Literature DB >> 29027956

Combined Venom Gland Transcriptomic and Venom Peptidomic Analysis of the Predatory Ant Odontomachus monticola.

Kohei Kazuma1, Keiichi Masuko2, Katsuhiro Konno3, Hidetoshi Inagaki4.   

Abstract

Ants (hymenoptera: Formicidae) have adapted to many different environments and have become some of the most prolific and successful insects. To date, 13,258 ant species have been reported. They have been classified into 333 genera and 17 subfamilies. Except for a few Formicinae, Dolichoderinae, and members of other subfamilies, most ant species have a sting with venom. The venoms are composed of formic acid, alkaloids, hydrocarbons, amines, peptides, and proteins. Unlike the venoms of other animals such as snakes and spiders, ant venoms have seldom been analyzed comprehensively, and their compositions are not yet completely known. In this study, we used both transcriptomic and peptidomic analyses to study the composition of the venom produced by the predatory ant species Odontomachus monticola. The transcriptome analysis yielded 49,639 contigs, of which 92 encoded toxin-like peptides and proteins with 18,106,338 mapped reads. We identified six pilosulin-like peptides by transcriptomic analysis in the venom gland. Further, we found intact pilosulin-like peptide 1 and truncated pilosulin-like peptides 2 and 3 by peptidomic analysis in the venom. Our findings related to ant venom peptides and proteins may lead the way towards development and application of novel pharmaceutical and biopesticidal resources.

Entities:  

Keywords:  Odontomachus monticola; peptidome; pilosulin-like peptide; transcriptome; venom gland

Mesh:

Substances:

Year:  2017        PMID: 29027956      PMCID: PMC5666370          DOI: 10.3390/toxins9100323

Source DB:  PubMed          Journal:  Toxins (Basel)        ISSN: 2072-6651            Impact factor:   4.546


1. Introduction

Ants (Formicidae) have many traits in common with social and solitary wasps and bees, including morphology, behavior, and bionomics. Like such Aculeata, most ant species have a sting which they use in both predation and defense. The potency of the venom is attributed to various irritant or paralytic constituents, some of which are potential lead compounds in drug development. To date, conventional biochemical and molecular biological methods have been employed to identify toxin-like peptides and proteins from several ant species. In our previous studies, we identified bioactive peptides from Myrmecia species complex [1,2] and Strumigenys kumadori [3] by a PCR-mediated method. In addition, de novo sequencing and transcriptome analysis yielded many toxin-like peptides and proteins from the venom glands of the predatory ants Dinoponera quadriceps [4] and Tetramorium bicarinatum [5]. Considering the number of ant species already identified, however, the number of toxin-like peptides and proteins which have been identified from ants are so limited thus far. Odontomachus monticola, a predatory ant species in the subfamily Ponerinae, is about 10 mm long, red-brown in color, and has long mandibles. O. monticola is distributed mainly throughout south- and southeast Asia. In Japan, these ants were originally confined to the southwestern part of the country [6]. Nevertheless, their habitat range has expanded to Tokyo due to climate change over the last few decades. They use their powerful stings to prey upon termites. Although they are not aggressive toward humans, their stings cause intense pain and prolonged itching (Figure 1).
Figure 1

Odontomachus monticola venom sting, sac, and gland. O. monticola (A) and its venom sac and gland were dissected from the abdomen (B). Venom sac and gland of panel B were magnified (C).

In previous studies, Aili et al. used LC-MS to analyze the venoms of O. hastatus in French Guiana and found 528 molecular masses in the venom, 27 of which were disulfide-bonded [7,8]. The primary structures and biological activities of these peptides have not yet been elucidated. In this study, we used both transcriptomic and peptidomic analyses to identify novel toxic peptides and proteins of Odontomachus monticola, a heretofore unexamined species. We identified six pilosulin-like peptides, one chitinase-like protein, one icarapin-like peptide, one hyaluronidase-like protein, four dipeptidyl peptidases, four inhibitor cystine knot (ICK)-like peptides, three phospholipase A2-like proteins, and others. In addition, we found certain factors which activate the toxin precursors.

2. Results and Discussion

2.1. Ilumina Hiseq 2500 Deep RNA Sequencing, Assembly, and Annotation

To characterize the gene expression profile of the O. monticola venom gland, we analyzed its mRNA using the Next Generation Sequencer, Illumina Hiseq 2500 and obtained 44,087,058 100-bp reads. The de novo assemblies with Trinity yielded 49,639 contigs (N50 contig 1466 bp). After the highly homologous and duplicated contigs were integrated with cd-hit-est, 43,662 of them were compared against the Uniprot KB database with the BLASTX program in order to determine their potential functions. About 69.3% of the contigs were found to resemble the transcripts in the Uniprot KB database. We found that two contigs, Om13705_c0_g1_i1 and Om23716_c0_g1_i1, corresponded to 18 s and 28 s rRNAs, respectively. In addition, the 1897 contigs with similarities to bacterial transcripts (Figure S1) might indicate symbiotic microbes in O. monticola. Some of these microbes might be utilized for the supply of amino acids and vitamins to the host ant species [9]. These contigs were eliminated from the O. monticola transcript data. To estimate the relative expression levels of the venom gland transcripts, the input reads were mapped to the contigs and counted by Bowtie 2. Five contigs at the top of the read counts resembled an antimicrobial ant peptide, pilosulin, and a toxic honey bee (Apis mellifera) peptide, melittin, in predicted amino acid sequences. We named the peptides encoded by these contigs pilosulin-like peptides 2, 3, 4, 5, and 6. We used PCR in the attempt to find other transcripts encoding pilosulin-like peptides. We designed two 20-base primers corresponding to the leader sequence and the 3′ untranslated region. These are conserved in pilosulin-like peptides 2 and 4. We found another cDNA clone that encodes a pilosulin-like peptide and called it pilosulin-like peptide 1. Pilosulin-like peptides 1, 2, and 4 share conserved 5′ and 3′ untranslated sequences and a leader sequence. Therefore, assembly software could not discriminate among the reads derived from each pilosulin-like peptide, and might not generate a contig coding for pilosulin-like peptide 1. After adding the pilosulin-like peptide 1 sequence to the 41,764 reference sequences and eliminating the rRNA and bacterial transcripts from them, all input reads were mapped to them and counted again by Bowtie 2 in order to estimate the relative venom gland transcript expression levels (Table 1).
Table 1

Summary of O. monticola venom gland transcriptome.

Total number of reads44,087,058
Average base pairs100 bp
Total number of contigs49,639
(after cd-hit-est)43,662
(-rRNA, -Bacterial transcripts, +Pilosulin-like peptide 1)41,764
N50 contig size1466 bp
Ninety-two contigs corresponding to toxin-like peptides and proteins and their isoforms were selected from the database search. The relative expression levels of the toxin-like peptide and protein genes accounted for 45.1% of all reads. Pilosulin-like peptide transcripts constituted 98.5% of the toxin-like peptide and protein reads in the venom transcripts. The remaining 1.5% represented the expression of other toxin-like peptide and protein genes in the venom gland (Figure 2A,B).
Figure 2

The Odontomachus monticola venom gland gene expression profile. The relative expression levels of the genes encoding toxin-like peptides, proteins, non-toxins, and unidentified molecules are displayed as percentages of mapped reads in the total reads (A). The distribution of toxin-like peptide- and protein gene expressions (B) and non-toxin gene expressions (C) are shown. The relative expression levels of the genes are typically reported as RPKM (reads per kilobase of exon model per million mapped reads) in order to correct for the differences in length of individual transcripts. Nevertheless, transcript lengths may not, in fact, influence the expression levels, because those for the abundantly expressed toxin-like peptides and proteins were short.

Despite the wide range of similarities in the amino acid sequences among individual toxin-like peptides and proteins, the combination of toxin-like peptides and protein transcripts in O. monticola venom gland resembled that of T. bicarinatum [5]. We found pilosulin-like peptides, ICK-like peptides, phospholipase A2-like proteins, waprin-like peptides, hyaluronidase-like proteins, venom allergen 1 (Sol i 1-like protein and phospholipase A1-like protein), venom allergen 2/4 (Sol i 2/4), venom serine proteases, and venom carboxylesterase in two species. The venom glands in the two ant species are rich in pilosulin-like peptide transcripts and poor in the rest of the toxin-like peptide and protein transcripts. Venom gland transcriptomic analyses of some parasitoid wasps (Hymenoptera) have been reported. In contrast to the combination in the two ant species mentioned above, they seem to have few or no linear peptides, like pilosulin and melittin [10,11]. The relative expression level of non-toxin genes accounted for 45.2% of all reads. They were rich in ribosomal proteins (7.0%), vitellogenins (2.8%), apolipophorins (2.2%), elongation factors (1.6%), and cytochrome oxidase P450 (1.6%) (Figure 2A,C). In the non-toxin and toxin contigs, we found some transcripts which encode the factors that activate or modify the toxins. These include protein disulfide-isomerases (Om23447_c0_g1_i1, Om12259_c2_g2_i2), dipeptidyl peptidases (Om12825_c0_g9_i1, Om4088_c0_g1_i1, Om1574_c0_g1_i1, Om4797_c0_g1_i1), amidating lyases (Om9737_c0_g1_i3, Om1447_c0_g1_i1), and carboxypeptidases (Om9464_c0_g1_i1).

2.2. Toxin-Like Peptides and Proteins

2.2.1. Pilosulin-Like Peptides

In our previous studies, we identified pilosulins 3, 4, and 5 from Myrmecia pilosula species complex [1,2]. Pilosulin-like peptides resemble mellitin and pilosulin in terms of their precursor amino acid sequences (20.0–32.8%) (Figure 3A). In the precursor leader sequences, both pilosulins and pilosulin-like peptides contain a repeated sequence with a proline or alanine residues at every second or fourth position and aspartic or glutamic acid residues between them. Because of the low similarities, we could not find a common feature among pilosulin-like peptides in the mature forms, except for pilosulin-like peptides 1, 2, 3, 4, 6, which are alpha helices, amphiphilic, and basic peptides.
Figure 3

Multiple alignment and identity matrix of pilosulin-related peptide amino acid sequences. Percentage amino acid sequence identities between melittin (NP_001011607.1), pilosulin 1 (Q07932.1), and pilosulin-like peptides (PLPs) are shown in (A). The amino acid sequences of melittin and pilosulin-like peptides were aligned with ClustalW in Lasergene 12 (DNASTAR, Madison, WI, USA). Arrows indicate the putative processing and modification sites for signal peptidase, dipeptidyl peptidase, amidating lyase, and carboxypeptidase. Proline and alanine residues in the spacer region between the signal- and mature peptides of pilosulin-related peptides are highlighted in yellow. Nucleotide sequences for PLP 1, 2, 3, 4, 5, and 6 were assigned DDBJ/EMBL/GenBank Accession Numbers LC316119, and FX985495-9, respectively (B).

Some of the bioactive linear peptides in Hymenoptera like melittin [12], eumenine mastoparan-OD-like peptide [13], dinoponeratoxin [4], and pilosulin [14] share the same unique repeated sequences in their leader sequences. These repeats might be a common feature of all bioactive linear peptides in Hymenoptera. The repeated sequences could be processed by dipeptidyl peptidase 4 [15], which cleaves the precursor peptides after the proline and alanine residues to yield dipeptides next to an endopeptidase (Figure 3B). In fact, dipeptidylpeptidase 4 (Om4088_c0_g1_i1) was moderately expressed in the venom gland (0.15% of all toxin-like peptide and protein reads). Many bioactive peptides, which have glycine or glycine-lysine residues at the C-terminus in the precursor, tend to be amidated at this site in the mature forms. Pilosulin-like peptides 1, 5, and 6 have glycine-lysine residues at their C-termini [16]. Carboxypeptidase (Om9464_c0_g1_i1, less than 0.01% of all toxin-like peptide and protein reads) and amidating lyase (Om9737_c0_g1_i3 and Om1447_c0_g1_i1, less than 0.01% of all non-toxin reads) were slightly expressed in the venom gland. The theoretical masses of pilosulin-like peptides 1, 5, and 6 are 2061.090, 1837.071, and 3704.231, respectively. Many bioactive peptides, which have glutamic acid-lysine residues at their C-termini in the precursors, lose the lysine residues in their mature forms. Therefore, pilosulin-like peptides 2 and 3 could also lose their C-terminus lysine residues. The theoretical masses of pilosulin-like peptides 2 and 3 after C-terminus lysine loss are 3361.753 and 4101.241. Pilosulin-like peptide 4 has one cysteine residue and a theoretical mass of 3166.810. In the Myrmecia pilosula species complex, pilosulin 5 monomeric peptides with one cysteine residue are connected by a disulfide bridge as homodimers [2]. Using peptidome analysis, we also found a peptide with the same mass as the pilosulin-like peptide 4 dimer in O. monticola venom (Table 2). In summary, two pilosulin-like peptide 4 monomers may be joined by a disulfide bridge to form a dimer with a theoretical mass of 6331.625.
Table 2

Pilosulin-like peptide sequences analyzed from MS/MS spectra.

Fraction No.Retention Time (min)Amino Acid SequenceObserved Molecular Mass aDerivative
98.15KVMDWLKDKM-NH21291.677PLP1
118.55VMDWLKDKM-NH21163.582PLP1
118.75AAANAAASEALSAMASQNE1776.795PLP3
129.08GLLDWGK787.423PLP1
129.21GWGSLFK793.412PLP2
129.40GWGSLFKT894.458PLP2
139.54GWGSLFKTVGKM1309.685PLP2
1410.95GWGSLFKTVGKMLAKAAVK1991.142PLP2
1411.08KTALEAAANAAASEALSAMASQNE2319.098PLP3
1511.86GLLDWGKKVMDWLKDKm-NH22077.083PLP1
1612.75GLLDWGKKVMDWLKDKM-NH22061.090PLP1

a monoisotopic mass, L = either L or I; m = methionine S-oxide.

2.2.2. Chitinase-Like Protein

In general, insects use chitinase to digest chitinous materials and to remodel their body structures during ecdysis. Chitinase was detected in the venom gland of an endoparasitic wasp, Cheonus spp. In Cheonus, chitinase might facilitate the diffusion of the other venom components or the digestion of the prey [17]. A chitinase of the octopus Eledone cirrhosa is hemolytic [18]. In O. monticola, we found one contig (Om8058_c0_g1_i1) encoding chitinase-like protein (0.51% of all toxin-like peptide and protein reads). O. monticola chitinase-like protein displays significant homology (75.7%) with the amino acid sequences of A. mellifera (honey bee) chitinase-like protein XP_001120887.3 (Figure 4). Recently, Tetreau et al. [19] classified chitinase-like proteins into eleven groups. On the basis of this system, O. monticola chitinase-like protein was placed in group V.
Figure 4

Alignment of chitinase-like protein amino acid sequences. Using ClustalW, the amino acid sequences of chitinase-like proteins were aligned. The catalytic domain and identical amino acid residues were highlighted in red and grey, respectively. The nucleotide sequence of O. monticola chitinase-like protein has been assigned DDBJ/EMBL/GenBank Accession Numbers FX985546.

2.2.3. Icarapin-Like Peptide

We found one contig (Om1373_c0_g1_i1) encoding icarapin-like peptide (0.30% of all toxin-like peptide and protein reads). Icarapin is an IgE-binding A. mellifera venom protein. Although recombinant icarapin reacts with sera from humans allergic to bee venom (Api m 10), the primary biological functions of icarapin are unknown [20]. O. monticola icarapin-like peptide displays significant homology (49.7%) with the amino acid sequences of A. mellifera icarapin Q5EF78.2 (Figure 5).
Figure 5

Alignment of icarapin-like peptide amino acid sequences. Using ClustalW, the amino acid sequences of icarapin-like peptides were aligned. Identical amino acid residues of icarapin-like peptides are highlighted in grey. The nucleotide sequence of O. monticola icarapin-like peptide has been assigned DDBJ/EMBL/GenBank Accession Numbers FX985505.

2.2.4. Hyaluronidase

Hyaluronidase occurs in many venomous animals, including ants and bees. Hyaluronidase degrades hyaluronic acid, thereby facilitating the penetration of the venom components into various tissues. It is also an allergen in A. mellifera venom (Api m 2) [21]. In O. monticola venom glands, one contig (Om13456_c0_g1_i1) encodes hyaluronidase (0.21% of all toxin-like peptide and protein reads). Both O. monticola and A. mellifera hyaluronidase have four conserved cysteine residues. O. monticola hyaluronidase displays significant homology (52.8%) with the amino acid sequences of A. mellifera hyaluronidase NP_001011619 (Figure 6).
Figure 6

Alignment of hyaluronidase amino acid sequences. Using ClustalW, the amino acid sequences of hyaluronidases were aligned. Identical amino acid residues of hyaluronidases are highlighted in grey. Conserved cysteine and identical amino acid residues of hyaluronidases are highlighted in red and grey, respectively. The nucleotide sequence of O. monticola hyaluronidase has been assigned DDBJ/EMBL/GenBank Accession Numbers FX985505.

2.2.5. ICK-Like Peptides

We found four contigs in the O. monticola transcript data which encode ICK-like peptides. Three of them have six conserved cysteine residues (Om253_c0_g2_i1, Om12753_c3_g1_i1, and Om17608_c0_g1_i1) and are known as short-type ICK-like peptides 1, 2, and 3, respectively. The other has eight conserved cysteine residues (Om11798_c3_g4_i1 with 290 reads) and is called a long-type ICK-like peptide. The transcription levels of all ICK-like peptides are low (<0.1% of all toxin-like peptide and protein reads). Short-type ICK-like peptides 1, 2, and 3 share amino acid sequences (20.4–76.9% homology) with a D. quadriceps ortholog (XP_014475205.1). The ICK-like peptides seem to be ubiquitous among all ant species. Although they have diverse biological functions like antimicrobial activity and ion channel blocking, they are still poorly understood [22]. The long-type ICK-like and the D. quadriceps ortholog (XP_014473918.1) have nearly identical amino acid sequences (96.9% identity) except for three amino acid substitutions at positions 10, 20, and 74 [4] (Figure 7).
Figure 7

Multiple alignment alignment of ICK-like peptide amino acid sequences. Using ClustalW, the amino acid sequences of long- (A) and short- (B) type ICK-like peptides were aligned. Conserved cysteine and identical amino acid residues of ICK-like peptides are highlighted in black and grey, respectively. The nucleotide sequences of O. monticola ICK-like peptides have been assigned DDBJ/EMBL/GenBank Accession Numbers FX985500-985503.

2.2.6. Dipeptidyl Peptidase 4

We found four contigs in the O. monticola transcript data encoding dipeptidyl peptidase 4 (Om12825_c0_g9_i1, Om4088_c0_g1_i1, Om1574_c0_g1_i1, and Om4797_c0_g1_i1). The dipeptyl peptidase 4 corresponding to Om12825_c0_g9_i1 constitutes 0.15% of all toxin-like peptide and protein reads in the venom gland. It displays significant homology with D. quadriceps venom dipeptidyl peptidase 4 isoform X2 (XP_014479089.1) (78.7%) and that of A. mellifera (NP_001119715.1) (53.4%). The other dipeptidyl peptidases 4, Om4088_c0_g1_i1, Om1574_c0_g1_i1, and Om4797_c0_g1_i1, closely resemble D. quadriceps dipeptidyl peptidase 4 isoform X2 (XP_014469652.1), Harpegnathos saltator dipeptidyl aminopeptidase C2E11.08 isoform X2 (XP_011146456.1), and Harpegnathos saltator dipeptidyl peptidase 4 (EFN87859.1) (94.3%, 93.2%, and 99.5%, respectively) (Figure 8). In A. mellifera, dipeptidyl peptidase 4 is a major venom allergen and is known as Api m 5. Despite the fact that A. mellifera dipeptidyl peptidase 4 is an allergen, O. monticola dipeptidyl peptidase 4 might serve to activate pilosulin-like peptides [15].
Figure 8

Multiple alignment of dipeptidyl peptidase amino acid sequences. Using ClustalW, the amino acid sequences of dipeptidyl peptidases were aligned. The key amino acid residues for enzymatic activity and identical amino acid residues were highlighted in red and grey, respectively. The nucleotide sequences of O. monticola dipeptidyl peptidases have been assigned DDBJ/EMBL/GenBank Accession Numbers FX985542-FX985545.

2.2.7. Phospholipase A2-Like Proteins

As with the venom glands in other ant species, the phospholipase A2-like protein gene is expressed in those of O. monticola. We found five contigs encoding phospholipase A2-like proteins in O. monticola. Three of them (Om12710_c0_g1_i5, Om6159_c0_g1_i1, and Om13056_c3_g1_i1) significantly resemble (25.0–71.4%) the venom gland phospholipase A2 (XP_001120293.1 and XP_016768690.1) of A. mellifera, and two of them (Om13038_c1_g2_i11 and Om11043_c0_g2_i1) are similar to the housekeeping phospholipase ABHD3 and the calcium-independent phospholipase A2 gamma, respectively. The enzymatic activities of phospholipases A2 vary significantly with ant species [23]. The transcription levels of Om12710_c0_g1_i5, Om6159_c0_g1_i1, and Om13056_c3_g1_i1 were very low (<0.1% of all toxin-like peptide and protein reads), so the enzymatic activities of phospholipases A2 in the venom might be low as well. Like other phospholipases A2, the O. monticola phospholipase A2-like protein has His74, Asp104, and Tyr/Phe126 which form a reactive center, Trp48, Gly50, Gly52, and Asp75 for Ca2+ binding, and eight conserved cysteine residues. (The numbering refers to XP_001120293.1) (Figure 9). Based on the phospholipase A2 classification by Dennis et al., O. monticola phospholipase A2-like protein might be a group III phospholipase A2 [24].
Figure 9

Multiple alignment of phospholipase A2-like protein amino acid sequences. Using ClustalW, the amino acid sequences of phospholipase A2-like proteins were aligned. Conserved cysteine and identical amino acid residues are highlighted of phospholipase A2-like proteins are highlighted in black and grey, respectively. The key amino acid residues for Ca2+ binding and enzymatic activity were highlighted in yellow and red, respectively. The nucleotide sequences of O. monticola phospholipase A2-like proteins have been assigned DDBJ/EMBL/GenBank Accession Numbers FX985506-FX985507.

2.2.8. Other Low-Abundance Transcripts of Toxin-Like Peptides and Proteins

The following transcripts were found for minor venom gland components: venom allergens 1–4 [25], three venom acid phosphatases, four venom serine proteases, two waprin-like peptides, one vascular endothelial cell growth factor (VEGF), one phospholipase D1, one Kazal protease inhibitor, one Kunitz protease inhibitor, six matrix metallopeptidases (MMPs), one secapin, one carboxypeptidase, and two carboxylesterase. The corresponding contig ID, accession numbers, lengths, read counts, identities with corresponding orthologs, and potential functions are summarized in Table S1. Most of these toxin-like proteins and peptides show significant homology with their corresponding orthologs in other ant species. Venom allergens 2 and 4, however, display low identities with the orthologs but both the proteins and their orthologs share 4 and 6 conserved cysteine residues, respectively.

2.3. Peptidomic Analysis

For MS/MS analysis of venom peptides, O. monticola venom was subjected to LC-MS by reverse-phase chromatography (C18 UG 120). On-line mass fingerprint was prepared from TIC by “virtual fractionation”, collecting MS spectra from a certain range of retention time (Figure 10). After MS/MS measurement in each fraction, we manually determined the sequence of the peptides. The obtained sequences were found to be truncated and intact pilosulin-like peptides by comparing with contigs from transcriptome analysis (Table 2 and Table S2). The possibility that pilosulin-like peptides are cleaved in the venom could not be excluded.
Figure 10

LC-ESI-MS (C18 column) profile of O. monticola venom extracts. Reverse-phase HPLC chromatogram pattern at A210 (A), the pattern of total ion current (m/z 100-2000) (B), and MS/MS spectrum (C) of O. monticola crude venom extracts were shown.

A wide pore column (C8 SG300) gave better separation than a reverse-phase C18 column. The molecular masses in the major peak fractions were subjected to electrospray ionization-mass spectrometry (ESI-MS). The observed molecular masses were compared with the theoretical molecular mass of the pilosulin-like peptides predicted by transcriptome analysis (Figure 11). Some of the molecules eluted from the chromatography fractions could be assigned to pilosulin-like peptides 1–6 (Table 3). One major peak (27.4% of the total area) consisted of Om2061 molecule. The observed molecular mass of Om2061 molecule (2061.089) was identical to the theoretical molecular mass of pilosulin-like peptide 1. Two middle peaks (20.85% and 12.94%) consisted of Om6368 and Om4101 molecules, respectively.
Figure 11

LC-ESI-MS (a wide pore C8 column) profile of O. monticola venom extracts. Reverse-phase HPLC chromatogram pattern at A210 (A) and the pattern of total ion current (m/z 100–2000) (B) of O. monticola crude venom extracts were shown.

Table 3

LC-MS peaks and estimates of pilosulin-like peptides (PLPs) based on transcriptome analysis.

PeakIDRetention Time (min)Area (%)Observed Molecular Mass aTranscriptome Analysis Assisted Estimation of Mature Peptides
Possible Amino Acid SequenceMolecular FormulaTheoretical Molecular Mass aDerivative
4Om326410.580.413263.957
5Om411711.040.254117.238
6Om348913.840.463488.881
7bOm422914.45<0.14229.334KIKWGKIFKKGGKLIGKTALEAAANAAASEAISAMASQNEKC188H317N53O55S4229.336PLP3
7aOm310114.45<0.13100.615
8Om410115.0412.944101.244KIKWGKIFKKGGKLIGKTALEAAANAAASEAISAMASQNEC182H305N51O54S4101.241PLP3
9Om370416.514.293704.235IKGKKIMKNMGKAMKIAGKVAKAMAPIVVPLIVSAA-NH2C168H306N46O38S43704.231PLP6
10Om440117.510.264401.364
13Om636823.0720.856367.557
14Om635023.995.276349.589
15Om633224.625.426331.631GVKELFGKAWGLVKKHLPKACGLLGYVKQC300H484N78O68S26331.625PLP4
|
GVKELFGKAWGLVKKHLPKACGLLGYVKQ
16Om336225.377.783361.756GWGSIFKTVGKMIAKAAVKAAPEAISAMASQNEC149H224N40O44S23361.753PLP2
17Om332526.946.973324.856
18Om224727.661.522247.188GILDWGKKVMDWIKDKMGKC103H166N26O26S22247.191PLP1
19bOm211929.26<1.02119.094GILDWGKKVMDWIKDKMGC97H154N24O25S22119.096PLP1
19aOm206129.7627.412061.089GILDWGKKVMDWIKDKM-NH2C95H152N24O23S22061.090PLP1
20Om178232.051.081782.019
21Om181233.620.671812.030
22Om183734.863.651836.995IWGALLGTLIPAITSAIQ-NH2C87H144N20O231837.071PLP5

a monoisotopic mass.

The observed molecular mass of Om4101 (4101.244) was identical to the theoretical molecular mass of pilosulin-like peptide 3. Smaller peaks (7.78%, 6.97%, 5.42%, 5.27%, 4.29%, and 3.65% of the total area) consisted of Om3362, Om3325, Om6332, Om6350, Om3704, and Om1837 molecules, respectively. The observed molecular masses of Om3362 (3361.756), Om6332 (6331.631), Om3704 (3704.235), and Om1837 (1836.995) were nearly identical to the theoretical molecular masses of pilosulin-like peptides 2 (3361.753), 4 (6331.625), 6 (3704.231), and 5 (1837.071), respectively. Comparing the mass profile of O. monticola with that of O. hastatus from a previous study, the proportion of the O. monticola molecules with a mass >5 kDa was higher than that of O. hastatus. We detected the molecules Om6368, Om6350, Om6332 and others in O. monticola venom. We can obtain the preliminary amino acid sequence information from MS/MS analysis and partially correlate the peptidome data with that of the transcriptome. In future research, peptide sequencing by MS/MS with trypsin digestion or Edman degradation will be necessary to confirm all the aforementioned pilosulin-like peptide assignments and to identify those that are as yet unassigned.

3. Conclusions

In this study, we identified 92 toxin-like peptides and proteins from O. monticola using a transcriptomic analysis. In addition, we found intact and truncated pilosulin 1, 2, and 3 by a peptidomic analysis. The primary structures of all toxin-like peptides resemble their orthologs in other ant species. The bioactivities of the peptides and proteins may vary depending on the habitat and environment of ants. Certain toxin-like peptides and proteins in this study were tentatively classified as allergens and their primary bioactivities may be enzymatic, enzyme inhibition, and ion channel blockage. In future studies, we will characterize the biological functions of the toxin-like peptides and proteins in O. monticola.

4. Materials and Methods

4.1. Ants

One O. monticola colony was collected in Musashimurayama, Tokyo, Japan, on 1 July 2016. The species was morphologically identified.

4.2. Transcriptome Analysis

Total RNA was extracted from 115 venom glands with sacs. A cDNA library was prepared using TruSeq Stranded mRNA Library Prep Kit (Illumina, San Diego, CA, USA). The sequencing was performed by Hokkaido System Science (Sapporo, Japan) using HiSeq2500 (Illumina, San Diego, CA, USA) with paired-end reads (100 base pairs). The adapter and low-quality sequences were eliminated from these reads by Cutadapt v. 1.8.1. The de novo assemblies were run with Trinity v. 2.1.1 in DDBJ [26]. Highly homologous and duplicated contigs were integrated by cd-hit-est (parameters: –M 0, –d 0, –c 0.98). A BLASTX search against 551,987 UniProtKB [27] proteins was performed for gene annotation purposes. All input reads were mapped to the contigs and counted by Bowtie 2 to estimate the relative expression levels of the venom gland transcripts.

4.3. Pilosulin-Like Peptide 1 cDNA Cloning and Sequencing

Total RNA isolated from the ants was reverse-transcribed to cDNA and amplified by PCR with Ex Taq (Takara, Otsu, Japan). The oligonucleotide primers used were Pilo U1 (5′-ATGAAACCGTCGGGTATCAC-3′) corresponding to nucleotides (nt) 9–28 and PLP-1as (5′-ATGGTGTGATTGTTTCATCTA-3′) corresponding to nucleotides (nt) 261–281 of pilosulin-like peptide 2 (OM12875_c1_g1_i1). The amplified products corresponding to the original and 5′ side of the cDNAs were cloned into pCR 2.1-TOPO (Thermo Fisher Scientific, Waltham, MA, USA). All inserts were sequenced using a Model 3500 Genetic Analyzer (Thermo Fisher Scientific, Waltham, MA, USA).

4.4. Liquid Chromatography-Mass Spectrometry (LC-MS) Analysis

Twenty O. monticola venom sacs were collected and extracted with 50% acetonitrile containing 0.1% v/v trifluoroacetic acid (50 μL) for 2 h at 4 °C. The extract was passed through a 0.45-μm filter and successively diluted with the extraction solvent to a final concentration of 0.04 sacs/μL. This dilution was used for the LC-MS analysis. The LC conditions were: solvent A, 0.1% v/v aqueous formic acid; solvent B, 0.1% v/v formic acid in acetonitrile; 5–65% linear gradient of solvent B in solvent A at a flow rate of 200 μL/min; column, Capcell Pak C18 UG 120 (1.5 × 150 mm, Shiseido, Tokyo, Japan) and Capcell Pak C8 SG300 (1.5 × 150 mm, Shiseido, Tokyo, Japan); column temperature, 25 °C. The molecular weights of the ant peptides were verified by LTQ Orbitrap XL-ETD (Thermo Fisher Scientific, Waltham, MA, USA). The MS conditions were: ionization, electrospray in positive mode; ion spray voltage, 4.6 kV; capillary temperature, 350 °C; capillary and tube lens voltages, 19 V and 35 V, respectively; detector, an orbitrap at a resolution of 60,000 at m/z 400. The mass spectrometer was calibrated with polytyrosine and the resolution was usually 1–3 ppm after measurement. The mass-to-charge ratios for multiple charged ions were deconvoluted to give molecular masses. Peptide sequences were manually determined from MS/MS spectra and were confirmed by MS-Product in ProteinProspector program [28].
  23 in total

1.  Comparisons of Protein and Peptide Complexity in Poneroid and Formicoid Ant Venoms.

Authors:  Samira R Aili; Axel Touchard; Jennifer M S Koh; Alain Dejean; Jérôme Orivel; Matthew P Padula; Pierre Escoubas; Graham M Nicholson
Journal:  J Proteome Res       Date:  2016-08-02       Impact factor: 4.466

Review 2.  Genomics and evolution of heritable bacterial symbionts.

Authors:  Nancy A Moran; John P McCutcheon; Atsushi Nakabachi
Journal:  Annu Rev Genet       Date:  2008       Impact factor: 16.830

3.  Comparative enzymology of venoms from stinging Hymenoptera.

Authors:  J O Schmidt; M S Blum; W L Overal
Journal:  Toxicon       Date:  1986       Impact factor: 3.033

4.  [Sequence analysis of melittin from tryptic and peptic degradation products].

Authors:  E Habermann; J Jentsch
Journal:  Hoppe Seylers Z Physiol Chem       Date:  1967-01

5.  Isolation, cloning, and characterization of new chitinase stored in active form in chitin-lined venom reservoir.

Authors:  A Krishnan; P N Nair; D Jones
Journal:  J Biol Chem       Date:  1994-08-19       Impact factor: 5.157

6.  Novel mastoparan and protonectin analogs isolated from a solitary wasp, Orancistrocerus drewseni drewseni.

Authors:  Kazuya Murata; Tetsuro Shinada; Yasufumi Ohfune; Miki Hisada; Akikazu Yasuda; Hideo Naoki; Terumi Nakajima
Journal:  Amino Acids       Date:  2008-08-11       Impact factor: 3.520

7.  Proteomic view of the venom from the fire ant Solenopsis invicta Buren.

Authors:  José R A dos Santos Pinto; Eduardo G P Fox; Daniel M Saidemberg; Lucilene D Santos; Anally R da Silva Menegasso; Eliúde Costa-Manso; Ednildo A Machado; Odair C Bueno; Mario S Palma
Journal:  J Proteome Res       Date:  2012-08-22       Impact factor: 4.466

8.  Comparative transcriptome analysis of venom glands from Cotesia vestalis and Diadromus collaris, two endoparasitoids of the host Plutella xylostella.

Authors:  Wei Zhao; Min Shi; Xi-Qian Ye; Fei Li; Xiao-Wei Wang; Xue-Xin Chen
Journal:  Sci Rep       Date:  2017-05-02       Impact factor: 4.379

9.  Transcriptome analysis in venom gland of the predatory giant ant Dinoponera quadriceps: insights into the polypeptide toxin arsenal of hymenopterans.

Authors:  Alba F C Torres; Chen Huang; Cheong-Meng Chong; Siu Wai Leung; Alvaro R B Prieto-da-Silva; Alexandre Havt; Yves P Quinet; Alice M C Martins; Simon M Y Lee; Gandhi Rádis-Baptista
Journal:  PLoS One       Date:  2014-01-31       Impact factor: 3.240

10.  Arthropod venom Hyaluronidases: biochemical properties and potential applications in medicine and biotechnology.

Authors:  Karla C F Bordon; Gisele A Wiezel; Fernanda G Amorim; Eliane C Arantes
Journal:  J Venom Anim Toxins Incl Trop Dis       Date:  2015-10-22
View more
  14 in total

1.  Heterodimeric Insecticidal Peptide Provides New Insights into the Molecular and Functional Diversity of Ant Venoms.

Authors:  Axel Touchard; Helen C Mendel; Isabelle Boulogne; Volker Herzig; Nayara Braga Emidio; Glenn F King; Mathilde Triquigneaux; Lucie Jaquillard; Rémy Beroud; Michel De Waard; Olivier Delalande; Alain Dejean; Markus Muttenthaler; Christophe Duplais
Journal:  ACS Pharmacol Transl Sci       Date:  2020-10-06

2.  A comprehensive portrait of the venom of the giant red bull ant, Myrmecia gulosa, reveals a hyperdiverse hymenopteran toxin gene family.

Authors:  Samuel D Robinson; Alexander Mueller; Daniel Clayton; Hana Starobova; Brett R Hamilton; Richard J Payne; Irina Vetter; Glenn F King; Eivind A B Undheim
Journal:  Sci Adv       Date:  2018-09-12       Impact factor: 14.136

3.  Mass Spectrometry Analysis and Biological Characterization of the Predatory Ant Odontomachus monticola Venom and Venom Sac Components.

Authors:  Naoki Tani; Kohei Kazuma; Yukio Ohtsuka; Yasushi Shigeri; Keiichi Masuko; Katsuhiro Konno; Hidetoshi Inagaki
Journal:  Toxins (Basel)       Date:  2019-01-17       Impact factor: 4.546

4.  Identification and Functional Characterization of a Novel Insecticidal Decapeptide from the Myrmicine Ant Manica rubida.

Authors:  John Heep; Marisa Skaljac; Jens Grotmann; Tobias Kessel; Maximilian Seip; Henrike Schmidtberg; Andreas Vilcinskas
Journal:  Toxins (Basel)       Date:  2019-09-25       Impact factor: 4.546

5.  An Integrated Proteomic and Transcriptomic Analysis Reveals the Venom Complexity of the Bullet Ant Paraponera clavata.

Authors:  Samira R Aili; Axel Touchard; Regan Hayward; Samuel D Robinson; Sandy S Pineda; Hadrien Lalagüe; Irina Vetter; Eivind A B Undheim; R Manjunatha Kini; Pierre Escoubas; Matthew P Padula; Garry S A Myers; Graham M Nicholson
Journal:  Toxins (Basel)       Date:  2020-05-14       Impact factor: 4.546

6.  The Peptide Venom Composition of the Fierce Stinging Ant Tetraponera aethiops (Formicidae: Pseudomyrmecinae).

Authors:  Valentine Barassé; Axel Touchard; Nathan Téné; Maurice Tindo; Martin Kenne; Christophe Klopp; Alain Dejean; Elsa Bonnafé; Michel Treilhou
Journal:  Toxins (Basel)       Date:  2019-12-14       Impact factor: 4.546

Review 7.  Cell-Penetrating Peptides Derived from Animal Venoms and Toxins.

Authors:  Gandhi Rádis-Baptista
Journal:  Toxins (Basel)       Date:  2021-02-15       Impact factor: 4.546

Review 8.  Application of Metabolomic Tools for Studying Low Molecular-Weight Fraction of Animal Venoms and Poisons.

Authors:  Agnieszka Klupczynska; Magdalena Pawlak; Zenon J Kokot; Jan Matysiak
Journal:  Toxins (Basel)       Date:  2018-07-24       Impact factor: 4.546

9.  Transcriptomic and Proteomic Analyses Reveal the Diversity of Venom Components from the Vaejovid Scorpion Serradigitus gertschi.

Authors:  Maria Teresa Romero-Gutiérrez; Carlos Eduardo Santibáñez-López; Juana María Jiménez-Vargas; Cesar Vicente Ferreira Batista; Ernesto Ortiz; Lourival Domingos Possani
Journal:  Toxins (Basel)       Date:  2018-09-05       Impact factor: 4.546

10.  Shedding Lights on Crude Venom from Solitary Foraging Predatory Ant Ectatomma opaciventre: Initial Toxinological Investigation.

Authors:  Lucas Ian Veloso Correia; Fernanda Van Petten de Vasconcelos Azevedo; Fernanda Gobbi Amorim; Sarah Natalie Cirilo Gimenes; Lorena Polloni; Mariana Alves Pereira Zoia; Mônica Soares Costa; Jéssica Peixoto Rodrigues; Kelly A Geraldo Yoneyama; Jean Carlos Santos; Eliane Candiani Arantes; Veridiana de Melo Rodrigues; Luiz Ricardo Goulart; Renata Santos Rodrigues
Journal:  Toxins (Basel)       Date:  2022-01-04       Impact factor: 4.546

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.