Literature DB >> 28955989

De novo protein sequencing, humanization and in vitro effects of an antihuman CD34 mouse monoclonal antibody.

Chia-Yu Fan1,2, Sheng-Yu Huang3, Min-Yuan Chou2, Ping-Chiang Lyu1.   

Abstract

QBEND/10 is a mouse immunoglobulin lambda-chain monoclonal antibody with strict specificity against human hematopoietic progenitor cell antigen CD34. Our in vitro study showed that QBEND/10 impairs the tube formation of human umbilical vein endothelial cells (HUVECs), suggesting that the antibody may be of potential benefit in blocking tumor angiogenesis. We provided a de novo protein sequencing method through tandem mass spectrometry to identify the amino acid sequences in the variable heavy and light chains of QBEND/10. To reduce immunogenicity for clinical applications, QBEND/10 was further humanized using the resurfacing approach. We demonstrate that the de novo sequenced and humanized QBEND/10 retains the biological functions of the parental mouse counterpart, including the binding kinetics to CD34 and blockage of the tube formation of the HUVECs.

Entities:  

Keywords:  Antiangiogenic therapy; CD34; De novo sequencing; Humanization; Monoclonal antibody

Year:  2016        PMID: 28955989      PMCID: PMC5614552          DOI: 10.1016/j.bbrep.2016.11.006

Source DB:  PubMed          Journal:  Biochem Biophys Rep        ISSN: 2405-5808


Introduction

The CD34 protein belongs to the family of single-pass transmembrane sialomucin proteins, with an apparent molecular mass (Mr) of approximately 115 kD [1], [2]. Cells with the CD34 surface protein could be found in the bone marrow, umbilical cord blood and peripheral blood as hematopoietic progenitor cells and vascular endothelial cells [3], [4], [5], [6], [7]. CD34+ hematopoietic cells enriched from bone marrows have traditionally been used clinically in patients after radiation therapy or chemotherapy [8], [9]. In previous studies, it was revealed that CD34−/− mice start to exhibit an abnormal vessel morphology when they are triggered by disease models, such as autoimmune arthritis [10], tumor angiogenesis [11], and oxygen-induced retinopathy [12]. Furthermore, CD34 expressed on human umbilical vascular endothelial cells (HUVECs) show the angiogenic tip cell phenotype [13]. Therefore, anti-CD34 should be considered when developing antiangiogenic therapy. Angiogenesis is a physiological process related to the sprouting and growth of new vessels from an existing vasculature. Angiogenesis is the predominant pathway for neovessel growth in malignancy [14]; therefore, the process is called tumor angiogenesis. In 1971, Folkman first proposed the hypothesis that tumor growth is angiogenesis dependent [15], according to which angiogenesis presents unique opportunities for therapeutic intervention in cancer treatment. During vascular network expansion, sprouting angiogenesis requires a subset of highly specialized endothelial cells, namely tip cells. The tip cells start migrating and existing at the leading front of the growing vessels to guide migration toward a source of angiogenic growth factors, such as vascular endothelial growth factor (VEGF) [16], [17], [18], [19], [20], platelet-derived growth factor [21], placental growth factor [19], [20], [22], fibroblast growth factor-2 [18], [23], interleukin-8 [24], [25], transforming growth factor-beta [26], [27], [28], and angiopoietins [29], [30]. Most monoclonal antibodies (mAbs) originate from mice; therefore, a human antimouse [31] or antichimeric [32] antibody might be evoked when mouse antibodies are applied in human therapy. To circumvent such an adverse immune response, mouse antibodies must be humanized for clinical applications [33]. Antibody humanization involves maintaining the specificity and affinity of the parental nonhuman antibody and designing an antibody molecule to reduce the immunogenicity to the greatest extent possible. QBEND/10 is a mouse mAb against CD34; it reacts with the class II epitope of CD34 [34]. The CliniMACS CD34 reagent system (Miltenyi Biotec, Bergisch Gladbach, Germany) is a clinically approved device for selecting hematopoietic stem cells from donor apheresis. CliniMACS uses mouse QBEND/10 directly conjugated to an iron oxide particle. Notably, in our current in vitro study, mouse QBEND/10 impaired the tube formation of HUVECs. To address the therapeutic potential of QBEND/10, we used de novo protein sequencing and antibody humanization technology as well as analyzed the effects of humanized QBEND/10 on angiogenesis in vitro by inhibiting the tube formation of HUVECs.

Materials and methods

Materials

Mouse QBEND/10 was purchased from AbD Serotec. Ammonium bicarbonate, dithiolthreitol (DTT), iodoacetamide (IAM), formic acid (FA), thermolysin, and subtilisin were purchased from Sigma–Aldrich. Urea and acetonitrile (ACN) were purchased from J.T Baker. Trypsin and chymotrypsin were purchased from Promega. Endoproteinase Glu-C (Glu-C) and peptide N-glycosidase F (PNGase F) were purchased from New England BioLabs and Roche, respectively. Furthermore, 4–12% and 4–20% NuPAGE Bis-Tris polyacrylamide gels were purchased from Invitrogen. Amicon Ultra centrifugal filters (molecular weight cut-off, 100 kDa) were purchased from Millipore.

Enzymatic digestion and deglycosylation of QBEND/10

Mouse QBEND/10 was first processed for detergent removal and buffer exchange into 50 mM ammonium bicarbonate buffer solution by using the centrifugal filters. QBEND/10 was subsequently denatured using 6 M urea, reduced with 10 mM DTT at 37 °C for 1 h and alkylated using 50 mM IAM for 30 min in the dark at room temperature (RT). The resulting protein was individually digested with trypsin, Glu-C, thermolysin, chymotrypsin, and subtilisin at 37 °C for 18 h (protein:enzyme=20:1). One aliquot of the trypsin digest was added to Glu-C for 20-h digestion at 37 °C. Thereafter, PNGase F was added for the deglycosylation reaction. The samples were subsequently diluted and acidified to 0.1% FA for liquid chromatography (LC)–mass spectrometry (MS) analysis.

In-gel tryptic digestion

In a parallel experiment, a mini gel (8 cm×8 cm, 4–20% NuPAGE Bis-Tris polyacrylamide gel) was used for separation through sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), followed by Coomassie Brilliant Blue R-250 staining. Two bands containing proteins with an apparent Mr of approximately 25 and 50 kDa were excised from the gel, washed, in-gel reduced, alkylated, and digested overnight with trypsin.

Liquid chromatography–tandem mass spectrometry analysis

The samples were analyzed with a Q Exactive mass spectrometer (Thermo Scientific) coupled with an Ultimate 3000 RSLC system (Dionex). LC was performed using the C18 column (Acclaim PepMap RSLC; 75 µm×150 mm, 2 µm, 100 Å) with a linear gradient of 1–25% of mobile phase B (mobile phase A: 5% ACN/0.1% FA; mobile phase B: 95% ACN/0.1% FA) for 40 min, 25–60% of mobile phase B for 3 min, and 60–80% of mobile B for 2 min for a total separation time of 70 min. A full MS scan was obtained in the range of m/z 350–2000, and the 10 most intense ions from the scan were subjected to fragmentation for MS/MS spectra. Raw data were processed into peak lists by using Proteome Discoverer 1.3 for a Mascot database search.

Database search and de novo sequencing

A customized database was prepared by collecting the sequences of immunoglobulins (IgGs) from the National Center for Biotechnology Information (NCBI) database. The database was searched using Mascot version 2.4.0. Carbamidomethylation was selected as the fixed modification, and deamidation (NQ), oxidation (M), and pyroglutamate (N-term Q) were included as variable modifications. Up to five missed cleavages were allowed for each enzyme digestion and ±5 ppm and ±0.02 Da were used as the mass tolerance window for parent and fragment ions, respectively. Furthermore, an error-tolerant search was performed, in which all modifications and sequence variations were considered. The MS/MS spectra with high intensities were manually sequenced if they had not been identified using Mascot. A customized computational algorithm was constructed to categorize the observed peptides as a heavy or light chain and then align the peptides into a complete sequence. The results were specified in Mascot as a new database for protein identification and an error-tolerant search. The process was repeated iteratively until the protein sequence with the highest possible score was obtained. All MS/MS spectra in this study were manually validated to assure their quality.

Molecular modeling

Molecular modeling of the variable fragment (Fv) of mouse QBEND/10 was performed using the Prediction of Immunoglobulin Structure (PIGS; http://www.biocomputing.it/pigs) [35], [36] Web server through single sequence submission. The structural model of the mouse QBEND/10 Fv region was generated from the corresponding amino acid sequence by using PIGS with default settings. The most suitable heavy and light chain templates were selected from the 20 templates displayed. The Protein Data Bank (PDB) codes 2GKI_H [37] and 2QHR_L [38], exhibiting 86.67% and 94.92% sequence similarity with mouse QBEND/10 VH and VL, respectively, were used to model the three-dimensional (3D) structure of mouse QBEND/10. For the automated construction of the 3D structure of the Fv region of mouse QBEND/10, a canonical loop grafting approach was used for CDRs L1–L3 and H1–H3. The position of the conserved amino acid side chains was maintained, whereas the nonconserved amino acid side chains were modeled using SCWRL 4.0 [39]. Energy minimization was performed using the Swiss-PdbViewer application [40].

QBEND/10 humanizaiton

Mouse QBEND/10 was humanized using the resurfacing approach [41]. The variable heavy and light (VH and VL, respectively) chains and CDRs were numbered and identified according to the method proposed by Kabat [42]. First, the generated Fv model of mouse QBEND/10 was used to identify surface accessible residues by using Swiss-PdbViewer [40], with the threshold set at 30% [43]. Second, the sequence of mouse QBEND/10 VH and VL chains was searched using NCBI IgBLAST against the human IgG germline database (http://www.ncbi.nlm.nih.gov/igblast/). Human germline V sequences with the highest identity to mouse VH and VL regions were used. The J region for the heavy and light chains was selected from the most identical human consensus sequence. Third, these crucial surface residues of the framework regions were manually exchanged with those from the selected human IgG germline sequence. These side chains were rotated manually to evaluate stable side chain conformation and were subsequently subjected to energy minimization using Swiss-PdbViewer. Finally, the sequence composition for the Fv region of the resurfaced QBEND/10 was assembled. Two resulting models, mouse and humanized QBEND/10, were analyzed, visualized, and superimposed with Swiss-PdbViewer [40]. On the basis of the superimposition result, structural changes in the CDRs were determined.

Recombinant plasmid construction

The DNA sequences of QBEND/10 VH and VL were separately synthesized using GenScript (GenScript USA Inc., Piscataway, NJ, USA). The coding region of the heavy chain is composed of an N-terminal QBEND/10 VH and a C-terminal human IgG1 constant region (CH1, hinge, CH2, and CH3) nucleotide sequence. This synthetic gene was prepared through overlapping polymerase chain reaction (PCR). The PCR product flanked with EcoRV and BamHI sites was cloned into the expression vector pSecTag2/Hygro (Thermo Fisher Scientific, Waltham, MA, USA) at the same sites. The entire heavy chain DNA of QBEND/10 was cloned in-frame with the N-terminal mouse Ig kappa-chain V-J2-C signal peptide of the pSecTag2/Hygro expression vector for secretion. The coding region of the light chain was composed of an N-terminal QBEND/10 VL and C-terminal lambda light chain constant region nucleotide sequence. This synthetic gene was prepared through overlapping PCR. The PCR product was cloned into the expression vector pcDNA3.3–TOPO TA (Thermo Fisher Scientific). The entire VL DNA segment of QBEND/10 was also cloned in-frame with the V-J2-C signal peptide for secretion.

Antibody expression and purification

Recombinant QBEND/10 antibodies were obtained through a stable cotransfection of expression constructs in mouse myeloma NS0 cells (European Collection of Animal Cell Cultures, Wiltshire, UK) by using Effectene (QIAGEN Inc., Valencia, CA, USA) according to the manufacturer's instructions. After selection with 400 μg/mL hygromycin B (Thermo Fisher Scientific) and 800 μg/mL G418 (Thermo Fisher Scientific) for 4 weeks, a stable clone was cultured in a shaker flask at an initial seeding density of 5×10E5 cells/mL in the chemically defined medium HyClone CDM4NS0 (Hyclone, GE Healthcare, South Logan, UT, USA) containing 2% fetal bovine serum (FBS). The culture was maintained at 130 rpm for 5 days at 37 °C. The recombinant antibodies were purified from the supernatant by using a human-IgG affinity column (IgSelect; GE Healthcare).

SDS-PAGE

SDS-PAGE was performed using a 4–12% NuPAGE Bis-Tris polyacrylamide gel with 3-morpholinopropanesulfonic acid (MOPS) as the running buffer (Thermo Fisher Scientific). The proteins were stained with Coomassie brilliant blue R-250.

ELISA

The protein concentrations were estimated using the procedure reported by Bradford [44]. In brief, a Nunc™ MaxiSorp 96-well plate (Thermo Fisher Scientific) was coated with the human CD34 protein (Fc tag; Sino Biological Incorporation, Beijing, China) in a volume of 50 μL at a concentration of 5 µg/mL and incubated at 4 °C for 18 h. After blocking with the StartingBlock™ blocking buffer (Thermo Fisher Scientific) and being washing with PBS containing 0.01% Tween-20 (PBST) three times, the samples were added to the plates and incubated for 1 h at 37 °C. After washing, the plates were incubated with horseradish peroxidase-conjugated antihuman lambda light chain antibody (Bethyl Laboratories, Inc., Montgomery, TX, USA) for 1 h at RT, followed by washing with PBST. 3,3′,5,5′-Tetramethylbenzidine was subsequently added to induce the color reaction. After the reaction was stopped with 1 N HCl, the absorbance was read at 450 nm on a microplate reader; all measurements were performed in duplicate.

Surface plasmon resonance

The binding kinetics of QBEND/10 antibodies to CD34 (Fc tag; Sino Biological Incorporation) were measured using the Biacore system (Biacore X, GE Healthcare) in the running buffer HBS-EP (10 mM HEPES, pH 7.4; 150 mM NaCl; 3 mM EDTA; 0.005% surfactant P20). In brief, CD34 was immobilized onto a CM5 sensor chip through amine coupling to a level of 1200 response units, and purified antibodies of different concentrations were injected at a flow rate of 30 μL/min. The surface was regenerated by injecting 15 μL of 10 mM glycine–HCl, pH 2.5. Sensorgrams were obtained at each concentration and were evaluated using the BIA Evaluation 3.2 program (GE Healthcare). Binding data were fitted with a 2:1 (bivalent) binding model to calculate the affinity constant KD, which was defined as the ratio of the dissociation rate (koff)/association rate (kon).

Cell culture

HUVECs were obtained from the American Type Cell Culture (Manassas, VA, USA). For expansion, the cells were grown in an endothelial cell medium (ECM) supplemented with 5% FBS, 1% endothelial cell growth supplement (ECGS), and 1% penicillin/streptomycin (5% CO2 at 37 °C). ECM, ECGS, and antibiotics were obtained from ScienCell Research Laboratory. HUVECs were used between passage 7 and 9.

Tube formation assay

HUVECs were pretreated with VEGF165 (25 ng/mL, Sigma–Aldrich) in the presence or absence of anti-VEGF IgG (G6-31) [45] in starvation medium (ECM containing 1% FBS) at 37 °C in a humidified atmosphere of 5% CO2 for 24 h. The tube formation assay was performed using growth factor-reduced Matrigel (BD Biosciences) added to 15-well microslides (Ibidi, Germany); the gel was allowed to solidify at 37 °C for 1 h. Subsequently, subconfluent HUVECs were prestained with 10 μg/mL DiIC12(3) fluorescent dye (BD Biosciences) at 37 °C for 1 h and then harvested with trypsin–EDTA. To evaluate the effects of mouse or humanized QBEND/10, HUVECs were resuspended in starvation medium in the presence or absence of QBEND/10 antibodies at various concentrations and then seeded onto the Matrigel layer at a cell density of 8×10E3 cells per well. After 18 h of incubation, tubular network structures were visualized and photographed using an inverted fluorescence microscope. Cell-covered area and junctions were quantified using ImageJ software.

Flow cytometry analysis

HUVECs were harvested with trypsin–EDTA. All immunofluorescent labeling and washing was performed in Stain Buffer (BSA) (BD Biosciences). Cells were incubated with an irrelevant isotype control or the mouse antihuman CD34 antibody (5 µg/mL, QBEND/10) for 1 h at 4 °C. After 3 times washing with cold Stain Buffer, FITC-conjugated goat antimouse IgG (1:100, Jackson ImmunoResearch) were added to the cells for 45 min in the dark at 4 °C, followed by washing. Flow cytometry analysis was performed using a FACSCalibur system (BD Biosciences) in combination with CellQuest software (BD Biosciences).

Results

De novo protein sequencing of variable fragments of mouse QBEND/10

LC–MS/MS-based techniques have emerged as a crucial tool for protein identification [46], [47], [48]. Detailed information on peptide sequences can be obtained by assigning fragment ions provided by MS/MS spectra. At present, Mascot is the most popular search engine, and its probability-based scoring algorithm has been widely used. Higher Mascot scores usually increases the confidence on peptide assignment for de novo sequencing. To achieve greater sequence coverage, in-solution digestion by using several enzymes and in-gel digestion with trypsin for the separated heavy and light chains were performed. LC–MS/MS was used to analyze all the resulting peptides, and peak lists were generated for an iterative database search and an error-tolerant search against customized databases. Only the peptides with high-quality MS/MS spectra (ion score, ≥30) were listed. The theoretical tryptic peptides for the QBEND/10 VL and VH segments are listed in Table 1, Table 2. The base peak intensity chromatograms of the QBEND/10 light and heavy chains digested by trypsin are shown in Fig. 1A and B. Ln and Hn indicate the nth tryptic peptide assigned from the N-terminal of the light and heavy chains, respectively. Each peak was identified and assigned according to the data in Table 1, Table 2. The identification results of the VL and VH segments from multiple enzyme digestion are aligned and shown in Fig. 2A and B.
Table 1

Theoretical peptides of QBEND/10 light chains obtained using trypsin digestion.

Theoretical M.W.Peptide no.Amino acid no.Sequence
1880.9843L11–19QLVLTQSSSASFSLGASAK
1144.5659L220–29LTCTLSSQHR
2003.0516L330–45TFTIEWYQQQPLKPPK
809.4105L446–51YVMELR
146.1055L552–52K
1312.5643L653–65DGSHSTGDGIPDR
969.4152L766–75FSGSSSGADR
2639.3152L876–99YLSISNIQPEDEAIYICGVG NTIK
1330.6557L9100–111EQFVYVFGGGTK
840.5069L10112–119VTVLGQPK
1731.8930L11120–135STPTLTVFPPSSEELK
389.1910L12136–138ENK
2092.1027L13139–158ATLVCLISNFSPSGVTVAWK
1699.8377L14159–175ANGTPITQGVDTSNPTK
446.2125L15176–179EGNK
1824.8617L16180–194FMASSFLHLTSDQWR
2017.8799L17195–212SHNSFTCQVTHEGDTVEK
818.3844L18213–220SLSPAECL
Table 2

Theoretical peptides of QBEND/10 heavy chains obtained using trypsin digestion.

Theoretical M.W.Peptide no.Amino acid no.Sequence
1993.0844H11–19QVQLEQSGPELVKPGASVK
467.1872H220–23MSCK
1757.8777H324–38ASGYTFTSYVIHWVK
2407.1808H439–59QKPGQGLEWLGYTNPYNDVTK
552.2544H560–63YNEK
293.1739H664–65FK
293.1739H766–67FK
734.3810H868–74ATLTSDK
2709.1574H975–98QSTTAYMEFSSLTSEDSAVYYCAR
2639.2366H1099–122YGGLWLYAMDYWGQGTSVTVSSAK
2802.4295H11123–150TTPPSVYPLAPGSAAQTNSMVTLGCLVK
6497.1325H12151–212GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTK
360.2009H13213–215VDK
146.1055H14216–216K
483.3169H15217–220IVPR
2693.3089H16221–245DCGCKPCICTVPEVSSVFIFPPKPK
1099.6488H17246–255DVLTITLTPK
1061.5791H18256–265VTCVVVDISK
2844.2990H19266–289DDPEVQFSWFVDDVEVHTAQTQPR
1156.5149H20290–298EEQFNSTFR
1852.9141H21299–314SVSELPIMHQDWLNGK
422.2165H22315–317EFK
277.1209H23318–319CR
1242.6608H24320–331VNSAAFPAPIEK
447.2693H25332–335TISK
247.1532H26336–337TK
456.2808H27338–341GRPK
1209.6757H28342–352APQVYTIPPPK
605.2843H29353–357EQMAK
261.1325H30358–359DK
3574.6424H31360–389VSLTCMITDFFPEDITVEWQWNAQPAENYK
1964.8826H32390–406NTQPIMDTDGSYFVYSK
600.3595H33407–411LNVQK
2847.2783H34412–436SNWEAGNTFTCSVLHEGLHNHHTEK
811.4188H35437–444SLSHSPGK
Fig. 1

BPI chromatogram of QBEND/10 light (A) and heavy (B) chains obtained using trypsin digestion. Ln and Hn denote the nth peptide counted from the N-terminal of QBEND/10 light and heavy chains, respectively. Stars indicate deamidated peptides. Pyro indicates pyroglutamate at Q, and oxi denotes oxidation at M.

Fig. 2

Multiple enzyme digestion and in-gel digestion sequence alignment for QBEND/10 light (A) and heavy (B) chain variable regions.

BPI chromatogram of QBEND/10 light (A) and heavy (B) chains obtained using trypsin digestion. Ln and Hn denote the nth peptide counted from the N-terminal of QBEND/10 light and heavy chains, respectively. Stars indicate deamidated peptides. Pyro indicates pyroglutamate at Q, and oxi denotes oxidation at M. Multiple enzyme digestion and in-gel digestion sequence alignment for QBEND/10 light (A) and heavy (B) chain variable regions. Theoretical peptides of QBEND/10 light chains obtained using trypsin digestion. Theoretical peptides of QBEND/10 heavy chains obtained using trypsin digestion.

Molecular modeling of QBEND/10

Molecular modeling of mouse QBEND/10 was performed using PIGS [35], [36], as described in Materials and Methods. The final refined 3D structure of the Fv region was viewed using the Swiss-PdbViewer (DeepView) application [40] (Fig. 3). Both VL and VH fragments of mouse QBEND/10 were modeled using the most accurate matches with the highest sequence identities of known templates from different structures. The PDB codes of the templates for mouse QBEND/10 Fv regions are as follows (sequence identity is indicated in parentheses): 2GKI [37] for the heavy chain (86.67%) and 2QHR [38] for the light chain (94.92%); 2QHR for CDR-L1 (75%), CDR-L2 (85.71%), and CDR-L3 (92.31%) and 2GKI for CDR-H1 (90%), CDR-H2 (82.35%), and CDR-H3 (45.45%). All CDRs were modeled on the basis of canonical conformations defined for those particular canonical structure classes.
Fig. 3

Molecular model of the QBEND/10 variable regions. The 3D structure of the mouse QBEND/10 Fv region is generated using the Web-based antibody structure prediction program PIGS. Nine amino acids (in boldface), namely four and five residues in the VH and VL frameworks, respectively, are substituted with human germline residues. The CDR loops are shown in red.

Molecular model of the QBEND/10 variable regions. The 3D structure of the mouse QBEND/10 Fv region is generated using the Web-based antibody structure prediction program PIGS. Nine amino acids (in boldface), namely four and five residues in the VH and VL frameworks, respectively, are substituted with human germline residues. The CDR loops are shown in red.

Humanization of QBEND/10

Through NCBI IgBLAST, the human germline V region from the IGHV1–3*01 and IGLV4–69*01 groups showed the highest identity to mouse QBEND/10 VH (67.3%) and VL (70.1%), respectively. The sequence alignment of the mouse and human templates is shown in Fig. 4A and B. The J regions for the heavy (IGHJ4*01) and light (IGLJ1*01) chains were selected from the most identical human consensus sequences, which showed one mismatched residue each for VH (WGQGTSVTVSS) and VL (FGGGTKVTVLGQP). The QBEND/10 model (Fig. 3) was used to identify surface accessible residues. Twenty-eight amino acids in the VH of QBEND/10 (Fig. 4A) were identified as surface accessible residues. Excluding CDRs, only 4 (Gln5Val, Pro9Ala, Lys73Thr, and Gln74Ser) of the 28 amino acids differed from the human germline sequence and were adapted to the human version. Considering QBEND/10 VL (Fig. 4B), 5 (Ser8Pro, Leu41Glu, Thr54dLys, Asn77Ser, and Gly100Thr) of 35 surface accessible amino acids differed from the human germline and were substituted with their corresponding amino acids. The residue numbers were calculated according to the method stated by Kabat et al. [49].
Fig. 4

Sequence alignment of mouse QBEND/10 with corresponding human germline sequence. The QBEND/10 heavy (A) and light (B) chain variable regions are sequence-aligned to the most homologous human germline genes IGHV1–3*01/J4*01 and IGLV4–69*01/J1*01, respectively. The conserved surface residues are marked with empty boxes, and the nonconserved surface residues are shown as shaded boxes. The CDRs (within brackets) are unchanged.

Sequence alignment of mouse QBEND/10 with corresponding human germline sequence. The QBEND/10 heavy (A) and light (B) chain variable regions are sequence-aligned to the most homologous human germline genes IGHV1–3*01/J4*01 and IGLV4–69*01/J1*01, respectively. The conserved surface residues are marked with empty boxes, and the nonconserved surface residues are shown as shaded boxes. The CDRs (within brackets) are unchanged.

Construction and expression of QBEND/10

In this study, two mammalian expression vectors, pSecTag2/Hygro and pcDNA3.3, were used to express the QBEND/10 IgG molecule as previously described by Chiu et al. [50]. To aid QBEND/10 secretion in culture media, a leader sequence was added upstream of the heavy and light chains, respectively. The amino acid sequences of QBEND/10 VH and VL were cloned in-frame with the human IgG gamma 1 heavy chain and lambda light chain constant regions, respectively. Chimeric and humanized QBEND/10 antibodies were expressed as soluble secretory proteins in mouse myeloma NS0 cells. Each culture medium was purified using IgSelect (GE Healthcare) and analyzed though SDS-PAGE. As shown in Fig. 5, one prominent band of approximately 150 kDa in nonreducing conditions and two clear bands of approximately 50 kDa (heavy chain) and approximately 25 kDa (light chain) in reducing conditions were observed.
Fig. 5

Purification of chimeric and humanized QBEND/10 antibodies. The indicated chimeric QBEND/10 (lanes 1 and 2) and humanized QBEND/10 (lanes 3 and 4) antibodies were stably expressed in the mouse myeloma NS0 cells and purified from culture media by column chromatography. The samples were electrophoresed on a 4–12% NuPAGE Bis-Tris polyacrylamide gel with the MOPS buffer under nonreducing (lanes 1 and 3) and reducing (lanes 2 and 4) conditions. The gel was stained with Coomassie brilliant blue R-250.

Purification of chimeric and humanized QBEND/10 antibodies. The indicated chimeric QBEND/10 (lanes 1 and 2) and humanized QBEND/10 (lanes 3 and 4) antibodies were stably expressed in the mouse myeloma NS0 cells and purified from culture media by column chromatography. The samples were electrophoresed on a 4–12% NuPAGE Bis-Tris polyacrylamide gel with the MOPS buffer under nonreducing (lanes 1 and 3) and reducing (lanes 2 and 4) conditions. The gel was stained with Coomassie brilliant blue R-250.

Antibody binding analysis

The binding affinities of two antibodies, chimeric and humanized QBEND/10, with recombinant CD34 were determined using a surface plasmon resonance biosensor-based assay, and the binding kinetics were determined. The KD of the binding of chimeric QBEND/10 with CD34 was 14.7 nM, whereas that of the humanized QBEND/10 with the CD34 protein was 7.34 nM (Table 3). In both instances, the koff was approximately 2.6×10E4 s−1, whereas the kon increased by two-fold for the humanized QBEND/10 (from 1.78×10E4 M−1 s−1 to 3.66×10E4 M−1 s−1; Table 3). The similar KD values of the chimeric and humanized QBEND/10 indicated that the process of humanization did not alter the binding affinity of CD34.
Table 3

Binding kinetics of chimeric and humanized QBEND/10 to immobilized human CD34 protein.

Antibodykon/104 (M1 s1)koff/104 (s1)KD(nM)
Chimeric QBEND/101.782.6214.7
Humanized QBEND/103.662.687.34
Binding kinetics of chimeric and humanized QBEND/10 to immobilized human CD34 protein.

Effects of various culture conditions on CD34 expression

Previous data have shown that freshly isolated HUVECs are 90–95% CD34+, but CD34 expression is rapidly lost when cells are cultured [13], [51]. In this study, we kept HUVECs in culture (complete ECM) for a period of 7 days without being passaged, the proportion of CD34+ cells strongly increased (39.62%) at passage 8 (Fig. 6A). Furthermore, stimulated the 7-day cultured HUVECs with serum starvation in the absence or presence of VEGF165 (25 ng/mL) for 24 h showed a more increased percentage of CD34+ HUVECs, 44.75% (Fig. 6B) and 60.82% (Fig. 6C), respectively.
Fig. 6

The proportion of CD34HUVECs in different culture conditions. The proportion of CD34+ cells was determined by flow cytometry after 7-day culturing. (A) Cells incubated with complete medium for 24 h. (B) Cells incubated with starvation medium for 24 h. (C) Cells stimulated with VEGF165 in starvation medium for 24 h.

The proportion of CD34HUVECs in different culture conditions. The proportion of CD34+ cells was determined by flow cytometry after 7-day culturing. (A) Cells incubated with complete medium for 24 h. (B) Cells incubated with starvation medium for 24 h. (C) Cells stimulated with VEGF165 in starvation medium for 24 h.

Effects of humanized QBEND/10 on VEGF165-induced tube formation of endothelial cells

The HUVEC tube formation assay is an in vitro angiogenesis assay, which recapitulates some angiogenesis steps and has been used for many years [52], [53]. HUVECs on the Matrigel formed tube-like structures (Fig. 7A). Cell-covered area and the number of junctions were calculated using ImageJ, which directly revealed the ability of the HUVECs to form capillary-like structures. As shown in Fig. 7B and C, VEGF165 promoted tube formation, whereas the humanized QBEND/10 (10 μg/mL) or anti-VEGF IgG (10 μg/mL) significantly inhibited VEGF165-dependent tube formation. These results demonstrated that the humanized QBEND/10 exhibited similar potential as anti-VEGF IgG in inhibiting VEGF165-induced tube formation.
Fig. 7

Effects of the humanized QBEND/10 on VEGF-induced tube formation of human umbilical vascular endothelial cells. (A) Representative fluorescent images showing the inhibitory effect of humanized QBEND/10 on VEGF165-induced HUVEC tube formation. HUVECs were treated with VEGF165 (25 ng/mL) in the presence or absence of humanized QBEND/10 (10 μg/mL) or anti-VEGF IgG (10 μg/mL). (B, C) Capillary tube formation was quantified by counting the cell-covered area and junctions per field from A. One field was examined per well, with five wells per dose per experiment. Each column represents the mean±standard error of the mean. ##P<0.01 and ###P<0.001 compared with the control group; *P<0.05 and **P<0.01 compared with the VEGF165 group.

Effects of the humanized QBEND/10 on VEGF-induced tube formation of human umbilical vascular endothelial cells. (A) Representative fluorescent images showing the inhibitory effect of humanized QBEND/10 on VEGF165-induced HUVEC tube formation. HUVECs were treated with VEGF165 (25 ng/mL) in the presence or absence of humanized QBEND/10 (10 μg/mL) or anti-VEGF IgG (10 μg/mL). (B, C) Capillary tube formation was quantified by counting the cell-covered area and junctions per field from A. One field was examined per well, with five wells per dose per experiment. Each column represents the mean±standard error of the mean. ##P<0.01 and ###P<0.001 compared with the control group; *P<0.05 and **P<0.01 compared with the VEGF165 group.

Discussion

Angiogenesis is a characteristic of cancer and contributes not only to tumor growth but also to tumor cell invasion [54]. Targeting tumor angiogenesis has focused on the VEGF pathway. Bevacizumab, the recombinant humanized VEGF-A-specific mAb, was approved by the U.S. Food and Drug Administration for treating brain, lung, kidney, ovarian, and colon cancers. Anti-VEGF therapy showed significant clinical benefits for treating some cancers but was not as efficacious as expected [55]. Moreover, a recent study focused on the tumor microenvironment as a possible source of resistance to anti-VEGF therapy [56]. The CD34 function in the tumor microenvironment was previously reported [11]. Anti-CD34 should be considered when developing combination therapies to overcome resistance to anti-VEGF therapy. In current study, we showed that QBEND/10 impairs the tube formation of human umbilical vein endothelial cells (HUVECs). Our finding is in accordance with the previous reports of that CD34−/− mice under some circumstances, exhibit an abnormal vessel morphology [10], [11], [12]. Moreover, CD34+ HUVECs have been reported to show the antiangiogenic tip cell phenotype [31]. Therefore, CD34 could be a potential drug target for antiangiogenic therapy. De novo sequencing remains challenging for large proteins such as mAbs, particularly because of its variable region, which cannot be searched in the existing database. In this study, multiple enzyme digestion was performed. Although trypsin provided the highest sequence coverage, the use of other enzymes, including thermolysin and subtilisin, enabled the identification of complementary sequences and confirmation of overlapping sequences. High-resolution MS facilitates obtaining more stringent criteria for database searching, which further increases the reliability of data interpretation. Mouse QBEND/10 has been predominantly used in clinical experiments to isolate human stem cells [57], [58]. It was classified as binding to the class II epitope of CD34 [34]. The recombinant QBEND/10 IgG has not been reported to date. Because the hybridoma cells of QBEND/10 were unavailable, we adopted the de novo protein sequencing approach to determine the amino acid sequences of the VH and VL of QBEND/10 IgG. By combining the de novo MS/MS sequencing and homologous database search, we successfully assembled the mouse mAb QBEND/10. In this study, the PIGS Web server was used for predicting and generating antibody homology models. Mouse QBEND/10 was subsequently humanized through variable domain resurfacing to minimize its immunogenicity. Humanized QBEND/10 can maintain the binding affinity and specificity of parental antibodies as well as impair the tube formation of HUVECs in vitro. Therefore, our humanization approach can provide a basis for developing a mAb for therapeutic use.

Conclusions

In conclusion, we provide a method to resolve the primary structure of the VH and VL of a mouse monoclonal antibody through de novo protein sequencing when hybridoma cells were unavailable. In addition, our humanization approach can conduct a basis for the development of monoclonal antibodies for therapeutic use and the humanized antibody can retain the binding affinity similar to that of the parental antibody.
  55 in total

Review 1.  Antibody humanization: a case of the 'Emperor's new clothes'?

Authors:  M Clark
Journal:  Immunol Today       Date:  2000-08

Review 2.  CD34-positive stem cells: in the treatment of heart and vascular disease in human beings.

Authors:  Alexander R Mackie; Douglas W Losordo
Journal:  Tex Heart Inst J       Date:  2011

3.  Synergism between vascular endothelial growth factor and placental growth factor contributes to angiogenesis and plasma extravasation in pathological conditions.

Authors:  P Carmeliet; L Moons; A Luttun; V Vincenti; V Compernolle; M De Mol; Y Wu; F Bono; L Devy; H Beck; D Scholz; T Acker; T DiPalma; M Dewerchin; A Noel; I Stalmans; A Barra; S Blacher; T VandenDriessche; A Ponten; U Eriksson; K H Plate; J M Foidart; W Schaper; D S Charnock-Jones; D J Hicklin; J M Herbert; D Collen; M G Persico
Journal:  Nat Med       Date:  2001-05       Impact factor: 53.440

4.  PIGS: automatic prediction of antibody structures.

Authors:  Paolo Marcatili; Alessandra Rosi; Anna Tramontano
Journal:  Bioinformatics       Date:  2008-07-19       Impact factor: 6.937

Review 5.  Transforming growth factor-beta: vasculogenesis, angiogenesis, and vessel wall integrity.

Authors:  M S Pepper
Journal:  Cytokine Growth Factor Rev       Date:  1997-03       Impact factor: 7.638

6.  Monoclonal antibody 12-8 recognizes a 115-kd molecule present on both unipotent and multipotent hematopoietic colony-forming cells and their precursors.

Authors:  R G Andrews; J W Singer; I D Bernstein
Journal:  Blood       Date:  1986-03       Impact factor: 22.113

Review 7.  The role of interleukin-8 and its receptors in gliomagenesis and tumoral angiogenesis.

Authors:  Daniel J Brat; Anita C Bellail; Erwin G Van Meir
Journal:  Neuro Oncol       Date:  2005-04       Impact factor: 12.300

Review 8.  New model of tumor angiogenesis: dynamic balance between vessel regression and growth mediated by angiopoietins and VEGF.

Authors:  J Holash; S J Wiegand; G D Yancopoulos
Journal:  Oncogene       Date:  1999-09-20       Impact factor: 9.867

9.  Isolation and characterization of CD34+ hematopoietic stem cells from human peripheral blood by high-gradient magnetic cell sorting.

Authors:  K Kato; A Radbruch
Journal:  Cytometry       Date:  1993

10.  Interleukin-8 as a macrophage-derived mediator of angiogenesis.

Authors:  A E Koch; P J Polverini; S L Kunkel; L A Harlow; L A DiPietro; V M Elner; S G Elner; R M Strieter
Journal:  Science       Date:  1992-12-11       Impact factor: 47.728

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.