| Literature DB >> 29177138 |
Xing-Ru Chen1,2, Xiao-Ting Wang1,2, Mei-Qi Hao1,2, Yong-Hui Zhou1,2, Wen-Qiang Cui1,2, Xiao-Xu Xing1,2, Chang-Geng Xu1,2, Jing-Wen Bai3, Yan-Hua Li1,2.
Abstract
The imidazole glycerophosphate dehydratase (IGPD) protein is a therapeutic target for herbicide discovery. It is also regarded as a possible target in Staphylococcus xylosus (S. xylosus) for solving mastitis in the dairy cow. The 3D structure of IGPD protein is essential for discovering novel inhibitors during high-throughput virtual screening. However, to date, the 3D structure of IGPD protein of S. xylosus has not been solved. In this study, a series of computational techniques including homology modeling, Ramachandran Plots, and Verify 3D were performed in order to construct an appropriate 3D model of IGPD protein of S. xylosus. Nine hits were identified from 2,500 compounds by docking studies. Then, these nine compounds were first tested in vitro in S. xylosus biofilm formation using crystal violet staining. One of the potential compounds, baicalin was shown to significantly inhibit S. xylosus biofilm formation. Finally, the baicalin was further evaluated, which showed better inhibition of biofilm formation capability in S. xylosus by scanning electron microscopy. Hence, we have predicted the structure of IGPD protein of S. xylosus using computational techniques. We further discovered the IGPD protein was targeted by baicalin compound which inhibited the biofilm formation in S. xylosus. Our findings here would provide implications for the further development of novel IGPD inhibitors for the treatment of dairy mastitis.Entities:
Keywords: Staphylococcus xylosus; biofilm formation; homology model; imidazole glycerophosphate dehydratase (IGPD); virtual screening
Year: 2017 PMID: 29177138 PMCID: PMC5686052 DOI: 10.3389/fchem.2017.00098
Source DB: PubMed Journal: Front Chem ISSN: 2296-2646 Impact factor: 5.221
The full-length protein sequence of IGPD from the gene sequence.
| MIYQKTRNTAETQLSISLADDNRPSKINTGVGFLDHMLTLFTFHSNLSITIEANGDTEV |
3D structures used as templates for homology modeling of IGPD protein.
| 74 | 4.04E-71 | 2.01 | |
| 40 | 4.18E-36 | 3 | |
| 40 | 6.90E-34 | 2.3 | |
| 32 | 2.783 | 1.9 | |
| 24 | 3.69587 | 2.25 | |
| 25 | 3.98409 | 2 | |
| 34 | 5.60917 | 2.101 |
Figure 1The alignment sequence between IGPD proteins from Staphylococcus xylosus. Staphylococcus aureus (PDB ID: 2AE8F), Arabidopsis thaliana (PDB ID: 2F1DP) and Cryptococcus neoformans (PDB ID: 1RHYB). The α helices are shown as red blocks. The β sheets are shown as blue blocks. Most of the secondary structures are observed to be well conserved.
Figure 2Superposition of ligand-free dimers of IGPD showing the difference flap conformations.
Figure 3The protein backbone is shown and colored gold, cyan for chains A, A' respectively. The two manganese ions are shown as labeled silvery white spheres, and the atoms of the compound, baicalin, are shown in ball-and-stick format and colored by atom. Polar interactions are shown as dashed colored lines. Among them, the green dotted line represents the hydrogen bond interaction. The pink dotted line represents hydrophobic interaction.
The screen of compounds of MICs and the biofilm formation.
| 64982 | Baicalin | 38.9626 | 58.3956 | >5 | |
| 5281614 | Fisetin | 89.0047 | 56.9835 | >12 | |
| 10639 | Physcion | 39.4196 | 38.5684 | > 4.5 | |
| 1794427 | Chlorogenic Acid | 44.9349 | 66.4344 | >9 | |
| 23711819 | Sodium Danshensu | 62.4521 | 58.0722 | >21 | |
| 3220 | Emodin | 46.6379 | 39.5454 | 0.156 | |
| 10208 | Chrysophanol | 41.7041 | 38.5834 | 0.156 | |
| 445858 | Ferulic Acid | 48.0386 | 51.0912 | 0.875 | |
| 5281605 | Baicalein | 54.3528 | 45.3041 | 2 |
Figure 4Effect of MICs of compounds at different concentrations on biofilm formation by Staphylococcus xylosus ATCC700494. Data are expressed as means ± standard deviations. Asterisk indicates signifcantly different (*p < 0.05) compared to untreated control bacteria. (A) Baicalin: (a) blank, (b) 5 mg/mL (c) 2.5 mg/mL, (d) 1.25 mg/mL, (e) control. (B) Fisetin: (a) blank, (b) 12 mg/mL (c) 6 mg/mL, (d) 3 mg/mL, (e) control. (C) Emodin: (a) blank, (b) 1/2 MIC (c) 1/4 MIC, (d) 1/8 MIC, (e) control. (D) Ferulic acid: (a) blank, (b) 1/2 MIC (c) 1/4 MIC, (d) 1/8 MIC, (e) control. (E) Physcion: (a) blank, (b) 4.5 mg/mL (c) 2.25 mg/mL, (d) 1.125 mg/mL, (e) control. (F) Chlorogenic: (a) blank, (b) 9 mg/mL (c) 4.5 mg/mL, (d) 2.25 mg/mL, (e) control. (G) Physcion: (a) blank, (b) 1/2 MIC (c) 1/4 MIC, (d) 1/8 MIC, (e) control. (H) Baicalein (a) blank, (b) 1/2 MIC (c) 1/4 MIC, (d) 1/8 MIC, (e) control. (I) Solidum danshensu: (a) blank, (b) 21 mg/mL (c) 10.5 mg/mL, (d) 5.25 mg/mL, (e) control.
Figure 5Scanning electron micrographs of S. xylosus ATCC700794 biofilm following growth in TSB supplemented with 5 mg/mL of baicalin (a) or control (b). Controls refer to the absence of baicalin. (A) 5 mg/mL of baicalin. (B) control.