter. (B) Representative fluorescent images of electroporated neurons showing that GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC were more concentrated on the membranes at the soma and proximal dendrites (arrows) than GtACR2-EYFP. Note the intracellular aggregation of GtACR2-EYFP (arrow head). (C) Representative fluorescent images of the contralateral hemisphere showing less GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC in the callosal projections than GtACR2-EYFP. The callosal projections were labeled by tdTomato. (D) Summary data of the experiments in (A). The EYFP or EGFP fluorescence ratio between layer 5 and layer 2/3 was normalized by the tdTomato fluorescence ratio between layer 5 and layer 2/3. A reduction in the normalized EYFP or EGFP fluorescence ratio indicates a shift of the EYFP or EGFP distribution from the axon to somatodendritic domain. (E) Summary data of the experiments in (C). The ratio of EYFP fluorescence to tdTomato fluorescence of the callosal projections in the contralateral hemisphere. A reduction in the ratio indicates less EYFP in the callosal axons. The numbers of analyzed slices were indicated in the panels. The columns and error bars are mean ± s.e.m. **p<0.01, ****p<0.0001.

Amino acid sequences of somatodendritic targeting motifs.

Black bold, amino acid sequences of somatodendritic targeting motifs; blue, GtACR2; red, EYFP or EGFP; purple, linker. To determine how targeting GtACR2 to the somatodendritic domain affects its photocurrent and ability to trigger neurotransmitter release, we compared the somatodendritically targeted GtACR2 variants, GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC, with wild type GtACR2 in the same litters of mice. We first recorded GtACR2+ layer 2/3 pyramidal neurons and found that the blue light-activated photocurrents of GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC were 2.1–2.4 and 2.7–3.5 folds of GtACR2-EYFP photocurrents, respectively (Figure 5A–C and Figure 5—figure supplement 1A,C,E,G). We then recorded the EPSCs in GtACR2– layer 2/3 pyramidal neurons in response to different strengths of blue light stimulation. The EPSCs evoked by activating GtACR2-EYFP-Kv2.1C or GtACR2-EYFP-Kv2.1C-linker-TlcnC were reduced by 52–60% or 65–77%, respectively, as compared to those evoked by activating GtACR2-EYFP (Figure 5D–G and Figure 5—figure supplement 1B,D,F,H). In a subset of experiments with GtACR2-EYFP-Kv2.1C or GtACR2-EYFP-Kv2.1C-linker-TlcnC, the lowest light stimulation strength could no longer evoke EPSCs in GtACR2– neurons, but still induced robust photocurrents in GtACR2+ neurons (Figure 5—figure supplement 1E–H). Furthermore, when photostimulating the callosal projections, the EPSCs in layer 2/3 pyramidal neurons of the contralateral cortex were reduced by 54% and 73% for GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC, respectively, as compared to GtACR2-EYFP (Figure 5H,I). These results show that the somatodendritic targeting motifs, especially Kv2.1C-linker-TlcnC, shift GtACR2 from the axon towards the soma and dendrites, thereby reducing the excitatory action in the axon and presynaptic terminals while enhancing the inhibitory currents at the soma and dendrites.
Figure 5.

Activation of somatodendritically targeted GtACR2 variants generates larger photocurrents but causes less neurotransmitter release than wild type GtACR2.

(A) Schematic of slice experiments in (B,C). GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. (B) Somatic photocurrents recorded at the membrane potential of +10 mV from GtACR2-EYFP-, GtACR2-EYFP-Kv2.1C-, or GtACR2-EYFP-Kv2.1C-linker-TlcnC-expressing neurons in response to a blue light pulse of 1 ms and 2.5 mW/mm2. (C) Summary graph showing the photocurrent peak amplitudes in response to a blue light pulse of 1 ms and 2.5 mW/mm2. (D,E) As in (A,B), but for recording EPSCs in GtACR2– layer 2/3 pyramidal neurons in response to a blue light pulse of 5 ms and 2.9 mW/mm2. (F,G) Summary graphs showing the EPSC amplitudes in response to a blue light pulse of 1 ms and 2.5 mW/mm2 (F), 5 ms and 2.9 mW/mm2 (G, left panel), or 5 ms and 16.1 mW/mm2 (G, right panel). Note that at the stimulation strength of 1 ms and 2.5 mW/mm2 (F), EPSCs were not observed in a subset of neurons, particularly for GtACR2-EYFP-Kv2.1C-linker-TlcnC. (H) Schematic of slice experiments in (I). GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (I) Summary graphs showing the EPSC amplitudes of GtACR2– layer 2/3 pyramidal neurons in response to stimulating the callosal axons with a blue light pulse of 5 ms and 23.6 mW/mm2. The numbers of recorded neurons were indicated in the panels. The columns and error bars are mean ± s.e.m. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

(A,B) Schematics of slice experiments in (C,E,G) and (D,F,H), respectively. GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. (C,D) Summary graph showing the photocurrent peak amplitudes (C) and EPSC amplitudes (D) in response to a blue light pulse of 1 ms and 2.3 mW/mm2. Note that at this stimulation strength, EPSCs were not observed in a subset of neurons, particularly for GtACR2-EYFP-Kv2.1C-linker-TlcnC. (E,F) Summary graph showing that in a subset of experiments for WT GtACR2-EYFP (top panels) and GtACR2-EYFP-Kv2.1C (bottom panels), photocurrents (E) or EPSCs (F) were recorded in response to all four different strengths of stimulation (#1: 1 ms and 2.3 mW/mm2, #2: 1 ms and 2.5 mW/mm2, #3: 5 ms and 2.9 mW/mm2, and #4: 5 ms and 16.1 mW/mm2). (G,H) As in (E,F), but for WT GtACR2-EYFP (top panels) and GtACR2-EYFP-Kv2.1C-linker-TlcnC (bottom panels). Note that for GtACR2-EYFP-Kv2.1C-linker-TlcnC, EPSCs were absent in 13 out of 38 GtACR2– neurons when the stimulation strength decreased to 1 ms and 2.3 mW/mm2, whereas photocurrents were still observed in all recorded GtACR2+ neurons at this stimulation strength. (I) Left, schematic of slice experiments. GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. EPSCs and photocurrents were simultaneously recorded from a GtACR2– neuron and a GtACR2+ neuron, respectively. Right, in 3 experiments where the EPSCs in GtACR2– neurons were absent when the stimulation strength decreased to 1 ms and 2.3 mW/mm2 or 2.5 mW/mm2, the photocurrent peak amplitudes and EPSC amplitudes from these pairs of GtACR2+ and GtACR2– neurons were plotted as a function of light stimulation strength. Each shape of the symbols represents one pair of neurons. Note that GtACR2+ neurons still showed robust photocurrents when the EPSCs in GtACR2– neurons reduced to zero.

Figure 5—figure supplement 1.

GtACR2-induced photocurrents and EPSCs at different strengths of blue light stimulation.

(A,B) Schematics of slice experiments in (C,E,G) and (D,F,H), respectively. GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. (C,D) Summary graph showing the photocurrent peak amplitudes (C) and EPSC amplitudes (D) in response to a blue light pulse of 1 ms and 2.3 mW/mm2. Note that at this stimulation strength, EPSCs were not observed in a subset of neurons, particularly for GtACR2-EYFP-Kv2.1C-linker-TlcnC. (E,F) Summary graph showing that in a subset of experiments for WT GtACR2-EYFP (top panels) and GtACR2-EYFP-Kv2.1C (bottom panels), photocurrents (E) or EPSCs (F) were recorded in response to all four different strengths of stimulation (#1: 1 ms and 2.3 mW/mm2, #2: 1 ms and 2.5 mW/mm2, #3: 5 ms and 2.9 mW/mm2, and #4: 5 ms and 16.1 mW/mm2). (G,H) As in (E,F), but for WT GtACR2-EYFP (top panels) and GtACR2-EYFP-Kv2.1C-linker-TlcnC (bottom panels). Note that for GtACR2-EYFP-Kv2.1C-linker-TlcnC, EPSCs were absent in 13 out of 38 GtACR2– neurons when the stimulation strength decreased to 1 ms and 2.3 mW/mm2, whereas photocurrents were still observed in all recorded GtACR2+ neurons at this stimulation strength. (I) Left, schematic of slice experiments. GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. EPSCs and photocurrents were simultaneously recorded from a GtACR2– neuron and a GtACR2+ neuron, respectively. Right, in 3 experiments where the EPSCs in GtACR2– neurons were absent when the stimulation strength decreased to 1 ms and 2.3 mW/mm2 or 2.5 mW/mm2, the photocurrent peak amplitudes and EPSC amplitudes from these pairs of GtACR2+ and GtACR2– neurons were plotted as a function of light stimulation strength. Each shape of the symbols represents one pair of neurons. Note that GtACR2+ neurons still showed robust photocurrents when the EPSCs in GtACR2– neurons reduced to zero.

Activation of somatodendritically targeted GtACR2 variants generates larger photocurrents but causes less neurotransmitter release than wild type GtACR2.

(A) Schematic of slice experiments in (B,C). GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. (B) Somatic photocurrents recorded at the membrane potential of +10 mV from GtACR2-EYFP-, GtACR2-EYFP-Kv2.1C-, or GtACR2-EYFP-Kv2.1C-linker-TlcnC-expressing neurons in response to a blue light pulse of 1 ms and 2.5 mW/mm2. (C) Summary graph showing the photocurrent peak amplitudes in response to a blue light pulse of 1 ms and 2.5 mW/mm2. (D,E) As in (A,B), but for recording EPSCs in GtACR2– layer 2/3 pyramidal neurons in response to a blue light pulse of 5 ms and 2.9 mW/mm2. (F,G) Summary graphs showing the EPSC amplitudes in response to a blue light pulse of 1 ms and 2.5 mW/mm2 (F), 5 ms and 2.9 mW/mm2 (G, left panel), or 5 ms and 16.1 mW/mm2 (G, right panel). Note that at the stimulation strength of 1 ms and 2.5 mW/mm2 (F), EPSCs were not observed in a subset of neurons, particularly for GtACR2-EYFP-Kv2.1C-linker-TlcnC. (H) Schematic of slice experiments in (I). GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons in the contralateral hemisphere. (I) Summary graphs showing the EPSC amplitudes of GtACR2– layer 2/3 pyramidal neurons in response to stimulating the callosal axons with a blue light pulse of 5 ms and 23.6 mW/mm2. The numbers of recorded neurons were indicated in the panels. The columns and error bars are mean ± s.e.m. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

GtACR2-induced photocurrents and EPSCs at different strengths of blue light stimulation.

(A,B) Schematics of slice experiments in (C,E,G) and (D,F,H), respectively. GtACR2-EYFP, GtACR2-EYFP-Kv2.1C, or GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. (C,D) Summary graph showing the photocurrent peak amplitudes (C) and EPSC amplitudes (D) in response to a blue light pulse of 1 ms and 2.3 mW/mm2. Note that at this stimulation strength, EPSCs were not observed in a subset of neurons, particularly for GtACR2-EYFP-Kv2.1C-linker-TlcnC. (E,F) Summary graph showing that in a subset of experiments for WT GtACR2-EYFP (top panels) and GtACR2-EYFP-Kv2.1C (bottom panels), photocurrents (E) or EPSCs (F) were recorded in response to all four different strengths of stimulation (#1: 1 ms and 2.3 mW/mm2, #2: 1 ms and 2.5 mW/mm2, #3: 5 ms and 2.9 mW/mm2, and #4: 5 ms and 16.1 mW/mm2). (G,H) As in (E,F), but for WT GtACR2-EYFP (top panels) and GtACR2-EYFP-Kv2.1C-linker-TlcnC (bottom panels). Note that for GtACR2-EYFP-Kv2.1C-linker-TlcnC, EPSCs were absent in 13 out of 38 GtACR2– neurons when the stimulation strength decreased to 1 ms and 2.3 mW/mm2, whereas photocurrents were still observed in all recorded GtACR2+ neurons at this stimulation strength. (I) Left, schematic of slice experiments. GtACR2-EYFP-Kv2.1C-linker-TlcnC in a subset of layer 2/3 pyramidal neurons. EPSCs and photocurrents were simultaneously recorded from a GtACR2– neuron and a GtACR2+ neuron, respectively. Right, in 3 experiments where the EPSCs in GtACR2– neurons were absent when the stimulation strength decreased to 1 ms and 2.3 mW/mm2 or 2.5 mW/mm2, the photocurrent peak amplitudes and EPSC amplitudes from these pairs of GtACR2+ and GtACR2– neurons were plotted as a function of light stimulation strength. Each shape of the symbols represents one pair of neurons. Note that GtACR2+ neurons still showed robust photocurrents when the EPSCs in GtACR2– neurons reduced to zero.

Discussion

Optogenetic suppression of neuronal activity and synaptic outputs is an essential approach for dissecting the roles of specific neurons in brain functions. Light-gated chloride channels, particularly GtACR1 and GtACR2, are increasingly used due to their large photocurrents and high sensitivity to light (Forli et al., 2018; Mardinly et al., 2018; Mauss et al., 2017; Mohamed et al., 2017; Mohammad et al., 2017). To use these tools to their full potentials, it is necessary that we understand their function and, importantly, their limitations. Our experiments reveal that wide-field activation of these channels in cortical neurons suppresses action potentials at the soma but also triggers neurotransmitter release at the presynaptic terminals, thereby voiding inhibition of neuronal activity. As demonstrated, the excitatory action of chloride channels in the axon and presynaptic terminals is due to the high intracellular chloride concentrations that create a depolarizing chloride electrochemical gradient. The depolarizing effect of presynaptic chloride channels, GABAA or glycine receptors, has been documented at a few synapses in the hippocampus, cerebellum, and brainstem through application of agonists or antagonists (Jang et al., 2006; Pugh and Jahr, 2011; Ruiz et al., 2010; Stell et al., 2007; Turecek and Trussell, 2001; Zorrilla de San Martin et al., 2017). Our results in cortical excitatory and inhibitory neurons expand previous findings and indicate that a presynaptic depolarizing chloride electrochemical gradient is likely a general property across brain regions and neuronal types. More importantly, our experiments directly demonstrate that activation of presynaptic chloride channels is in fact excitatory, as it can elicit action potentials with short latency, which was difficult to explicitly demonstrate by agonist application (Pugh and Jahr, 2011). Thus, light-gated chloride channels can be targeted to different brain regions, cell types, and subcellular compartments to study chloride electrochemical gradients with unprecedented temporal precision. Although the excitatory effect of light-gated chloride channels is undesired for neuronal silencing, a potential utilization of their dual actions at the presynaptic terminals and soma is to activate specific projections of neurons while minimizing the effect of antidromic spikes. For example, long-range projection neurons often target multiple brain areas, and sometimes it is desired to selectively excite the axonal terminals projecting to one particular area. If ChR2 is used, local activation of ChR2-expressing axonal terminals may generate antidromic spikes, which will affect other projections. However, if GtACR2 is used, one can simultaneously activate GtACR2 in the soma and axonal terminals. Axonal depolarization will result in neurotransmitter release, but the antidromic spikes will be reduced or suppressed by the hyperpolarization originating from the somatodendritic domain, which reduces the likelihood of activating other projections. To create a better inhibitory optogenetic tool, we tested a number of somatodendritic targeting motifs to confine GtACR2 in the soma and dendrites. We generated a hybrid motif, Kv2.1C-linker-TlcnC, that was more effective than the widely used Kv2.1C (Baker et al., 2016; Mardinly et al., 2018; Wu et al., 2013). The Kv2.1C motif was recently used in a bioRxiv preprint (Mahn et al., 2017) to target GtACR2 to the somatodendritic domain. This GtACR2 variant achieved a greater reduction of neurotransmitter release from the contralateral callosal projections of medial prefrontal cortical neurons than what we observed with our GtACR2-EYFP-Kv2.1C and GtACR2-EYFP-Kv2.1C-linker-TlcnC in visual cortical neurons. This quantitative difference is likely due to different expression levels, light stimulation strengths, or neuronal types (see discussion below), which reiterates the importance of precisely characterizing the effect of light-gated chloride channels, specific to each experimental design, when using them to manipulate neuronal activity. While GtACR2-EYFP-Kv2.1C-linker-TlcnC can still traffic to the axon to cause neurotransmitter release, it is thus far the most improved light-gated chloride channel for optogenetic inhibition. Since it can generate much larger photocurrents in the somatodendritic domain than what is necessary to suppress action potentials, one approach to use this tool is to reduce the overall GtACR2 expression level to further decrease its presence in the axon while still generating sufficient inhibitory photocurrents at the soma. Supporting this idea, post hoc analysis of our experiments indicates that, for a given experiment, it is possible to identify a light stimulation strength that is low enough not to cause neurotransmitter release but still produce large inhibitory photocurrents in GtACR2+ neurons (Figure 5—figure supplement 1). However, this stimulation strength must be empirically determined for every experiment. Furthermore, since during continuous activation of GtACR2, large and synchronous neurotransmitter release occurs at the early phase of the light stimulation (Figure 1—figure supplement 3), one may also take advantage of the late phase when neurotransmitter release is reduced but photocurrent is still robust for optogenetic inhibition experiments. Another approach is to selectively photostimulate GtACR2 at the soma by two-photon excitation (Forli et al., 2018; Mardinly et al., 2018). However, it is difficult to apply this photoactivation approach to freely moving animals or deep brain areas. Therefore, it is imperative that we further engineer light-gated chloride channels to eliminate their excitatory action in the axonal terminals. Future strategies include generating more effective somatodendritic targeting motifs, creating outwardly rectifying channels, and the combination of both strategies. The GtACR2-EYFP-Kv2.1C-linker-TlcnC reported here enhances the available toolkit for optogenetic inhibition and will serve as the foundation for future improvement.

Materials and methods

Mice

All procedures to maintain and use mice were approved by the Institutional Animal Care and Use Committee at Baylor College of Medicine. Mice were maintained on a 14 hr:10 hr light:dark cycle with regular mouse chow and water ad libitum. Experiments were performed during the light cycle. ICR (CD-1) female mice were purchased from Baylor College of Medicine Center for Comparative Medicine or Charles River Laboratories. C57BL6/J, Pvalb-2A-Cre, and Pvalb-2A-Flpo mice were obtained from Jackson Laboratory (stock numbers 000664, 012358, and 022730, respectively). Both male and female mice were used in the experiments. The mice were used at the age of 3–9 weeks for experiments, except for the conditional expression of GtACR2 in adults, where mice were used at the age of 10–12 weeks.

DNA constructs

Plasmids pLenti-UbiC-GtACR2-EYFP (Addgene #67877) and pLenti-UbiC-GtACR1-EYFP (Addgene #67795) were obtained from Dr. John Spudich, pAAV-CaMKIIα-iC++-TS-EYFP and pAAV-EF1α-DIO-iC++-TS-EYFP from Dr. Karl Deisseroth, pAAV-EF1α-DIO-iChloC-T2A-mCherry from Drs. Matthew Caudill and Massimo Scanziani, pCAG-tdTomato from Anirvan Ghosh, and pCAG-Cre from Addgene (#13775). Plasmid pCAG-Flpo (Addgene #60662) was previously described (Xue et al., 2014). All other plasmids were generated and deposited at Addgene as below. pCAG-hChR2(H134R)-EYFP (Addgene #114367) was created by replacing the EGFP in pCAG-EGFP (Addgene #11150) with the hChR2(H134R)-EYFP from pAAV-EF1α-DIO-hChR2(H134R)-EYFP (Addgene #20298). pAAV-EF1α-DIO-ReaChR-P2A-dTomato (Addgene #114368) was created by replacing the oChIEF(E163A T199C) in pAAV-EF1α-DIO-oChIEF(E163A T199C)-P2A-dTomato (Addgene #51094) with the ReaChR from pAAV-hSyn-FLEX-ReaChR-Citrine (Addgene #50955). pAAV-EF1α-FRT-FLEX-GtACR2-EYFP (Addgene #114369) and pAAV-EF1α-FRT-FLEX-GtACR1-EYFP (Addgene #114370) were created by replacing the mNaChBac-T2A-tdTomato in pAAV-EF1α-FRT-FLEX-mNaChBac-T2A-tdTomato (Addgene #60658) with the GtACR2-EYFP and GtACR1-EYFP from pLenti-UbiC-GtACR2-EYFP and pLenti-UbiC-GtACR1-EYFP, respectively. Motifs MBD and TlcnC were generated by PCR primers. Motifs Nlgn1C and Kv4.2LL were generated by PCR from pAAV-CAG-post-mGRASP-2A-dTomato (Addgene #34912) and a Kv4.2-expressing plasmid, respectively. Motif Kv2.1C was obtained from pAAV-EF1α-DIO-hChR2(H134R)-EYFP-Kv2.1C (Wu et al., 2013). Motifs Kv2.1C-TlcnC and Kv2.1C-linker-TlcnC were generated by PCR from Kv2.1C and TlcnC. All motifs were then added to the C-terminus of the GtACR2-EYFP to create pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-MBD (Addgene #114371), pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-Nlgn1C (Addgene #114372), pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-Kv4.2LL (Addgene #114373), pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-TlcnC (Addgene #114374), pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-Kv2.1C (Addgene #114375), pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-Kv2.1C-TlcnC (Addgene #114376), and pAAV-EF1α-FRT-FLEX-GtACR2-EYFP-Kv2.1C-linker-TlcnC (Addgene #114377). pAAV-EF1α-FRT-FLEX-GtACR2-KA2N-EGFP (Addgene #114378) was created by replacing the EYFP in pAAV-EF1α-FRT-FLEX-GtACR2-EYFP with the KA2N-EGFP from pAAV-hSyn-soCoChR-EGFP (Addgene #107708).

In utero electroporation

Female ICR mice were crossed with male C57BL6/J, Pvalb-2A-Cre, or Pvalb-2A-Flpo mice to obtain timed pregnancies. In utero electroporation was performed as previously described (Xue et al., 2014) with a square-wave pulse generator (Gemini X2, BTX Harvard Bioscience). To express GtACR2, GtACR1, iC++, or ChR2 in layer 2/3 pyramidal neurons, pLenti-UbiC-GtACR2-EYFP, pLenti-UbiC-GtACR1-EYFP, pAAV-CaMKIIα-iC++-TS-EYFP, or pCAG-hChR2(H134R)-EYFP (all 2 µg/µl) was used, respectively. In a few experiments, pAAV-EF1α-FRT-FLEX-GtACR2-EYFP (2 µg/µl) with pCAG-Flpo (0.2 µg/µl), pAAV-EF1α-FRT-FLEX-GtACR1-EYFP (2 µg/µl) with pCAG-Flpo (0.2 µg/µl), or pAAV-EF1α-DIO-iC++-TS-EYFP (2 µg/µl) with pCAG-Cre (0.2 µg/µl) was used to express GtACR2, GtACR1, or iC++, respectively. To express somatodendritically targeted GtACR2 variants in layer 2/3 pyramidal neurons and compare them with wild type GtACR2, the pAAV-EF1α-FRT-FLEX constructs described above were used (all 2 µg/µl) with pCAG-Flpo (0.2 µg/µl). pCAG-tdTomato (0.1 µg/µl) was included in all experiments. The plasmid concentrations stated above were final concentrations in the plasmid mix. Transfected pups were identified by the transcranial fluorescence of tdTomato with a MZ10F stereomicroscope (Leica) 1–2 days after birth.

AAV production and injection

All recombinant AAV serotype 9 vectors were produced by the Gene Vector Core at Baylor College of Medicine except AAV9-hSyn-Flpo (Addgene #60663), which was produced by the Penn Vector Core (Xue et al., 2014). To express GtACR2, ReaChR, iC++, or iChloC in Pv neurons, 200–250 nl of the following recombinant AAV serotype 9 vectors at their respective titer were injected into the visual cortex of Pvalb (for GtACR2) or Pvalb (for ReaChR, iC++, or iChloC) mice at postnatal day 1 as previously described (Xue et al., 2014): AAV9-EF1α-FRT-FLEX-GtACR2-EYFP (3.8 × 1013 genome copies/ml), AAV9-EF1α-DIO-ReaChR-P2A-dTomato (7.0 × 1013 genome copies/ml), AAV9-EF1α-DIO-iC++-TS-EYFP (3.71 × 1013 genome copies/ml), and AAV9-EF1α-DIO-iChloC-2A-mCherry (3.7 × 1014 genome copies/ml). To conditionally express GtACR2 in juvenile and adult neurons, mice previously electroporated with plasmid pAAV-EF1α-FRT-FLEX-GtACR2-EYFP into layer 2/3 pyramidal neurons were injected with 200 nl of AAV9-hSyn-Flpo (1.2 × 1012 genome copies/ml) at postnatal day 23, 60, or 64. Injection was performed as previously described (Xue et al., 2014) with an UltraMicroPump III and a Micro4 controller (World Precision Instruments).

Brain slice electrophysiology

Mice were anesthetized by an intraperitoneal injection of a ketamine and xylazine mix (80 mg/kg and 16 mg/kg, respectively) and transcardially perfused with cold (0–4°C) slice cutting solution containing 80 mM NaCl, 2.5 mM KCl, 1.3 mM NaH2PO4, 26 mM NaHCO3, 4 mM MgCl2, 0.5 mM CaCl2, 20 mM D-glucose, 75 mM sucrose and 0.5 mM sodium ascorbate (315 mosmol, pH 7.4, saturated with 95% O2/5% CO2). Brains were removed and sectioned in the cutting solution with a VT1200S vibratome (Leica) to obtain 300 μm coronal slices. Slices were incubated in a custom-made interface holding chamber containing slice cutting solution saturated with 95% O2/5% CO2 at 34°C for 30 min and then at room temperature for 20 min to 10 hr until they were transferred to the recording chamber. Recordings were performed on submerged slices in artificial cerebrospinal fluid (ACSF) containing 119 mM NaCl, 2.5 mM KCl, 1.3 mM NaH2PO4, 26 mM NaHCO3, 1.3 mM MgCl2, 2.5 mM CaCl2, 20 mM D-glucose and 0.5 mM sodium ascorbate (305 mosmol, pH 7.4, saturated with 95% O2/5% CO2, perfused at 3 ml/min) at 30–32°C. For whole-cell recordings, a K+-based pipette solution containing 142 mM K+-gluconate, 10 mM HEPES, 1 mM EGTA, 2.5 mM MgCl2, 4 mM ATP-Mg, 0.3 mM GTP-Na, 10 mM Na2-phosphocreatine (295 mosmol, pH 7.35) or a Cs+-based pipette solution containing 121 mM Cs+-methanesulfonate, 1.5 mM MgCl2, 10 mM HEPES, 10 mM EGTA, 4 mM Mg-ATP, 0.3 mM Na-GTP, 10 mM Na2-Phosphocreatine, and 2 mM QX314-Cl (295 mosmol, pH 7.35) was used. Membrane potentials were not corrected for liquid junction potential (experimentally measured as 12.5 mV for the K+-based pipette solution and 9.5 mV for the Cs+-based pipette solution). Neurons were visualized with video-assisted infrared differential interference contrast imaging, and fluorescent neurons were identified by epifluorescence imaging under a water immersion objective (40×, 0.8 numerical aperture) on an upright SliceScope Pro 1000 microscope (Scientifica) with an infrared IR-1000 CCD camera (DAGE-MTI). Data were low-pass filtered at 4 kHz and acquired at 10 kHz with an Axon Multiclamp 700B amplifier and an Axon Digidata 1550 Data Acquisition System under the control of Clampex 10.7 (Molecular Devices). Data were analyzed offline using AxoGraph X (AxoGraph Scientific). For the photostimulation of GtACR2-, iC++-, iChloC-, or ChR2-expressing neurons, blue light was emitted from a collimated light-emitting diode (LED) of 455 nm, whereas for the photostimulation of GtACR1- or ReaChR-expressing neurons, red light was emitted from a LED of 617 nm. The LEDs were driven by a LED driver (Mightex) under the control of an Axon Digidata 1550 Data Acquisition System and Clampex 10.7. Light was delivered through the reflected light fluorescence illuminator port and the 40× objective. Synaptic currents and photocurrents were recorded in the whole-cell voltage clamp mode with the Cs+-based patch pipette solution. Only recordings with series resistance below 20 MΩ were included. EPSCs and IPSCs were recorded at the reversal potential for IPSCs (−60 mV) and EPSCs (+10 mV), respectively, unless stated otherwise. Photocurrents were recorded at +10 mV unless stated otherwise. For short light pulse stimulation, pulse duration (0.5–10 ms) and intensity (2.3–23.6 mW/mm2) were adjusted for each recording to evoke small (to minimize voltage-clamp errors) but reliable monosynaptic EPSCs or IPSCs. Disynaptic IPSCs were evoked using the same light pulses that were used for evoking the corresponding monosynaptic EPSCs. Light pulses were delivered at 30 s interstimulus intervals. For long light pulse stimulation, blue light was delivered for 2 s at 60 s interstimulus intervals. To obtain the cumulative charge transfer curves, the EPSC traces were high-pass filtered at 0.3 Hz to minimize the effect of slow changes in the baselines, except for two neurons that were filtered at 0.5 Hz or 1.3 Hz. It was not necessary to high-pass filter the IPSC traces. The traces were baselined before the light onset and then integrated to calculate the cumulative charge transfers. Antidromic spikes in GtACR2+ neurons were recorded with the K+-based patch pipette solution in whole-cell current clamp mode or with ACSF as the patch pipette solution in the loose-patch current clamp mode. For pharmacology experiments, the baseline synaptic currents were recorded for at least 3 min in the absence of any drug. The drugs were then added to the ACSF at the following concentrations: TTX (1 μM), NBQX (10 μM), (RS)-CPP (10 μM), SR95531 (Gabazine, 10 μM), ZD7288 (20 μM), bumetanide (50 or 100 μM), TEA (1.5 mM), and 4-AP (1.5 mM). The synaptic currents were recorded for at least 3 min in the presence of drugs. For ZD7288, which did not inhibit GtACR2-induced neurotransmitter release, the efficacy of the drug was monitored by examining the Ih current of cortical layer 5 pyramidal neurons.

Fluorescent microscopy

Fluorescent images were taken from live brain slices, except for the conditional expression of GtACR2 in adults, where images were taken from fixed brain slices. Live brain slices were prepared as described for slice electrophysiology. For the fixed brain slices, mice were anesthetized by an intraperitoneal injection of a ketamine and xylazine mix (80 mg/kg and 16 mg/kg, respectively) and transcardially perfused with phosphate buffered saline (PBS, pH 7.4) followed by 4% paraformaldehyde in PBS (pH 7.4). Brains were further fixed overnight in 4% paraformaldehyde, cryoprotected with 30% sucrose in PBS, and frozen in optimum cutting-temperature medium until sectioning. A HM 450 Sliding Microtome (Thermo Scientific) was used to section the brains to obtain 30–50 mm coronal slices. Images were acquired on an Axio Zoom.V16 Fluorescence Stereo Zoom Microscope (Zeiss) and processed using National Institutes of Health ImageJ. To determine the EYFP (or EGFP) fluorescence ratio between layer 5 and layer 2/3, one or two 350 µm-wide rectangular regions that were perpendicular to the pia and spanned all 6 cortical layers were selected in the most transfected regions of each slice. The mean EYFP (or EGFP) fluorescence was measured for layer 5 and layer 2/3 within the selected area. The mean tdTomato fluorescence was measured similarly for layer 5 and layer 2/3. The mean background fluorescence was measured from a nearby rectangular region (140.5 µm by 90.8 µm) where no cellular EYFP (or EGFP) and tdTomato fluorescence was present. The normalized EYFP (or EGFP) fluorescence ratio between layer 5 and layer 2/3 was calculated by . To determine the ratio of EYFP fluorescence to tdTomato fluorescence in the callosal projections, one or two rectangular regions that contained the tdTomato-labeled axons were selected in each slice to measure the mean EYFP and tdTomato fluorescence. The mean background fluorescence was measured in a nearby cortical area spanning the same layers. The ratio of EYFP fluorescence to tdTomato fluorescence was calculated by .

Statistics

All reported sample numbers (n) represent biological replicates that are the numbers of recorded neurons for electrophysiology or the numbers of analyzed regions of interest (ROI) for fluorescent images. Statistical analyses were performed with Prism 7 (GraphPad Software). We first determined whether the data were normally distributed by performing the D’Agostino and Pearson test, Shapiro-Wilk test, and KS test. If all data within one experiment passed all three normality tests, we then performed the statistical test that assumes a Gaussian distribution. Otherwise, we performed the statistical test that assumes a non-Gaussian distribution. All statistical tests were two-tailed with an alpha of 0.05. Wilcoxan matched-pairs signed rank test was used for Figure 1F,K; Figure 2B,D,F,J; Figure 2—figure supplement 2B,E; Figure 2—figure supplement 3B (EPSCs); Figure 3B; and Figure 3—figure supplement 1C. Paired t test was used for Figure 1G,J; Figure 2H; Figure 2—figure supplement 1D; and Figure 2—figure supplement 3B (photocurrents); Figure 2—figure supplement 3D. t test with Welch’s correction was used for Figure 5C (WT vs. Kv2.1C). Mann-Whitney test was used for Figure 5C (WT vs. Kv2.1C-linker-TlcnC); Figure 5F,G,I; Figure 5—figure supplement 1C,D. Repeated measures one-way ANOVA with Greenhouse-Geisser correction and Tukey multiple comparisons with multiplicity adjusted P values was used for Figure 3D,F. Kruskal-Wallis test with Dunn’s multiple comparisons with multiplicity adjusted P values was used for Figure 4D. Ordinary one-way ANOVA with Dunnet’s multiple comparison test with multiplicity adjusted P values was used for Figure 4E. The details of all statistical tests, numbers of replicates and mice, and P values were reported in Supplementary file 1. In the interests of transparency, eLife includes the editorial decision letter and accompanying author responses. A lightly edited version of the letter sent to the authors after peer review is shown, indicating the most substantive concerns; minor comments are not usually included. Thank you for submitting your article "Targeting light-gated chloride channels to neuronal somatodendritic domain reduces their excitatory effect in the axon" for consideration by eLife. Your article has been reviewed by two peer reviewers, and the evaluation has been overseen by a Reviewing Editor and Gary Westbrook as the Senior Editor. The reviewers have opted to remain anonymous. The reviewers have discussed the reviews with one another and the Reviewing Editor has drafted this decision to help you prepare a revised submission. We hope you will be able to submit the revised version within two months. Summary: This study explores the effects of the optogenetic tool GtACR2, an optically activated Cl channel, on cortical neurons. The results demonstrate that, owing to differences in the chloride gradient in different cellular compartments, activation of GtACR2 suppresses electrical activity in somatodendritic compartments but leads to depolarization and transmitter release from synaptic terminals. Modifying GtACR2 to target it preferentially to the somatodendritic membrane, substantially reduces light-induced neurotransmitter release. The data therefore show that Cl currents are depolarizing in cortical synaptic terminals and also provide a technical caution for experiments that seek to manipulate Cl currents for specific outcomes. Essential revisions: Both reviewers were highly enthusiastic about the study, including the caliber of the work, the scientific result, and the technical pointers provided. As you will see in the reviews, which are included in full below, it was noted that the somatodendritic targeting was only partially successful, and reviewer 2 therefore raised questions about the efficacy of the modified GtACR2. However, in the consultation period, it was acknowledged by both reviewers and editor that the work is of importance even without a perfect alternative. Reviewer 1's primary comment was that the study is cast primarily as an exploration of tools, while perhaps selling the work short on the actual discovery/demonstration of the depolarizing chloride gradient in a variety of cortical neurons. Given these two responses to the study, we suggest moderate revisions (1) to emphasize the scientific discovery (in the Discussion) and (2) to acknowledge the limitation of the modified GtACR2 and/or define conditions or protocols that maximize its efficacy. We realize that this parameter space may already have been maximally explored; if so, this can be indicated in the text without further experimentation. The reviews are included in full below. Reviewer #1: This interesting work reports on the actions of Cl channel opsin, GtACR2, on somatodendritic vs axon/terminal domains in cortex. The essential result is that, although inhibitory to somatodendritic membrane, activation of the opsin triggers neurotransmitter release from terminals due to the depolarizing effect of Cl currents in axons and terminals. There are several strong points to this study. First, it is very well done. The sequence of logical and very clever molecular and physiological strategies revealed that a lot of thought as well as a lot of work went into the planning and execution of this study. As an aside, studies like this are often from large well-funded labs. It is impressive to see such a complete study performed in a small lab without federal funds. Second, it obviously serves as an important cautionary tale for the field regarding the use of this flavor of opsin for any study in neuroscience. Third, it points to the potency of presynaptic Cl gradients in not just depolarizing axons and terminals but actually exciting them. In this regard, I feel the authors missed an opportunity in their Discussion, which at present focuses on the work as a characterization of a tool. As the authors note, depolarizing Cl gradients have been described brainstem and cerebellum slices and in dissociated hippocampal neurons that retain little torn off terminals (the Jang study). The latter are a bit suspect as far as their physiological state. In this study we have a demonstration that not only are Cl channels depolarizing in a wide variety of cortical neurons, but that they can induce short latency, triggered action potentials. This ability to directly excite a terminal was not observed or tested explicitly for the brainstem and cerebellum, in part because authors were limited by the efficacy of agonists and how they were applied; at best, the previous work indicated that Cl channels enhance excitability in response to other stimuli. So we have here a demonstration of an important physiological principle, as well as a method for exploring it in many different brain regions. I felt the authors could have highlighted this as well in their Discussion. Overall, I am impressed, enjoyed the read, and have no technical concerns with the work. Reviewer #2: Neuroscientists hope to use light-gated chloride channels, such as GtACR2, to suppress the activity of neurons. Messier and colleagues describe a major limitation with GtACR2, namely that it is depolarizes boutons resulting in the release of neurotransmitter rather than the suppression of neuronal activity/transmission as intended. They show this happens in both excitatory and inhibitory neurons and is because the chloride reversal potential is relatively depolarizing in boutons as compared to the somatodendritic compartment of the cell. Finally, they fuse several different targeting sequences to the channel with the goal of localizing GtACR2 to the somatodendritic compartment of the neuron. The intention of this manipulation is to bias the effects of the channel to hyperpolarizing neurons, rather than depolarizing boutons and triggering release. They are moderately successful in achieving this goal. This study is carefully executed and the experiments/interpretation are unambiguous. I am fully convinced of the limitations of GtACR2 and the underlying mechanism the authors propose. This information is useful to the community and should be published. I am less convinced, however, that they have solved the problem. Fusing Kv2.1C-linker-TlcnC targeting motifs to the channel reduces neurotransmission associated with light activation of the channel by ~3-5 fold, but does not eliminate it. In light of this, I'm not sure that this tool is ultimately any more useful than the wild type channel. The authors suggest reducing channel expression levels or 2-photon activation of the channel may further reduce excitation associated with channel gating (or more precisely bias the cell to hyperpolarization of the somatodendritic compartment rather than depolarization of the axon). This should be tested. Additionally, maybe there is a light intensity that could achieve this same goal? (Editor's comment: This is the point that reviewers/editor agreed was optional, since it seems likely that the result has already been optimized. However, if experimentation to address this point is feasible, please do so. If not, please discuss.) Reviewer #1: […] Third, it points to the potency of presynaptic Cl gradients in not just depolarizing axons and terminals but actually exciting them. In this regard, I feel the authors missed an opportunity in their Discussion, which at present focuses on the work as a characterization of a tool. As the authors note, depolarizing Cl gradients have been described brainstem and cerebellum slices and in dissociated hippocampal neurons that retain little torn off terminals (the Jang study). The latter are a bit suspect as far as their physiological state. In this study we have a demonstration that not only are Cl channels depolarizing in a wide variety of cortical neurons, but that they can induce short latency, triggered action potentials. This ability to directly excite a terminal was not observed or tested explicitly for the brainstem and cerebellum, in part because authors were limited by the efficacy of agonists and how they were applied; at best, the previous work indicated that Cl channels enhance excitability in response to other stimuli. So we have here a demonstration of an important physiological principle, as well as a method for exploring it in many different brain regions. I felt the authors could have highlighted this as well in their Discussion. Overall, I am impressed, enjoyed the read, and have no technical concerns with the work. Reviewer #1 is correct that most of the previous studies on the presynaptic GABAA or glycine receptors in the brainstem and cerebellum did not directly demonstrated that activation of these chloride channels can trigger action potentials, except that Pugh et al. (2011) observed antidromic spikes when GABA was applied to the axons of some cerebellar granule cells. Nevertheless, the powerful excitatory effect of presynaptic chloride channels in cortical excitatory and inhibitory neurons was not demonstrated in previous studies. Our study also indicates that the light-gated chloride channels are excellent tools for investigating the chloride gradients in different brain regions, cell types, and subcellular compartments due to its fast kinetics and large channel conductance. We revised the text to highlight these Discussion points. Reviewer #2: […] I am less convinced, however, that they have solved the problem. Fusing Kv2.1C-linker-TlcnC targeting motifs to the channel reduces neurotransmission associated with light activation of the channel by ~3-5 fold, but does not eliminate it. In light of this, I'm not sure that this tool is ultimately any more useful than the wild type channel. The authors suggest reducing channel expression levels or 2-photon activation of the channel may further reduce excitation associated with channel gating (or more precisely bias the cell to hyperpolarization of the somatodendritic compartment rather than depolarization of the axon). This should be tested. Additionally, maybe there is a light intensity that could achieve this same goal? (Reviewing Editor's comment: This is the point that reviewers/editor agreed was optional, since it seems likely that the result has already been optimized. However, if experimentation to address this point is feasible, please do so. If not, please discuss.) Reviewer #2 is correct that the somatodendritically targeted GtACR2 reduces, but does not eliminate, the excitatory effect in the axons, as we stated in the manuscript that “GtACR2-EYFP-Kv2.1C-linker-TlcnC can still traffic to the axon to cause neurotransmitter release”. After we discovered the excitatory effect of GtACR2 in the axon and presynaptic terminals in 2015, we have explored many different ways to minimize this undesired effect including various light stimulation protocols. In the revised manuscript, we added a new figure (Figure 5—figure supplement 1) to show the GtACR2-mediated photocurrents and EPSCs at different light stimulation strengths. Our results indicate that it is possible to identify a light stimulation strength that is low enough not to cause neurotransmitter release but still produce large inhibitory photocurrents in GtACR2+ neurons. However, this stimulation strength must be empirically determined for every experiment. Furthermore, we added another new figure (Figure 1—figure supplement 3) to show the time course of neurotransmitter release during a long pulse of light. Since large and synchronous neurotransmitter release occurs at the early phase of the light stimulation, one may take advantage of the late phase when neurotransmitter release is reduced but photocurrent is still robust for optogenetic inhibition experiments. These additional results were also discussed.
Key resources table
Reagent type (species) or resourceDesignationSource or referenceIdentifiersAdditional information
Strain, strain background (M. musculus)Pvalb-2A-FlpoJackson LaboratoryRRID:IMSR_JAX:022730
Strain, strain background (M. musculus)Pvalb-2A-CreJackson LaboratoryRRID:IMSR_JAX:012358
Recombinant DNA reagent (plasmid)GtACR2Govorunova et al., 2015Addgene:67877pLenti-UbiC- GtACR2-EYFP; obtained from Dr. John Spudich
Recombinant DNA reagent (plasmid)GtACR1Govorunova et al., 2015Addgene:67795pLenti-UbiC- GtACR1-EYFP; obtained from Dr. John Spudich
Recombinant DNA reagent (plasmid)iC++Berndt et al., 2016pAAV-CaMKIIα-i C++-TS-EYFP or pAAV-EF1α-DIO-iC++ -TS-EYFP; obtained from Dr. Karl Deisseroth
Recombinant DNA reagent (plasmid)FlpoXue et al. (2014)Addgene:60662pCAG-Flpo
Recombinant DNA reagent (plasmid)ChR2this paperAddgene:114367pCAG-hChR2(H134R) -EYFP
Recombinant DNA reagent (plasmid)Flpo-dependent GtACR2this paperAddgene:114369pAAV-EF1α-FRT-FLEX -GtACR2-EYFP
Recombinant DNA reagent (plasmid)Flpo-dependent GtACR1this paperAddgene:114370pAAV-EF1α-FRT-FLEX -GtACR1-EYFP
Recombinant DNA reagent (plasmid)GtACR2-EYFP-Kv2.1Cthis paperAddgene:114375pAAV-EF1α-FRT- FLEX-GtACR2- EYFP-Kv2.1C
Recombinant DNA reagent (plasmid)GtACR2-EYFP- Kv2.1C-linker-TlcnCthis paperAddgene:114377pAAV-EF1α-FRT- FLEX-GtACR2-EYFP- Kv2.1C-linker-TlcnC
Transfected construct (adeno- associated virus)FlpoXue et al. (2014); Penn Vector CoreAddgene:60663AAV9-hSyn-Flpo
Transfected construct (adeno -associated virus)Flpo-dependent GtACR2; GtACR2This paper; Baylor College of Medicine Gene Vector CoreAddgene:114369AAV9-EF1α- FRT-FLEX -GtACR2-EYFP
Transfected construct (adeno- associated virus)ReaChRThis paper; Baylor College of Medicine Gene Vector CoreAddgene:114368AAV9-EF1α- DIO-ReaChR-P2A-dTomato
Transfected construct (adeno- associated virus)iC++This paper; Baylor College of Medicine Gene Vector CoreAAV9-EF1α-DIO- iC++-TS-EYFP; plasmid obtained from Dr. Karl Deisseroth
Transfected construct (adeno-associated virus)iChloCThis paper; Baylor College of Medicine Gene Vector CoreAAV9-EF1α-DIO- iChloC-T2A-mCherry; plasmid obtained from Drs. Matthew Caudill and Massimo Scanziani
Chemical compound, drugBumetanide (Ro 10–6338)Santa Cruz BiotechnologySanta Cruz:sc-20072750 or 100 µM
  51 in total

1.  Fast noninvasive activation and inhibition of neural and network activity by vertebrate rhodopsin and green algae channelrhodopsin.

Authors:  Xiang Li; Davina V Gutierrez; M Gartz Hanson; Jing Han; Melanie D Mark; Hillel Chiel; Peter Hegemann; Lynn T Landmesser; Stefan Herlitze
Journal:  Proc Natl Acad Sci U S A       Date:  2005-11-23       Impact factor: 11.205

2.  Multimodal fast optical interrogation of neural circuitry.

Authors:  Feng Zhang; Li-Ping Wang; Martin Brauner; Jana F Liewald; Kenneth Kay; Natalie Watzke; Phillip G Wood; Ernst Bamberg; Georg Nagel; Alexander Gottschalk; Karl Deisseroth
Journal:  Nature       Date:  2007-04-05       Impact factor: 49.962

3.  Axonal GABAA receptors increase cerebellar granule cell excitability and synaptic activity.

Authors:  Jason R Pugh; Craig E Jahr
Journal:  J Neurosci       Date:  2011-01-12       Impact factor: 6.167

4.  Excitatory GABA responses in embryonic and neonatal cortical slices demonstrated by gramicidin perforated-patch recordings and calcium imaging.

Authors:  D F Owens; L H Boyce; M B Davis; A R Kriegstein
Journal:  J Neurosci       Date:  1996-10-15       Impact factor: 6.167

5.  Myosin-dependent targeting of transmembrane proteins to neuronal dendrites.

Authors:  Tommy L Lewis; Tianyi Mao; Karel Svoboda; Don B Arnold
Journal:  Nat Neurosci       Date:  2009-04-19       Impact factor: 24.884

6.  Channelrhodopsin-2, a directly light-gated cation-selective membrane channel.

Authors:  Georg Nagel; Tanjef Szellas; Wolfram Huhn; Suneel Kateriya; Nona Adeishvili; Peter Berthold; Doris Ollig; Peter Hegemann; Ernst Bamberg
Journal:  Proc Natl Acad Sci U S A       Date:  2003-11-13       Impact factor: 11.205

7.  rAAV-mediated subcellular targeting of optogenetic tools in retinal ganglion cells in vivo.

Authors:  Chaowen Wu; Elena Ivanova; Yi Zhang; Zhuo-Hua Pan
Journal:  PLoS One       Date:  2013-06-14       Impact factor: 3.240

8.  A high-light sensitivity optical neural silencer: development and application to optogenetic control of non-human primate cortex.

Authors:  Xue Han; Brian Y Chow; Huihui Zhou; Nathan C Klapoetke; Amy Chuong; Reza Rajimehr; Aimei Yang; Michael V Baratta; Jonathan Winkle; Robert Desimone; Edward S Boyden
Journal:  Front Syst Neurosci       Date:  2011-04-13

9.  ReaChR: a red-shifted variant of channelrhodopsin enables deep transcranial optogenetic excitation.

Authors:  John Y Lin; Per Magne Knutsen; Arnaud Muller; David Kleinfeld; Roger Y Tsien
Journal:  Nat Neurosci       Date:  2013-09-01       Impact factor: 24.884

10.  Two-Photon Bidirectional Control and Imaging of Neuronal Excitability with High Spatial Resolution In Vivo.

Authors:  Angelo Forli; Dania Vecchia; Noemi Binini; Francesca Succol; Serena Bovetti; Claudio Moretti; Francesco Nespoli; Mathias Mahn; Christopher A Baker; McLean M Bolton; Ofer Yizhar; Tommaso Fellin
Journal:  Cell Rep       Date:  2018-03-13       Impact factor: 9.423

View more
  16 in total

1.  Corticostriatal Flow of Action Selection Bias.

Authors:  Eun Jung Hwang; Trevor D Link; Yvonne Yuling Hu; Shan Lu; Eric Hou-Jen Wang; Varoth Lilascharoen; Sage Aronson; Keelin O'Neil; Byung Kook Lim; Takaki Komiyama
Journal:  Neuron       Date:  2019-11-06       Impact factor: 17.173

2.  Opposite Charge Movements Within the Photoactive Site Modulate Two-Step Channel Closing in GtACR1.

Authors:  Oleg A Sineshchekov; Elena G Govorunova; Hai Li; Xin Wang; John L Spudich
Journal:  Biophys J       Date:  2019-10-14       Impact factor: 4.033

3.  Kalium channelrhodopsins are natural light-gated potassium channels that mediate optogenetic inhibition.

Authors:  Elena G Govorunova; Yueyang Gou; Oleg A Sineshchekov; Hai Li; Xiaoyu Lu; Yumei Wang; Leonid S Brown; François St-Pierre; Mingshan Xue; John L Spudich
Journal:  Nat Neurosci       Date:  2022-06-20       Impact factor: 28.771

4.  Aion is a bistable anion-conducting channelrhodopsin that provides temporally extended and reversible neuronal silencing.

Authors:  Silvia Rodriguez-Rozada; Jonas Wietek; Federico Tenedini; Kathrin Sauter; Neena Dhiman; Peter Hegemann; Peter Soba; J Simon Wiegert
Journal:  Commun Biol       Date:  2022-07-09

5.  A midbrain-thalamus-cortex circuit reorganizes cortical dynamics to initiate movement.

Authors:  Hidehiko K Inagaki; Susu Chen; Margreet C Ridder; Pankaj Sah; Nuo Li; Zidan Yang; Hana Hasanbegovic; Zhenyu Gao; Charles R Gerfen; Karel Svoboda
Journal:  Cell       Date:  2022-03-03       Impact factor: 66.850

6.  Neurophotonic tools for microscopic measurements and manipulation: status report.

Authors:  Ahmed S Abdelfattah; Sapna Ahuja; Taner Akkin; Srinivasa Rao Allu; Joshua Brake; David A Boas; Erin M Buckley; Robert E Campbell; Anderson I Chen; Xiaojun Cheng; Tomáš Čižmár; Irene Costantini; Massimo De Vittorio; Anna Devor; Patrick R Doran; Mirna El Khatib; Valentina Emiliani; Natalie Fomin-Thunemann; Yeshaiahu Fainman; Tomas Fernandez-Alfonso; Christopher G L Ferri; Ariel Gilad; Xue Han; Andrew Harris; Elizabeth M C Hillman; Ute Hochgeschwender; Matthew G Holt; Na Ji; Kıvılcım Kılıç; Evelyn M R Lake; Lei Li; Tianqi Li; Philipp Mächler; Evan W Miller; Rickson C Mesquita; K M Naga Srinivas Nadella; U Valentin Nägerl; Yusuke Nasu; Axel Nimmerjahn; Petra Ondráčková; Francesco S Pavone; Citlali Perez Campos; Darcy S Peterka; Filippo Pisano; Ferruccio Pisanello; Francesca Puppo; Bernardo L Sabatini; Sanaz Sadegh; Sava Sakadzic; Shy Shoham; Sanaya N Shroff; R Angus Silver; Ruth R Sims; Spencer L Smith; Vivek J Srinivasan; Martin Thunemann; Lei Tian; Lin Tian; Thomas Troxler; Antoine Valera; Alipasha Vaziri; Sergei A Vinogradov; Flavia Vitale; Lihong V Wang; Hana Uhlířová; Chris Xu; Changhuei Yang; Mu-Han Yang; Gary Yellen; Ofer Yizhar; Yongxin Zhao
Journal:  Neurophotonics       Date:  2022-04-27       Impact factor: 4.212

7.  Soma-Targeted Imaging of Neural Circuits by Ribosome Tethering.

Authors:  Yiming Chen; Heeun Jang; Perry W E Spratt; Seher Kosar; David E Taylor; Rachel A Essner; Ling Bai; David E Leib; Tzu-Wei Kuo; Yen-Chu Lin; Mili Patel; Aygul Subkhangulova; Saul Kato; Evan H Feinberg; Kevin J Bender; Zachary A Knight; Jennifer L Garrison
Journal:  Neuron       Date:  2020-06-22       Impact factor: 18.688

8.  The Effects of Chloride Flux on Drosophila Heart Rate.

Authors:  Catherine E Stanley; Alex S Mauss; Alexander Borst; Robin L Cooper
Journal:  Methods Protoc       Date:  2019-08-22

9.  Crystal structure of a natural light-gated anion channelrhodopsin.

Authors:  Hai Li; Chia-Ying Huang; Elena G Govorunova; Christopher T Schafer; Oleg A Sineshchekov; Meitian Wang; Lei Zheng; John L Spudich
Journal:  Elife       Date:  2019-01-07       Impact factor: 8.140

10.  PreBötzinger complex neurons drive respiratory modulation of blood pressure and heart rate.

Authors:  Clément Menuet; Angela A Connelly; Jaspreet K Bassi; Mariana R Melo; Sheng Le; Jessica Kamar; Natasha N Kumar; Stuart J McDougall; Simon McMullan; Andrew M Allen
Journal:  Elife       Date:  2020-06-15       Impact factor: 8.140

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.