Literature DB >> 30087831

Bordetella pertussis and Bordetella bronchiseptica filamentous hemagglutinins are processed at different sites.

David Jurnecka1,2, Petr Man2,3, Peter Sebo1, Ladislav Bumba1.   

Abstract

Filamentous hemagglutinin (FHA) mediates adherence and plays an important role in lower respiratory tract infections by pathogenic Bordetellae. The mature FHA proteins of B. pertussis (Bp-FHA) and the B. bronchiseptica (Bb-FHA) are generated by processing of the respective FhaB precursors by the autotransporter subtilisin-type protease SphB1. We have used bottom-up proteomics with differential 16O/18O labeling and show that despite high-sequence conservation of the corresponding FhaB segments, the mature Bp-FHA (~ 230 kDa) and Bb-FHA (~ 243 kDa) proteins are processed at different sites of FhaB, after the Ala-2348 and Lys-2479 residues, respectively. Moreover, protease surface accessibility probing by on-column (on-line) digestion of the Bp-FHA and Bb-FHA proteins yielded different peptide patterns, revealing structural differences in the N-terminal and C-terminal domains of the Bp-FHA and Bb-FHA proteins. These data indicate specific structural variations between the highly homologous FHA proteins.

Entities:  

Keywords:  Bordetella bronchiseptica; Bordetella pertussis; bacterial pathogenesis; mass spectrometry (MS); protein processing; serine protease

Year:  2018        PMID: 30087831      PMCID: PMC6070651          DOI: 10.1002/2211-5463.12474

Source DB:  PubMed          Journal:  FEBS Open Bio        ISSN: 2211-5463            Impact factor:   2.693


B. bronchiseptica filamentous hemagglutinin B. pertussis filamentous hemagglutinin electrospray ionization Fourier transform ion cyclotron resonance mass spectrometry filamentous hemagglutinin hydrogendeuterium exchange liquid chromatography–tandem mass spectrometry The three classical species of Gram‐negative Bordetellae cause respiratory infections in mammals. While B. bronchiseptica colonizes the nasopharynx and trachea of a broad range of mammalian hosts, such as rodents or dogs, B. pertussis is a strictly human pathogen that causes the highly contagious respiratory disease called whooping cough or pertussis. B. parapertussis typically infects ovines but human‐adapted strains of B. parapertussis account for up to 20% of human whooping cough cases 1. Introduction in the 1950s of whole‐cell pertussis (wP) vaccines, composed of killed B. pertussis cells, led to a dramatic decrease in pertussis‐related mortality and incidence of the disease 2. Safety concerns, however, led later to the replacement of the wP vaccine with the less reactogenic acellular pertussis component vaccines (aP). The latter are composed of one to five purified pertussis proteins, including chemically inactivated pertussis toxin (PT), filamentous hemagglutinin (FHA), pertactin (PRN), and/or fimbriae of serotype 2 or 3 (FIM2, FIM3). Recent epidemiologic data show a steep increase in pertussis incidence in adolescents and adults, which is linked to the switch from the use of wP to aP vaccines in developed countries in the late 1990s 3. While being effective in preventing clinical pertussis disease in infants, the aP vaccines appear to confer a rapidly waning protection and do not prevent bacterial colonization and transmission of the pathogen in aP‐vaccinated populations 4, 5, 6. The mature B. pertussis FHA is included in all but one of the used aP vaccines, as FHA was proposed to play an important role in bacterial adhesion and invasion of host epithelial and phagocytic cells 7. It is a hairpin‐shaped molecule (50 nm in length and approximately 4 nm in width) consisting predominantly of tandem repetitive β‐strands arranged into a right‐handed parallel β‐helix 8. Mature FHA or its FhaB precursor was found to mediate bacterial adherence to a wide range of cell lines in vitro and FhaB appears to play a role in colonization of the lower respiratory tract in rodents, such as rats and mice 9, 10, 11. Four different functional domains (heparin‐binding, carbohydrate recognition, ArgGlyAsp motif, and mature C‐terminal domain) of FHA were identified and implicated in interaction of mature FHA with eukaryotic cells in vitro. However, the roles played by these domains in Bordetella infections in vivo are poorly defined and remain controversial 12. In addition to a role in bacterial adherence, the FHA protein was proposed to exert immunomodulatory signaling, inducing secretion of tolerogenic IL‐10 by dendritic cells 13, 14. However, this was recently shown to be due contamination of FHA preparations by endotoxin‐associated TLR2 ligands 15. Moreover, FHA was also reported to interact with the adenylate cyclase toxin, an important Bordetella virulence factor 16, 17. Filamentous hemagglutinin of B. pertussis is synthesized as a 367‐kDa precursor (FhaB) that is exported across the cytoplasmic membrane by the general Sec system, using an unusually long N‐terminal signal peptide comprising 71 amino acid residues. The signal peptide of FhaB contains two cysteines (Cys24 and Cys31) that are necessary for post‐translational cyclization of the N‐terminal glutamine residue (Gln‐72) of processed FhaB to a cyclic pyroglutamyl residue 18. After removal of the signal sequence, the FhaB protein is secreted across the outer bacterial membrane by a two‐partner secretion (TPS) pathway 19. The N‐terminal ‘TPS domain’ of FhaB, comprising 245 residues, initiates export across the outer membrane by interacting with the periplasmic polypeptide transport associated (POTRA) domain of FhaC, the outer membrane component of the TPS secretion pathway 20. Translocation of FhaB proceeds in an N‐ to C‐terminal direction, where the N terminus forms an extended hairpin through the FhaC channel and the C terminus gradually folds into a β‐helix, as it emerges on the cell surface 21. The translocated portion of FhaB is then eventually processed by the outer membrane‐associated protease SphB1 to a 230‐kDa mature FHA protein. The ~ 1300 residue‐long C‐terminal fragment of FhaB, called the prodomain, was recently proposed to serve as an intramolecular chaperone and appears to be rapidly degraded in bacterial periplasm 22, 23, 24. SphB1 is a surface‐exposed autotransporter protein that harbors a subtilisin‐type serine protease domain. It was proposed to cleave FhaB of B. pertussis within the PLFETRIKFID sequence (residues 2362–2372), but the cleavage site was not identified 25. Moreover, in SphB1‐deficient (ΔsphB1) strains, the FhaB precursor can still be processed to a larger FHA* protein by another, as yet unknown, protease 21, 23, 24. Therefore, we used differential 16O/18O labeling and proteomics to identify the C‐terminal residues of FHA proteins purified from culture supernatants of wild‐type B. pertussis and B. bronchiseptica strains. The results show that despite high‐sequence conservation of the processed segments, the FhaB proteins from the two species are processed at different sites. Furthermore, the N‐ and C‐terminal domains of the two resulting FHA proteins exhibit a different surface accessibility to proteolytic cleavage.

Material and methods

Bacterial strains and growth conditions

Bordetella pertussis Tohama I and Bordetella bronchiseptica RB50 cells were grown at 37 °C on Bordet–Gengou agar (BG) supplemented with 15% defibrinated sheep blood. For liquid cultures, the bacteria were grown in Stainer–Scholte (SS) medium supplemented with 1 mg·mL−1 (2,6‐O‐dimethyl)‐β‐cyclodextrin at 37 °C.

Purification of FHA

Bordetella cells were grown in 50 mL of SS medium for 8 h at 37 °C, diluted in fresh SS medium (200 mL and 1 l for B. pertussis and B. bronchiseptica, respectively) to OD600=0.2 and cultivated for 36 or 14 h for B. pertussis or B. bronchiseptica, respectively, using a rotary shaker (160 r.p.m.) at 37 °C. The cells were spun down at 14 000 for 25 min at 4 °C, and the supernatants were filtered through a 0.2‐μm TPP Rapid Filtermax Vacuum Filtration system. The filtrates were loaded onto 5 mL bed volume of Cellufine sulfate (JNC Corporation, Japan) equilibrated with 10 mm phosphate buffer, pH 7.6 (PB), extensively washed with PB, and purified FHA proteins were eluted with PB supplemented with 700 mm NaCl. The purification procedure was performed at 4 °C. The purity of proteins was determined by sodium dodecyl sulfatepolyacrylamide gel electrophoresis (SDS/PAGE), and the protein concentrations were determined by Bradford assay using bovine serum albumin as standard. Due to low yields, B. bronchiseptica FHA was concentrated by precipitation with acetone (4 : 1, v/v) at −20 °C for 12 h and collected by centrifugation at 16 000 for 10 min at 4 °C. Protein pellets were reconstituted in phosphate‐buffered saline (PBS) or PBS supplemented with 4 m urea (for on‐line digestion).

Protein digest and 18O stable isotope labeling

Purified FHA proteins were separated on 5% SDS/PAGE gel and stained with Coomassie brilliant blue R‐250. Protein bands were excised from the gel, cut into small pieces and destained by sonication in 200 μL of Tris/HCl (pH 8.2) and 200 μL of acetonitrile (ACN). After complete destaining, the gel pieces were rinsed with 200 μL of ACN for 5 min, the liquid was discarded, and gel pieces were washed with 200 μL of H2O. Finally, the gel was washed by 200 μL of H2O/ACN (1 : 1) and dried under vacuum. Next, the gel was rehydrated in 50 μL of 10% ACN in 25 mm N‐ethyl morpholine acetate buffer (pH 8.2) containing the protease. The buffer was prepared either with normal water, or doubly concentrated buffer was diluted 1 : 1 with H2 18O. Proteins were digested at 37 °C overnight, and the proteases used were as follows: trypsin gold (enzyme‐to‐substrate ratio [w/w] of 1 : 75), LysC, and AspN (enzyme‐to‐substrate ratio [w/w] of 1 : 50 for both). After digestion, the peptides were extracted with 100 μL of 80% ACN, 0.1% trifluoroacetic acid (TFA), dried via vacuum centrifugation, and solubilized in 100 μL of 10% ACN and 0.1% TFA. Alternatively, 50 μg samples of purified FHA was dried, solubilized in 50 mm ammonium bicarbonate buffer (pH 8.2), and digested using the same proteases as described above. In‐solution digestion was carried out for 6 h. Following digestion, samples were dried and reconstituted as above. Samples from in‐gel and in‐solution digestion were next desalted by peptide MacroTrap (Optimize Technologies) and eluted with 150 μL of 80% ACN, 0.1% TFA. Desalted peptides were dried via vacuum centrifugation and dissolved in 30 μL of 5% ACN, 0.1% TFA (v/v) prior the LC‐MS/MS analysis.

Mass spectrometry

For LC‐MS/MS analyses, a capillary HPLC system (1200, Agilent Technologies, Germany) connected to an ESI source of the FT‐ICR mass spectrometer (15T, SolariX XR, Bruker) was used. Peptides were separated on analytical reverse phase column (MAGIC C18 AQ, 0.2 × 150 mm, Michrom Bioresources) and separated by following gradient: 1–10% B in 1 min, 10–40% B in 50 min, where solvent A was 0.2% formic acid, 2.5% ACN, and 2.5% isopropanol, and solvent B was 0.16% formic acid in 90% ACN and 5% isopropanol. The flow rate was 4 μL·min−1. ESI‐FT‐ICR MS was calibrated externally using arginine clusters resulting in a mass accuracy below 2 p.p.m. For peptide, mapping instrument was operated in data‐dependent mode, where each MS scan was followed by up to five MS/MS collision‐induced fragmentations of the most intense ions.

H/D‐like mapping of FHA using immobilized endopeptidase under denaturing conditions

Digestion of FHA, with immobilized porcine pepsin A, aspergillopepsin, or rhizopuspepsin under HDX compatible conditions, was performed as described previously 26. Briefly, the system consisted of injection and switching valves mounted with immobilized protease column, trap column (peptide MicroTrap, Optimized Technologies), and analytical column (Jupiter C18, 0.5 × 50 mm, 5 μm, 300 Å, Phenomenex), with all components immersed in an ice‐water bath. Digestion and desalting (4 min) were driven by a Shimadzu LC20‐AD pump isocratically delivering 0.4% formic acid at a flow rate of 100–200 μL·min−1 depending on the protease column used. Gradient separation on the analytical column was carried out by an HPLC system (Agilent Technologies 1200) running at a flow rate of 15 μL·min−1 Gradient elution from 5% B to 35% B in 40 min, followed by elution with 95% B, was used for separation. Solvents used were A: 0.4% formic acid and 2% ACN; and solvent B: 0.4% formic acid in 95% ACN. The outlet of the analytical column was directly connected to an electrospray ionization (ESI) source of 15T FT‐ICR mass spectrometer (Bruker Daltonics). The purified Bp‐FHA or Bb‐FHA (300 pmol) was diluted in 0.5 m glycine/HCl buffer (pH 2.3) and injected into the column system. Alternatively, Bp‐FHA, diluted 1 : 1 with 8 m urea (to give a final urea concentration of 4 m), or Bb‐FHA, resuspended in PBS containing 4 m urea, was incubated for 30 min at 50 °C before the mixture was diluted 1 : 1 with 0.5 m glycine/HCl buffer (pH 2.3) and immediately injected into the chromatography system.

Data processing

Data processing was performed using Data Analysis 4.1 (Bruker Daltonics). Peak picking was carried out by FTMS and SNAP algorithms, and two mascot generic files were created for each analysis. Data from the unlabeled samples (specific protease digestion) and from on‐line aspartic protease digestion were searched using local MASCOT server (MatrixScience) against a single protein database containing the sequence of FHA from B. pertussis or B. bronchiseptica with no‐enzyme specificity. Peptide tolerance was set to 10 p.p.m. and fragment ion tolerance to 0.05 Da. Identified C‐terminal peptides of FHA proteins were manually searched in the 18O labeled samples. The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE 27 partner repository with the dataset identifier PXD008664 and 10.6019/PXD008664.

Results

Purification of FHA proteins

Despite use of Bp‐FHA in aP vaccines for two decades, the exact C‐terminal sequence of FHA remained unknown. To identify the C‐terminal residues of FHA of B. pertussis and of B. bronchiseptica, we have purified the mature forms of the two proteins from culture supernatants using a single‐step affinity chromatography on Cellufine sulfate. SDS/PAGE analysis revealed that both B. pertussis (Bp‐FHA) and B. bronchiseptica (Bb‐FHA) FHA preparations contained the mature and the truncated forms of FHA 25, which migrated as double bands of >250 kDa (Fig. 1). Unlike the Bp‐FHA preparation, which was almost homogenous, the Bb‐FHA preparation contained proteolytic fragments (~ 130, 100 and 75 kDa) that were recognized by a polyclonal anti‐FHA antibody (data not shown). This likely reflected the difficulty to purify Bb‐FHA, which was obtained in about 20 times lower yields despite the use of five times larger volumes of culture supernatants. Indeed, B. bronchiseptica was reported to release much less FHA than B. pertussis 28. The lower yield of Bb‐FHA might further reflect a lower affinity for the Cellufine sulfate resin, as the heparin‐binding domain sequences of Bb‐FHA and Bp‐FHA differ importantly.
Figure 1

The SDS/PAGE analysis of FHA preparations purified from culture supernatants of B.pertussis (Bp‐FHA) and B.bronchiseptica (Bb‐FHA). The mature (FHA) and alternatively processed (FHA 1) forms of FHA are indicated.

The SDS/PAGE analysis of FHA preparations purified from culture supernatants of B.pertussis (Bp‐FHA) and B.bronchiseptica (Bb‐FHA). The mature (FHA) and alternatively processed (FHA 1) forms of FHA are indicated.

Identification of the C‐terminal residue of FHA

To identify the C‐terminal residues of the purified proteins, the bands corresponding to mature (FHA) and truncated (FHA1) forms of the FHA proteins were excised from the SDS/PAGE gels and digested with trypsin, AspN, or LysC proteases. In parallel, the Bp‐FHA and Bb‐FHA preparations were digested in solution and the resulting peptides were analyzed by LC‐MS/MS followed by MASCOT search. This yielded 94% and 96% coverage of the protein sequence of mature Bp‐FHA and Bb‐FHA, respectively (PRIDE Archive, project accession: PXD008664). The C‐terminal peptides of FHA proteins were identified as peptides with masses that did not match the highly specific cleavage pattern of the used proteases (X‐↓‐Asp/Glu for AspN; Lys‐↓‐X for LysC; and Arg/Lys‐↓‐X for trypsin). The C‐terminal peptides of Bp‐FHA1 and Bb‐FHA1 were further identified by peptide mapping of the in‐gel digested FHA1 bands (Fig. 1), as summarized in Table 1.
Table 1

The C‐terminal peptides of FHA and FHA1 proteins based on in‐gel and in‐solution digestions

ProteasePeptide positionPeptide sequenceMmonoisotopic (calculated)Mmonoisotopic (experimental)Error (Δ p.p.m.)
Bordetella pertussis FHAAspN2335–2348G.DQPVVAVGLEQPVA.T1420.75621420.75094
trypsin2300–2348R.NAQVADAGLAGPSAVAAPAVGAADVGVEPVTGDQVDQPVVAVGLEQPVA.T4546.31924546.32491
FHA1 AspN2214–2228R.DVGLEKRLDIDDALA.A1641.85731641.84965
LysC2220–2228K.RLDIDDALA.A1000.51891000.52516
Bordetella bronchiseptica FHAAspN2446–2479D.QPVVAVGLEQPAAAVRVAPPAVALPRPLFETRIK.F3560.07183560.05665
FHA1 AspN2335–2347D.DALAAVLVNPHIF.T1378.76081378.75147
trypsin2331–2347R.LDIDDALAAVLVNPHIF.T1834.98281834.98181
The C‐terminal peptides of FHA and FHA1 proteins based on in‐gel and in‐solution digestions The C‐terminal residue of Bp‐FHA was identified as Ala2348, based on detection of two peptides that partially violated the expected cleavage pattern, namely the AspN peptide 2335DQPVVAVGLEQPVA2348 and the tryptic peptide 2300NAQVADAGLAGPSAVAAPAVGAADVGVEPVTGDQVDQPVVAVGLEQPVA2348. The N termini of both peptides complied with the expected cleavage rules (X‐↓‐Asp for AspN and Arg‐↓‐X for trypsin) but the C‐terminal Ala2348 residue, followed by Thr2349 in FhaB sequence, did not, as neither AspN nor trypsin would cleave an Ala.Thr peptide bond. Similarly, the C terminus of Bp‐FHA1 was identified as Ala2228, based on detection of the LysC peptide 2220RLDIDDALA2228 and of the AspN peptide 2214DVGLEKRLDIDDALA2228. The N termini of these peptides complied well with LysC (Arg/Lys‐↓‐X) and AspN (X‐↓‐Asp) cleavage rules, while the C‐terminal Ala2228 residue (followed Ala2229 in FhaB sequence) could not result from cleavage of an Ala.Ala bond by LysC or AspN. It should be noted that the 2214DVGLEKRLDIDDALA2228 peptide contains three internal aspartate residues (D) that are possible targets for AspN cleavage, while the 2222DIDDALA2228, 2224DDALA2228, and 2225DALA2228 fragments were not detected. This can be understood, as the tetra‐ and penta‐peptides were too small to be trapped on the desalting column and were thus not detected by MS/MS. Moreover, AspN is rather inefficient in cutting of D‐D bonds and in complete processing of all the possible cleavage sites 29. The C‐terminal residue of Bb‐FHA could be identified only tentatively, as Lys2479 residue of 2446QPVVAVGLEQPAAAVRVAPPAVALPRPLFETRIK2479. This was the most C terminally located peptide detected in the AspN‐generated digests of Bb‐FHA. The N‐terminal residue of this peptide could have resulted from an unspecific AspN‐mediated cleavage on the N‐terminal side of Gln2446, but AspN was unlikely to have cleaved at the N‐terminal side of the Phe2480 residue, which follows Lys2479 in Bb‐FHA protein. Regrettably, no other peptides allowing confirmation of the identity of the C‐terminal residue of Bb‐FHA were detected. In contrast, the C‐terminal residue of Bb‐FHA1 was unambiguously identified by detection of the 2335DALAAVLVNPHIF2347 and 2331LDIDDALAAVLVNPHIF2347 peptides in the AspN and tryptic digests of Bb‐FHA1. Neither AspN, nor trypsin would cleave the 2347Phe.Thr2348 bond, while AspN and trypsin would generate the Asp2335 and Leu2331 N termini, respectively. Apart from the peptides covering the analyzed Bp‐FHA and Bb‐FHA proteins, the detailed analysis of MS spectra revealed that both FHA preparations contained also peptides originating from Bordetellae proteins other than FHA. As shown in Table 2, four and five additional proteins were identified as contaminants of the Bp‐FHA and Bb‐FHA preparations. Bp‐FHA contained traces of the putative phospholipid‐binding protein MlaC, of the toluene tolerance protein Ttg2D, and of the S4 and S5 subunits of pertussis toxin. The Bb‐FHA preparation was contaminated by adenylate cyclase toxin (CyaA), the SphB1 protease, and the Bsp22, BteA, and BopD proteins secreted by the type III secretion system.
Table 2

The overall protein content in the Bp‐FHA and Bb‐FHA preparations

ProteinMW (kDa)Isoelectric point (pI)
Bp‐FHAFilamentous hemagglutinin3679.2
Pertussis toxin subunit 4149.2
Pertussis toxin subunit 5135.4
Toluene tolerance protein Ttg2D209.2
Probable phospholipid‐binding protein mlaC219.2
Bb‐FHAFilamentous hemagglutinin3728.7
Adenylate cyclase toxin1784.4
SphB1 protease879.7
T3SS protein BopD326.4
T3SS protein Bsp22227.2
T3SS protein BteA695.0
The overall protein content in the Bp‐FHA and Bb‐FHA preparations To corroborate the identification of the C‐terminal residues of Bp‐FHA and Bb‐FHA proteins, we performed differential stable 18O isotope labeling. The method is based on protease‐catalyzed 18O replacement of two 16O atoms on the carboxyl of a newly liberated C‐terminal residue of a peptide that is generated by proteolytic cleavage of a protein in the presence of isotopic water (H2 18O) 30. As the carboxyl of the preexisting C‐terminal residue of the digested protein remains unlabeled, the resulting mass difference between the labeled and the unlabeled peptide ions permits the identification of the peptide that contains the C‐terminal residue of the given protein. As shown in Fig. 2, the isotope envelopes of the 2335DQPVVAVGLEQPVA2348 and 2214DVGLEKRLDIDDALA2228 peptide peaks in the 18O‐labeled AspN digests of the Bp‐FHA and of the Bp‐FHA1 proteins were identical to that observed for the same peptides in nonlabeled digests. The same was true for the 2446QPVVAVGLEQPAAAVRVAPPAVALPRPLFETRIK2479 and 2335DALAAVLNPHIF2347 peptides derived from Bb‐FHA and Bb‐FHA1 (Fig. 2). In contrast, the isotope envelopes of all other peptides in the 18O‐labeled AspN digests of Bp‐FHA/Bp‐FHA1 and Bb‐FHA/Bb‐FHA1 proteins exhibited the expected shifts to ‘double peaks’. These comprised strikingly enhanced intensities of the monoisotopic masses of the 18O‐labeled peptides, as documented in Fig. 2 for the internal 2279DALASLASL2288 and 1086DLQAGRSMTLGTVDTTG1102 peptides from the Bp‐FHA and Bb‐FHA proteins. These data thus fully confirmed that Ala2348 and Ala2228 were the C‐terminal residues of Bp‐FHA and of Bp‐FHA1, while Lys2479 and Phe2347 were the C‐terminal residues of Bb‐FHA and of Bb‐FHA1, respectively.
Figure 2

Isotope profiles of the C‐terminal peptides of FHA and FHA 1 after enzymatic digestion of Bp‐FHA (upper panel) and Bb‐FHA (lower panel) with AspN in the presence of normal H2O (unlabeled) and 50% 18O water (18O‐labeled).

Isotope profiles of the C‐terminal peptides of FHA and FHA 1 after enzymatic digestion of Bp‐FHA (upper panel) and Bb‐FHA (lower panel) with AspN in the presence of normal H2O (unlabeled) and 50% 18O water (18O‐labeled).

Mapping of FHA surface accessibility using immobilized endopeptidase columns

To gain insight into the specific sequence‐structure relationships of the Bp‐FHA and Bb‐FHA proteins, we performed an on‐line digestion of the two proteins on immobilized acid protease columns connected to an LC‐MS/MS analyzer. This instrumental setup comprises a continuous workflow system that is commonly employed for analysis of protein hydrogen/deuterium exchange (HDX) by mass spectrometry 26. The main advantage of this protocol is the rapidity of digestion and the absence of sample handling. This minimizes sample loss and unwanted protein modifications that may occur during lengthy digestions in typical proteomic protocols. Initial experiments with on‐line digestion of Bp‐FHA on an immobilized pepsin column at low pH (2.3) gave low peptide yields with sequence coverage of only 21% (data not shown). Remarkably, the recovered peptides predominantly originated from the C terminus of the mature Bp‐FHA protein (residues 1600–2350), indicating that the C‐terminal segment of Bp‐FHA is much more susceptible to protease digestion than its N‐terminal segment that exhibits a compact parallel β‐helical fold 8, 29. To increase the sequence coverage of the N‐terminal portion of FHA 19, the on‐line digestion was performed in the presence of denaturing agents, such as 3 m guanidine chloride or 4 m urea. These conditions usually do not denature proteins, but induce a partial destabilization of compact protein folds. Moreover, such concentrations of denaturing agents do not affect the cleavage efficiency of the immobilized proteases 26. Different protease columns (pepsin, nepenthesin‐1, aspergillopepsin, and rhizopuspepsin) along with different times and temperatures of digestion were also tested. Preliminary experiments showed that the best results were obtained on columns with immobilized pepsin proteases and operated and at flow rates of 100–200 μL·min−1 at 50 °C. The on‐line digest peptide map acquired under such conditions covered near completely the sequence of Bp‐FHA, starting from the N‐terminal pyroglutamate residue 72, up to the C‐terminal Ala2348 residue (Fig. 3). In contrast, the sequence coverage of the on‐line digest of Bb‐FHA was less complete (Fig. 3). The on‐line digestion was performed for a limited time under semidenaturing conditions, using proteases that mostly cleave C terminally to frequently occurring small hydrophobic residues. Therefore, the numbers of generated unique peptides, comprising a given residue of the FHA protein, reflect the accessibility of the corresponding segment to proteolytic cleavage and the compactness of its structure. The quantitative analysis of the peptide maps revealed a striking difference in the overall distribution of unique peptides that were generated by on‐line digestion of the Bp‐FHA and Bb‐FHA proteins (Fig. 3). Irrespectively of the protease used, importantly higher number of unique peptides was recovered from the C‐terminal segment of Bp‐FHA, than from its N‐terminal segment, thus indicating a loosened conformation of the C‐terminal segment of Bp‐FHA. In contrast, the C‐terminal segment of Bb‐FHA yielded disproportionally low numbers of unique peptides, which is indicative of a tightly packed structure. In contrast, substantially higher numbers of unique peptides were generated from the N‐terminal segment of Bb‐FHA, indicating its loosened structure (Fig. 3). This would go well with the fact that the N‐terminal segment of Bb‐FHA is about 131 residues longer than the corresponding segment of Bp‐FHA. On the other hand, the C‐terminal processing of the Bp‐FHA and Bb‐FHA proteins occurred at sites 21 residues apart within a segment of very high‐sequence homology of the Bp‐FHA and Bb‐FHA proteins (Fig. 4).
Figure 3

Surface accessibility of Bp‐FHA and Bb‐FHA probed by on‐column (on‐line) digestion. The FHA proteins were incubated in the presence of 4 m urea at 50 °C for 30 min and loaded on immobilized protease columns directly coupled to LC‐MS/MS analyzer. Frequency of the appearance of individual residues in the covered sequence is plotted as the number of unique peptides against the protein sequence. The data represent the aggregate result obtained from the on‐line digests using rhizopuspepsin, pepsin A, and aspergillopepsin columns.

Figure 4

Schematic representation of the C termini of FHA proteins. FHA is encoded by the fhaB gene and translated as a FhaB precursor polypeptide (3590 residues in Bordetella pertussis and 3710 residues in Bordetella bronchiseptica), containing the N‐terminal signal peptide (71 residues) that is removed during translocation of FhaB across the cytoplasmic membrane. FhaB is then exported from the periplasmic space through the outer membrane and processed in SphB1‐dependent manner, yielding mature [C terminus at position 2348 (Bp‐FHA) or 2479 (Bb‐FHA)] or truncated [C terminus at position 2228 (Bp‐FHA) or 2347 (Bb‐FHA)] variant of FHA protruding on the cell surface. The C‐terminal FhaB prodomain (130 kDa) remains in the periplasm, and it is rapidly degraded. The C‐terminal peptides identified by LC‐MS/MS approaches after digestion with AspN (blue), LysC (red), trypsin (green), rhizopuspepsin (orange), and (aspergillo)pepsin (magenta) are indicated over the Bp‐FHA and Bb‐FHA protein sequences aligned based on sequence homology.

Surface accessibility of Bp‐FHA and Bb‐FHA probed by on‐column (on‐line) digestion. The FHA proteins were incubated in the presence of 4 m urea at 50 °C for 30 min and loaded on immobilized protease columns directly coupled to LC‐MS/MS analyzer. Frequency of the appearance of individual residues in the covered sequence is plotted as the number of unique peptides against the protein sequence. The data represent the aggregate result obtained from the on‐line digests using rhizopuspepsin, pepsin A, and aspergillopepsin columns. Schematic representation of the C termini of FHA proteins. FHA is encoded by the fhaB gene and translated as a FhaB precursor polypeptide (3590 residues in Bordetella pertussis and 3710 residues in Bordetella bronchiseptica), containing the N‐terminal signal peptide (71 residues) that is removed during translocation of FhaB across the cytoplasmic membrane. FhaB is then exported from the periplasmic space through the outer membrane and processed in SphB1‐dependent manner, yielding mature [C terminus at position 2348 (Bp‐FHA) or 2479 (Bb‐FHA)] or truncated [C terminus at position 2228 (Bp‐FHA) or 2347 (Bb‐FHA)] variant of FHA protruding on the cell surface. The C‐terminal FhaB prodomain (130 kDa) remains in the periplasm, and it is rapidly degraded. The C‐terminal peptides identified by LC‐MS/MS approaches after digestion with AspN (blue), LysC (red), trypsin (green), rhizopuspepsin (orange), and (aspergillo)pepsin (magenta) are indicated over the Bp‐FHA and Bb‐FHA protein sequences aligned based on sequence homology.

Discussion

Release of many proteins and peptides from eukaryotic and prokaryotic cells involves proteolytic maturation of the secreted protein precursors. Production of the mature FHA protein of Bordetella pertussis involves processing of the 367‐kDa FhaB precursor, from which the bacterial surface‐anchored autotransporter subtilisin‐type protease SphB1 removes the 130‐kDa C‐terminal prodomain 23, 31, 32. Here, we have defined the C‐terminal residues of the mature and alternatively processed forms of FHA from the closely related B. pertussis and B. bronchiseptica species. Up to now, the C terminus of the mature FHA protein could not be accurately identified and it was only estimated by mass determination of purified B. pertussis FHA. The reported MALDI‐TOF analysis indicated that mature Bp‐FHA may arise from FhaB processing within the PLFETRIKFID sequence between residues 2362 and 2372 25. By analogy, processing of Bb‐FHA was predicted to occur between residues 2472 and 2482 of Bb‐FhaB. However, insufficient accuracy of mass determination of the 230‐kDa protein by MALDI‐TOF MS did not permit identification of its C‐terminal residue. The here‐employed digest‐based peptide mapping by high‐resolution FT‐ICR‐MS, combined with postdigestion 18O‐labeling analysis, yielded unambiguous identification of the C‐terminal residues of the various forms of the FHA protein (Fig. 4). Firstly, the C‐terminal residues of peptides that did not match the cleavage specificity of the used proteases indicated that the Ala2348 and Ala2228 were the bona fide C‐terminal residues of the mature Bp‐FHA/Bp‐FHA1 proteins. The Lys2479 and Phe2347 residues were then identified as the respective C‐terminal residues of the Bb‐FHA/Bb‐FHA1 proteins. Indeed, the molecular masses of peptides comprising these residues remained unchanged upon postdigestion 18O‐exchange labeling of the carboxyls of the C‐terminal residues of peptides that were newly generated by in vitro protease digestion in H2 18O. This confirmed the correct assignment of the C‐terminal residues. Mazar and Cotter (2006) have previously shown that the SphB1 protease is involved in proteolytic maturation of FhaB to FHA and FHA1 both in B. pertussis and in B. bronchiseptica. Moreover, the processed regions of the FhaB precursors from the two species exhibit a very high degree of sequence identity (Fig. 4) and the SphB1 proteases of the two species are themselves identical to 98%. It is, therefore, intriguing that processing of the FhaB proteins from the two species was found to occur at quite different sites located 21 residues apart within the same highly conserved segment of FhaB. Moreover, the processing step involved cleavage of peptide bonds between rather different pairs of residues. The bond between a small hydrophobic Ala2348 and a small hydrophilic Thr2349 residue was cleaved in Bp‐FhaB, while processing of the Bb‐FhaB protein resulted from cleavage of the bond between a positively charged Lys2479 and a bulky aromatic Phe2480 residue. As a result, the C‐terminal segment of the mature Bb‐FHA is extended by 21 residues, compared to mature Bp‐FHA. Similarly, the C‐terminal sequences of Bp‐FHA1 and Bb‐FHA1 differ by 9 residues. Albeit unlikely, it cannot be excluded that upon SphB1‐mediated cleavage the C termini of FHA may be further processed by some other secreted bacterial proteases. Alternatively, these unexpected results may indicate that the substrate specificities of the highly conserved SphB1 proteases of the two bacterial species may differ. The SphB1 protease, indeed, belongs to a superfamily of subtilisin‐like proteases that possess rather broad substrate specificity. This is largely determined by interactions of the P4‐P1 residue side chains in the binding pocket of the enzyme, which enables the cleavage of peptide bonds on the C‐side of aliphatic or aromatic amino acid residues 33. A closer look on the P4‐P1 residues of Bp‐FHA (QPVA2348) and Bp‐FHA1 (DALA2228) reveals a certain analogy between their C‐terminal sequences, in terms of side chain properties, indicating that Bp‐FhaB is processed by SphB1 with a defined substrate specificity. In contrast, the C‐terminal sequences of Bb‐FHA (TRIK2479) and Bb‐FHA1 (PHIF2347) are rather distinct and do not appear to share any similarity, even though the C‐terminal residue of Bb‐FHA1 complies with the substrate specificity of subtilisin‐like proteases. However, the C‐terminal Lys2479 residue of Bb‐FHA does not match the substrate specificity of a subtilisin type of protease. It thus remains to be determined if the Bb‐SphB1 has a broader substrate specificity than Bp‐SphB1, or another as yet unknown protease participates in the final processing of the Bb‐FhaB precursor. Even though the Bp‐FHA and Bb‐FHA proteins are highly homologous (90% identity) and appear to be functionally interchangeable between B. pertussis and B. bronchiseptica 34, our data show that the C termini of mature FHA proteins differ by 21 amino acid residues. The here observed difference in the processing and protease susceptibility of the C‐terminal segments of the two proteins is intriguing, as the mature C‐terminal domain of FHA was proposed to play an important role in adherence and virulence of Bordetellae 11, 24, 31, 34. B. pertussis is a fully human‐adapted pathogen, while B. bronchiseptica infects a broad variety of mammals. It will, hence, be important to determine whether the difference in FhaB processing in the two bacterial species plays a role in the biological activity of mature FHA proteins.

Author contributions

DJ measured and analyzed the data, PM performed and evaluated the on‐line digests, LB and PS designed the project, and LB, DJ, and PS wrote the manuscript.
  34 in total

1.  Mechanism of association of adenylate cyclase toxin with the surface of Bordetella pertussis: a role for toxin-filamentous haemagglutinin interaction.

Authors:  Franca R Zaretzky; Mary C Gray; Erik L Hewlett
Journal:  Mol Microbiol       Date:  2002-09       Impact factor: 3.501

2.  The crystal structure of filamentous hemagglutinin secretion domain and its implications for the two-partner secretion pathway.

Authors:  Bernard Clantin; Hélène Hodak; Eve Willery; Camille Locht; Françoise Jacob-Dubuisson; Vincent Villeret
Journal:  Proc Natl Acad Sci U S A       Date:  2004-04-12       Impact factor: 11.205

3.  Adenylate cyclase influences filamentous haemagglutinin-mediated attachment of Bordetella pertussis to epithelial alveolar cells.

Authors:  Maria L A Perez Vidakovics; Yanina Lamberti; W-Ludo van der Pol; Osvaldo Yantorno; Maria Eugenia Rodriguez
Journal:  FEMS Immunol Med Microbiol       Date:  2006-10

4.  Structure of the membrane protein FhaC: a member of the Omp85-TpsB transporter superfamily.

Authors:  Bernard Clantin; Anne-Sophie Delattre; Prakash Rucktooa; Nathalie Saint; Albano C Méli; Camille Locht; Françoise Jacob-Dubuisson; Vincent Villeret
Journal:  Science       Date:  2007-08-17       Impact factor: 47.728

5.  Waning immunity to pertussis following 5 doses of DTaP.

Authors:  Sara Y Tartof; Melissa Lewis; Cynthia Kenyon; Karen White; Andrew Osborn; Juventila Liko; Elizabeth Zell; Stacey Martin; Nancy E Messonnier; Thomas A Clark; Tami H Skoff
Journal:  Pediatrics       Date:  2013-03-11       Impact factor: 7.124

6.  Six alternative proteases for mass spectrometry-based proteomics beyond trypsin.

Authors:  Piero Giansanti; Liana Tsiatsiani; Teck Yew Low; Albert J R Heck
Journal:  Nat Protoc       Date:  2016-04-28       Impact factor: 13.491

7.  Bordetella pertussis filamentous hemagglutinin itself does not trigger anti-inflammatory interleukin-10 production by human dendritic cells.

Authors:  Rodrigo Villarino Romero; Shakir Hasan; Kellen Faé; Jana Holubova; Jeroen Geurtsen; Martin Schwarzer; Selma Wiertsema; Radim Osicka; Jan Poolman; Peter Sebo
Journal:  Int J Med Microbiol       Date:  2015-11-30       Impact factor: 3.473

8.  The prodomain of the Bordetella two-partner secretion pathway protein FhaB remains intracellular yet affects the conformation of the mature C-terminal domain.

Authors:  Christopher R Noël; Joseph Mazar; Jeffrey A Melvin; Jessica A Sexton; Peggy A Cotter
Journal:  Mol Microbiol       Date:  2012-10-05       Impact factor: 3.501

9.  New Insight into Filamentous Hemagglutinin Secretion Reveals a Role for Full-Length FhaB in Bordetella Virulence.

Authors:  Jeffrey A Melvin; Erich V Scheller; Christopher R Noël; Peggy A Cotter
Journal:  mBio       Date:  2015-08-18       Impact factor: 7.867

10.  2016 update of the PRIDE database and its related tools.

Authors:  Juan Antonio Vizcaíno; Attila Csordas; Noemi del-Toro; José A Dianes; Johannes Griss; Ilias Lavidas; Gerhard Mayer; Yasset Perez-Riverol; Florian Reisinger; Tobias Ternent; Qing-Wei Xu; Rui Wang; Henning Hermjakob
Journal:  Nucleic Acids Res       Date:  2015-11-02       Impact factor: 16.971

View more
  1 in total

Review 1.  Precision Vaccine Development: Cues From Natural Immunity.

Authors:  Soumik Barman; Dheeraj Soni; Byron Brook; Etsuro Nanishi; David J Dowling
Journal:  Front Immunol       Date:  2022-02-10       Impact factor: 7.561

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.