Literature DB >> 28742068

A peptide-based viral inactivator inhibits Zika virus infection in pregnant mice and fetuses.

Yufeng Yu1, Yong-Qiang Deng2, Peng Zou1, Qian Wang1, Yanyan Dai1, Fei Yu1, Lanying Du3, Na-Na Zhang2, Min Tian4, Jia-Nan Hao2, Yu Meng1, Yuan Li1, Xiaohui Zhou1, Jasper Fuk-Woo Chan5, Kwok-Yung Yuen5, Cheng-Feng Qin2, Shibo Jiang1,3, Lu Lu1.   

Abstract

Zika virus (ZIKV), a re-emerging flavivirus associated with neurological disorders, has spread rapidly to more than 70 countries and territories. However, no specific vaccines or antiviral drugs are currently available to prevent or treat ZIKV infection. Here we report that a synthetic peptide derived from the stem region of ZIKV envelope protein, designated Z2, potently inhibits infection of ZIKV and other flaviviruses in vitro. We show that Z2 interacts with ZIKV surface protein and disrupts the integrity of the viral membrane. Z2 can penetrate the placental barrier to enter fetal tissues and is safe for use in pregnant mice. Intraperitoneal administration of Z2 inhibits vertical transmission of ZIKV in pregnant C57BL/6 mice and protects type I or type I/II interferon receptor-deficient mice against lethal ZIKV challenge. Thus, Z2 has potential to be further developed as an antiviral treatment against ZIKV infection in high-risk populations, particularly pregnant women.

Entities:  

Mesh:

Substances:

Year:  2017        PMID: 28742068      PMCID: PMC5537589          DOI: 10.1038/ncomms15672

Source DB:  PubMed          Journal:  Nat Commun        ISSN: 2041-1723            Impact factor:   14.919


Zika virus (ZIKV), a re-emerging mosquito-borne flavivirus, is an enveloped, positive single-stranded RNA virus12. As of 20 October 2016, 73 countries and territories had reported continuing vector-borne transmission of ZIKV (http://www.who.int/emergencies/zika-virus/en). In addition to Africa and Asia-Pacific regions, the Americas, particularly South America, are areas at risk for ZIKV transmission3. It is concerning that ZIKV infection can cause severe congenital brain developmental abnormalities, including microcephaly456, and that it is a trigger of Guillain–Barré syndrome78. Currently, no specific anti-ZIKV therapeutic or vaccine is available, thus calling for the development of effective and safe antiviral drugs and vaccines for worldwide treatment and prevention of ZIKV infection. Some small-molecule compounds, such as 7-Deaza-2′-C-Methyladenosine9, 2′-C-methylated nucleosides10 and (−)-epigallocatechin gallate11, as well as some US Food and Drug Administration-approved drugs used in clinics for other purposes, such as PHA-690509, niclosamide, bortezomib, mycophenolic acid, mefloquine, daptomycin and bromocriptine121314, were found to inhibit ZIKV infection. However, the safety of small-molecule drugs for pregnant women requires more extensive evaluation. 2A10G6, a murine antibody, with broad flavivirus-neutralizing activity by targeting the ZIKV envelope (E) protein could neutralize ZIKV infection in vitro and in vivo15. However, its relatively low efficacy and requirement for humanization are main obstacles to its further development. ZIKV-117, a human monoclonal antibody (mAb), can broadly neutralize infection of ZIKV strains16. However, the high cost may limit its application in developing countries, such as Brazil. In recent years, development of peptide drugs has attracted growing attention because of their better safety and lower development cost compared to small-molecule- and antibody-based antiviral drugs. We previously identified the first highly potent anti-HIV C-peptide, SJ-2176 (refs 17, 18) and the patent was licensed to Trimeris Pharmaceutical Inc. for development of the first HIV fusion inhibitor, enfuvirtide, which was approved by the US Food and Drug Administration in 2003 for the treatment of HIV infection1920. Furthermore, the use of enfuvirtide, either alone or combined with other antiretroviral drugs, could successfully prevent mother-to-child HIV transmission during pregnancy212223, indicating that antimicrobial peptides could be developed as safe and effective antiviral therapeutics and/or prophylactics. Therefore, we aimed to design and identify an effective anti-ZIKV peptide. A flavivirion contains 180 copies of E protein and membrane (M) protein forming 90 E dimers, which completely cover the viral surface24. When fusion of viral envelope with host cell membrane occurs in low pH, the conformation of E protein changes from dimeric to trimeric25. The stem region in the E protein proximal to the virus membrane then changes conformation from α-helix to random coil, driving the viral transmembrane anchor towards the fusion loop and stabilizing the trimeric structure of E protein2627. It has been reported that the peptides derived from the stem region of dengue virus (DENV) could effectively inhibit fusion of DENV with the host cell or induce hole formation in viral membrane, resulting in the release of viral RNA genome272829, suggesting that the stem region can also serve as an important target for the development of anti-ZIKV drugs. In the present study, we designed and synthesized a peptide derived from the conserved stem region of ZIKV E protein, designated Z2, and found that Z2 inhibits ZIKV infection in vitro and in vivo through inactivating ZIKV virions. We demonstrated that Z2 is able to penetrate the placental barrier to block vertical transmission of ZIKV from pregnant mice to their fetuses. These results suggest that Z2 could be further developed as a safe and effective peptide therapeutic and prophylactic for the treatment and prevention of ZIKV infection in high-risk populations, especially in pregnant women.

Results

Rational design of anti-ZIKV peptide Z2

First, we aligned the amino-acid sequence of ZIKV E protein with that of the corresponding fragment in the stem region of DENV E protein, which represents the basis for the design of anti-DENV peptides272829. We next aligned these sequences with those in the E proteins of other flaviviruses, including Japanese encephalitis virus, yellow fever virus (YFV) and West Nile virus. We found that the sequence in this region is highly conserved among flaviviruses with amino-acid sequence conservation of 64 to 82% (Fig. 1a and Supplementary Fig. 1), implying that this region may play important roles in flavivirus infection. Finally, we located this region in the 3.8 Å resolution cryo-electron microscope structure of ZIKV (Protein Data Bank: 5IRE)30, as shown in pink in Fig. 1b, and it was confirmed as the membrane-proximal stem region of ZIKV E protein (residues 421–453), and this was then used as the basis for the design and synthesis of peptide Z2 and the scrambled peptide of Z2 (Z2-scr).
Figure 1

Design of peptide inhibitor Z2.

(a) Sequence alignment of stem regions from E protein of flaviviruses. JEV, Japanese encephalitis virus; WNV, West Nile virus. The % amino-acid conservation (%AA cons.) from stem region of ZIKV is shown. (b) Sequence and location of Z2 in the stem region of ZIKV E protein. The structure of E protein was generated by SWISS-MODEL software based on the 3.8 Å resolution cryo-electron microscope structure of ZIKV (Protein Data Bank: 5IRE)30. Red, domain I of ZIKV E protein; yellow, domain II; cyan, domain III; pink, peptide Z2; purple, viral membrane. Z2-scr, scrambled peptide of Z2.

Z2 inhibited ZIKV infection at early viral replication stage

To determine the antiviral activity of Z2 against ZIKV infection in BHK21 and Vero cells, we developed a rapid and sensitive colorimetric viral infection assay using Cell Counting Kit-8 (CCK8, Dojindo, Japan)313233. It was reported that ZIKV infection of these cells resulted in obvious cytopathic effects (CPE)34. Using this assay, we tested the inhibitory activity of Z2 at different concentrations on infection of ZIKV strain SZ01. We found that Z2 inhibited ZIKV infection in a dose-dependent manner with a 50% inhibitory concentration (IC50) value of 1.75±0.13 μM (mean±s.d., n=3) in BHK21 cells (Fig. 2a) and 3.69±0.27 μM (n=3) in Vero cells (Fig. 2b), while Z2-scr as a negative control showed no significant inhibition on ZIKV infection. We also used the plaque reduction assay and BHK21 cells to test anti-ZIKV activity. As shown in Supplementary Fig. 2, the IC50 value is 2.61±0.46 μM (n=3), suggesting that the result derived from the plaque reduction assay is consistent with that obtained from colorimetric CCK8 assay. The ZIKV-induced CPE in BHK21 and Vero cells were visibly reduced by Z2 at 5 μM, while Z2-scr at the same concentration exhibited no inhibitory activity (Fig. 2c). In line with the data from CCK8 assay, the result from immunofluorescence staining showed that Z2 at a concentration of 10 μM almost completely blocked ZIKV E protein expression in BHK21 and Vero cells (Fig. 2d). We then evaluated the antiviral activity of Z2 against other ZIKV strains. As shown in Table 1, Z2 was also effective in inhibiting infection of ZIKV strains FLR and MR766 in BHK21 cells with IC50 values of about 4 and 14 μM, respectively, suggesting that Z2 possesses broad inhibitory activity against ZIKV strains isolated from patients or rhesus monkeys in different regions of the world.
Figure 2

Antiviral activity of Z2 in vitro.

(a) Dose-dependent inhibition of ZIKV infection by Z2 in BHK21 cells. (b) Dose-dependent inhibition of ZIKV infection by Z2 in Vero cells. (c) Reduction of ZIKV-induced CPE in BHK21 and Vero cells by Z2. Scale bar, 20 μm. (d) Immunofluorescence assay to confirm the antiviral activity of Z2 against ZIKV. ZIKV E protein stained by the anti-E mAb 4G2 (green); nuclei stained by 4,6-diamidino-2-phenylindole (blue). Scale bar, 100 μm. (e) Inhibition of DENV-2 and YFV 17D in BHK21 cells by Z2. (f) Inhibition of pseudotyped VSV and MERS-CoV in Huh7 cells by Z2. Data are means±s.d. of triplicate experiments.

Table 1

Inhibition of ZIKV infection by Z2.

ZIKV strainIsolated fromSite of isolationYear of isolationIC50, μM mean±s.d. (n=3)
SZ01ZIKV-infected patientChina20161.75±0.13
FLRZIKV-infected patientColombia20154.04±1.87
MR766ZIKV-infected rhesus monkeyUganda194713.91±0.33

BHK21 cells were used to test the inhibitory activity of Z2 on ZIKV infection. IC50 values were calculated by Graphpad Prism 5.0 software (log(inhibitor) versus response or normalized response–variable slope).

Results of the time-of-addition experiment (Supplementary Fig. 3) showed that Z2 inhibited ZIKV infection as early as 2 h post infection, indicating that Z2 may inhibit infection of ZIKV before its entry into the target cell. Following this, we investigated whether Z2 could also inhibit infection by other mosquito-borne flaviviruses, such as DENV and YFV. We found that Z2 was also highly effective in inhibiting infection by DENV-2 and YFV 17D (Fig. 2e) with IC50 values of about 4 and 5 μM, respectively, while it had no inhibition on infection by pseudotyped vesicular stomatitis virus (VSV) and Middle East Respiratory Syndrome Coronavirus (Fig. 2f). These results suggest that Z2 may have inhibitory activity against infection of a broad spectrum of flaviviruses.

Z2 bound to E protein and inactivated ZIKV virions

It was reported that DN59, a peptide derived from the stem region of the DENV E protein, could inhibit flavivirus infection by interacting with virus particles and inducing formation of pores in viral envelope membrane, resulting in the release of viral RNA genome28. Using similar approaches, we investigated whether Z2 could interact with ZIKV E protein and induce the release of RNA genome from ZIKV virions. First, we used an immunofluorescence staining assay to show that 293T cells transfected by pcDNA3.1-Env could be bound by 4G2, a mouse mAb against E protein of pan-flaviviruses35. Meanwhile, the 293T cells transfected by the empty vector pcDNA3.1 showed no binding, suggesting that ZIKV E protein did express on the 293T cells transfected with pcDNA3.1-Env (Fig. 3a). Using a flow cytometric analysis, we demonstrated that the 293T cells transfected with pcDNA3.1-Env could be stained by Z2-Cy5, whereas the 293T cells expressing no E protein showed only background staining (Fig. 3b). Similar results were obtained from experiment using ZIKV-infected BHK21 cells (Supplementary Fig. 4). These results indicate that Z2 is able to interact with E protein of ZIKV.
Figure 3

Inactivation of ZIKV by Z2.

(a) Immunofluorescence staining the ZIKV E protein expressed on 293T cells by the anti-E mAb 4G2 (green). Nuclei stained by 4,6-diamidino-2-phenylindole (blue). Scale bar, 100 μm. (b) Determination of the binding of Z2 with E protein expressed on 293T cells by flow cytometry. (c) Degradation of released genomic RNA of ZIKV mediated by Z2 in an RNase digestion assay. The primers were used to detect RNA sequences in viral genome coding PrM, E protein and Cap protein, respectively. (d) Degradation of released genomic RNA of ZIKV mediated by Z2-scr. (e) The separation of genomic RNA and E protein of ZIKV treated with Z2, Z2-scr, DMSO or Triton X-100 through a sucrose density gradient assay. Per cent of total E protein in each fraction was assessed by western blot and analysed by Image J software. Per cent of total RNA genome in each fraction was measured by RT–qPCR. (f) Inactivation of ZIKV by Z2. After incubation at room temperature for 2 h, ZIKV was separated from Z2 by PEG-8000 for the measurement of the residual infectivity. Data are means±s.d. of triplicate experiments.

Next, we measured the potential release of viral genomic RNA from ZIKV using an RNase digestion assay28. As shown in Fig. 3c,d, the genomic RNA of untreated virions (0 μM Z2) or treated by Z2-scr were protected from digestion of micrococcal nuclease. However, the genomic RNA of Z2 treated virions was digested by micrococcal nuclease in a dose-responsive manner. About 70% genomic RNA of ZIKV virions treated with 50 μM Z2 was digested by micrococcal nuclease. To further confirm the release of viral genomic RNA, ZIKV virions treated with 1% dimethylsulfoxide (DMSO), 100 μM Z2 or Z2-scr in 1% DMSO, and 1% Triton X-100, respectively, was centrifuged through a sucrose density gradient as previously described28. Then the amount of genomic RNA and E protein of ZIKV in each fraction was monitored by reverse-transcription quantitative PCR (RT–qPCR) and western blot (Supplementary Figs 5 and 6), respectively, and the data of western blot was further analysed by Image J software. As shown in Fig. 3e, the genomic RNA and E protein of virions treated by 1% DMSO or Z2-scr migrated to the same fractions. For example, the peaks of both genomic RNA and E protein were located at fraction No. 6, suggesting that virions treated by 1% DMSO or Z2-scr maintained intact. However, the genomic RNA and E protein of virions treated by 1% Triton X-100 migrated to different fractions, that is, peaks of genomic RNA and E protein were in fraction No. 1 and 7, respectively, indicating that virions were completely destroyed by Triton X-100. Interestingly, the peaks of genomic RNA and E protein of virions treated with Z2 were located in fraction No. 6 and 3, respectively. These results indicate that Z2 treatment may cause pore formation in the viral membrane, resulting in the release of viral genomic RNA through the pores. Next, we determined whether the virions treated with Z2 peptide were inactivated. After incubation of ZIKV with Z2 or Z2-scr at room temperature for 2 h, we separated the treated ZIKV virions from the unbound free peptide with PEG-8000, as previously described36 and assessed their infectivity. As shown in Fig. 3f, ZIKV virions treated with Z2 lost infectivity in a dose-dependent manner with 50% effective concentration of 2.52±0.18 μM (n=3), while ZIKV treated with Z2-scr at concentration as high as 50 μM retained 90% infectivity (Fig. 3f), suggesting that Z2-treated ZIKV virions had been inactivated. Importantly, although Z2 could disrupt the integrity of ZIKV membranes, it showed no cytotoxic effect on cell lines (BHK21, Vero and Huh7) tested at concentration as high as 50 μM (Supplementary Fig. 7). Z2 also showed no cytotoxic effect on red blood cells isolated from mouse peripheral blood at concentration as high as 100 μM (Supplementary Fig. 8).

Z2 could cross placental barrier of pregnant ICR mice

ZIKV can cross the placental barrier and infect the fetus during pregnancy, causing an abnormal growth of the brain and head of the fetus537. Therefore, an effective anti-ZIKV drug should have the ability to penetrate through the placental barrier of the infected pregnant women to protect the fetus. Here we investigate whether Z2 can enter into the pregnant mouse’s organs, and penetrate through its placenta to enter into the fetus’ body. As shown in Fig. 4a and Supplementary Fig. 9a,b, the fluorescent signals of Z2-Cy5 were shown at the sites where the liver and bladder were located and the dissected organs, such as liver, kidney, spleen and heart, suggesting that Z2 is able to enter into blood circulation and organs of pregnant mice. The average radiant efficiency (p s−1 cm−2 sr−1)(μW−1 cm2) in the liver (P=0.0275, Student’s two-tailed t-test) and bladder (P=0.0426, Student’s two-tailed t test) of the Z2-treated mice was significantly higher than that in the phosphate-buffered saline (PBS)-treated mice (Fig. 4b). Then the uteruses of the pregnant mice and the fetuses in their uteruses were removed out for evaluating the distribution of Z2-Cy5. As speculated, the signal of Z2-Cy5 was seen in the uteruses (Fig. 4c) and the fetuses (Fig. 4d and Supplementary Fig. 9c). The average radiant efficiency in uteruses (P=0.0148, Student’s two-tailed t-test) and fetuses (P<0.0001, Student’s two-tailed t-test) from the Z2-Cy5 group was significantly higher than that from PBS group (Fig. 4e). In corroboration with the data in Supplementary Fig. 10, these results suggest that Z2 peptide injected intravenously or intraperitoneally (i.p.) can penetrate through the placental barrier of pregnant ICR mice and enter into the bodies of fetuses.
Figure 4

Ability of Z2 to penetrate the placental barrier of pregnant ICR mice.

(a) Imaging of pregnant ICR mice treated with Z2-Cy5 or PBS by the IVIS Lumina K Series III from PerkinElmer. Mice were injected intravenously with 100 μg Z2-Cy5 (n=3) or PBS (n=3) as control (for background fluorescence measurement), followed by imaging analysis. (b) The statistical analysis of results from Fig. 4a. (c) Imaging of the uteruses from pregnant mice. (d) Imaging of the fetuses (n=9) from uteruses. (e) The statistical analysis of results from Fig. 4c,d. Data are means±s.d., *P<0.05; ***P<0.001, Student’s two-tailed t-test.

Z2 is safe for pregnant ICR mice and their fetuses

ZIKV usually causes mild symptoms, such as fever and rash, but when it infects pregnant women, it can cause congenital brain development abnormalities to fetus638. Therefore, the safety of an anti-ZIKV agent for pregnant women should be taken into consideration. Accordingly, we assessed the safety of Z2 in pregnant ICR mice. The results showed that body weight changes of mothers (Fig. 5a) and pups (Fig. 5b) were almost the same among the six groups (intravenous injection of Z2 at 10, 20, 40, 80 and 120 mg kg−1, respectively, or PBS), suggesting that injection of Z2 does not cause visible damage to prenatal and postpartum health of the pregnant mice, nor does it interfere with the normal growth of pups. We did not find any pups with abnormal behaviour.
Figure 5

Safety analysis of Z2 for pregnant ICR mice and fetuses.

(a) Body weight changes of mothers at different prenatal and postnatal time points. Thirty-one pregnant ICR mice (E12–14) were assigned randomly to six groups and were injected intravenously with PBS (n=5), or PBS containing Z2 at escalating dose (10 mg kg−1, n=5; 20 mg kg−1, n=6; 40 mg kg−1, n=5; 80 mg kg−1, n=5; 120 mg kg−1, n=5) every day for 3 consecutive days. Data are means±s.d. (b) Body weight changes of pups at various postnatal time points. The average litter size of the offspring of PBS-treated pregnant mice was 10.4±1.5, while that of the pregnant mice treated with Z2 at dose of 10, 20, 40, 80 and 120 mg kg−1 was 10.2±1.6, 10.5±2.0, 10.4±2.1, 10.6±1.1 and 10.8±2.6, respectively. The same legend was used for Fig. 5a,b. Data are means±s.d. (c) The ALT in the sera of the pregnant mice measured by the ALT assay kit (NJJCBIO) before the first injection and 4 h, 1, 3 and 5 days after the third injection of Z2. All error bars reflect s.d. (d) The creatinine in the sera of the pregnant mice measured by the creatinine assay kit (NJJCBIO). All error bars reflect s.d. (e) Comparison of haematoxylin and eosin staining of tissues, including livers, kidneys, brains and spleens from mothers and pups in each group. Scale bar, 50 μm.

The levels of alanine aminotransferase (ALT; Fig. 5c) and creatinine (Fig. 5d) in the sera of mice in Z2- and PBS-treated groups showed no significant difference (P>0.05, Mann–Whitney test) at all time points, suggesting that injection of Z2 at high or low doses does not affect the hepatic and renal function of pregnant mice. Using enzyme-linked immunosorbent assay, we measured Z2-specific antibodies in sera of pregnant mice at 1 or 2 weeks after the third injection of Z2 or PBS, and found that Z2-specific antibodies in both Z2- and PBS-treated mice were at a level below detection (Supplementary Fig. 11). This result suggests that Z2 has poor immunogenicity. We then compared the potential histopathological changes of mothers and pups among the six groups. As shown in Fig. 5e, the haematoxylin-and-eosin-stained sections of livers, kidneys, brains and spleens from mice treated with Z2 at different doses exhibited no pathological abnormality, when compared with those from mice treated by PBS. None of these samples showed evidence of cell degeneration, necrosis or infiltration of inflammatory factors. Overall, Z2 is safe for pregnant ICR mice and fetuses, even at the dose as high as 120 mg kg−1 of body weight, which is 11-fold higher than that providing protection against ZIKV infection in vivo.

Z2 blocked vertical transmission of ZIKV in pregnant mice

To determine whether Z2 could protect against vertical transmission of ZIKV, pregnant C57BL/6 mice were infected by ZIKV as described previously39 and were then treated with Z2 at 10 mg kg−1 of body weight (n=12) or vehicle control (n=12). The results showed that Z2 treatment could reduce viraemia in ZIKV-infected pregnant C57BL/6 mice (P=0.0141, Mann–Whitney test; Fig. 6a). At the same time, viral RNA load in placentas from Z2-treated pregnant mice was significantly lower than that from vehicle-treated mice (P=0.0029, Mann–Whitney test), and the infection rate decreased from 18/24 to 12/24 (Fig. 6b). Interestingly, Z2 treatment resulted in the decrease of infection rate of fetal head from 14/24 to 2/24 (P=0.0001, Mann–Whitney test; Fig. 6c). These results suggest that Z2 may inactivate ZIKV virions either before or after the virions have penetrated the placenta to fetus, thus reducing the infection rate of fetuses, as well as protecting against vertical transmission of ZIKV in pregnant mice.
Figure 6

Protection against vertical transmission of ZIKV in Z2-treated pregnant C57BL/6 mice.

(a) Viraemia of pregnant C57BL/6 mice. Pregnant C57BL/6 mice were infected by ZIKV for 1 h and treated with Z2 or vehicle as control. At day 1 post infection, sera were collected by retro-orbital bleeding for viraemia detection. (b) Viral RNA load in placentas. Two embryos of each pregnant mouse were randomly collected and the viral RNA load in each placenta was determined by RT–qPCR. (c) Viral RNA load in fetal heads. The viral RNA load in fetal head of each collected embryo was determined by RT–qPCR. All bars reflect median values, *P<0.05; **P<0.01; ***P<0.001, Mann–Whitney test.

Z2 protected A129 or AG6 mice from lethal ZIKV challenge

Finally, the antiviral efficacy of Z2 was confirmed in the recently established A129 (type I interferon receptor-deficient)15 or AG6 (type I/II interferon receptor-deficient)4041 mouse model for ZIKV infection. One hour after the inoculation with ZIKV i.p., A129 mice were treated with Z2 or vehicle. As shown in Fig. 7a, all the mice treated with vehicle developed neurological symptoms from 5 days post inoculation and finally displayed a 100% mortality rate at 13 days post inoculation. In contrast, treatment with Z2 protected 75% of the A129 mice from death caused by ZIKV infection, and the survivors had no neurological symptoms. Z2 treatment also significantly prolonged mean survival time (MST) from 9 days to the end of the experiment (P=0.0010, log-rank (Mantel Cox) test). The viral load in Z2-treated A129 mice at 2 days post infection (d.p.i.) was about 7-fold lower than that of vehicle-treated mice (P=0.0002, Mann–Whitney test; Fig. 7b). Similarly, treatment with Z2 protected 67% of AG6 mice from death caused by subcutaneous administration of ZIKV and significantly prolonged MST from 10 days to the end of the experiment (P=0.0048, log-rank (Mantel Cox) test; Fig. 7c). The viral load in Z2-treated AG6 mice at 2 d.p.i. was about 13-fold lower than that of vehicle-treated mice (P=0.0022, Mann–Whitney test; Fig. 7d).
Figure 7

Protective activity of Z2 against ZIKV infection in lethal mouse models.

(a) Survival of ZIKV-infected A129 mice. A129 mice (4 weeks old) were infected with 1 × 105 p.f.u. of ZIKV through the intraperitoneal injection route. After 1 h, mice were treated with Z2 (n=8) at 10 mg kg−1 of body weight, and vehicle (n=8) as control. Mouse survival was observed and recorded daily until 21 d.p.i. **P<0.01, log-rank (Mantel Cox) test. (b) Viral RNA load in sera of ZIKV-infected A129 mice. At day 2 post infection, mice were retro-orbitally bled to measure viral RNA load in sera by RT–qPCR. ***P<0.001, Mann–Whitney test. (c) Survival of ZIKV-infected AG6 mice. AG6 mice (6 weeks old) were infected with 1 × 103 p.f.u. of ZIKV via a subcutaneous route in the footpad. After 1 h, mice were treated with Z2 (n=6) at 10 mg kg−1 of body weight, and vehicle (n=6) as control. Mouse survival was observed daily and recorded until 21 d.p.i. **P<0.01, log-rank (Mantel Cox) test. (d) Viral RNA load in sera of ZIKV-infected AG6 mice. At day 2 post infection, mice were retro-orbitally bled to measure viral RNA load in sera by RT–qPCR. Whiskers: 5–95 percentile. **P<0.01, Mann–Whitney test.

Twenty-four hours after inoculation with ZIKV, treatment with Z2 still could protect 33.3% of A129 mice from death (P=0.0139, log-rank (Mantel Cox) test; Supplementary Fig. 12a). Viral load in the Z2-treated A129 mice at 3 d.p.i. was about 4-fold lower than that of the vehicle-treated mice (P=0.0043, Mann–Whitney test; Supplementary Fig. 12b). Although Z2 inactivates ZIKV at the early stage of viral replication, consecutive Z2 injection after ZIKV penetration of cells could still provide some protection of the infected A129 mice, possibly by inactivating newly produced ZIKV virions and prevent their infection of more target cells.

Discussion

It has been reported that peptides derived from the stem region of DENV E protein inhibit the infection of DENV type 1–4 and some other flaviviruses, including Russian spring summer encephalitis virus, Central European encephalitis virus and West Nile virus27282942. However, to the best of our knowledge, none of these peptides has been reported to be effective against ZIKV infection in vitro and in vivo, or be further developed in preclinical and clinical studies. Here we showed that peptide Z2 derived from the stem region of ZIKV E protein is highly effective in inhibiting in vitro infection of ZIKV, both in BHK21 and Vero cells, and other flaviviruses, such as DENV-2 and YFV 17D. Most importantly, intraperitoneal administration of Z2 protected pregnant C57BL/6 mice against vertical transmission of ZIKV and protected A129 or AG6 mice, which are very susceptible to ZIKV infection, against lethal ZIKV challenge. The mechanism by which a peptide derived from the stem region of a flavivirus can inhibit infection by a broad spectrum of flaviviruses remains a point of controversy. It was reported that DN59, a 33-mer peptide that mimics a fragment of stem region of DENV E protein, acts like a disrupter of the DENV membrane, possibly inducing hole formation, leading to release of the viral genome28. Similarly, we found that Z2 peptide could bind to the E protein of ZIKV and disrupt the integrity of ZIKV membrane, resulting in the inactivation of virions. However, no detailed molecular mechanism or signalling pathway has so far been elucidated that would explain how Z2 binds E protein and disrupts the viral cell membrane. Electrostatic and hydrophobic interactions4344 or viral capsid dynamic studies4546 may explain the possible mechanism, but this investigation is beyond the scope of the present paper. Interestingly, Z2 can disrupt flavivirus membranes, but has no effect on the integrity of pseudotyped VSV and MERS-CoV membranes and cell membranes, possibly because the lipid composition, protein components, charge and hydrophobicity among these membranes are different4344, especially for the flavivirus membranes, which are derived from internal endoplasmic reticulum membranes of infected cells. Nevertheless, we cannot exclude other putative mechanisms of action involved in the anti-ZIKV activity of Z2, such as inhibition of membrane fusion2729. However, we do not have sufficient evidence to conclude the similar mechanism for Z2. Because of the same vector, Aedes aegypti, cases of co-infections by ZIKV, DENV and other arboviruses, such as chikungunya virus4748 have been reported. Moreover, preexisting DENV antibodies may enhance ZIKV infection through antibody-dependent enhancement (ADE) effect, a phenomenon in which antibody for certain flavivirus enhances the infection by heterogeneous virus49. Similar to DENV, some ZIKV antibodies may also induce ADE effect on ZIKV and DENV infection5051. Modification of the anti-ZIKV antibodies to decrease their binding to FcγR may reduce the risk of ADE effect16. However, this may further increase the cost of these antibodies. Z2, with antiviral activity against a broad spectrum of flaviviruses, may be favourable for patients infected by DENV and ZIKV simultaneously without the concern of ADE effect. Z2, as a viral inactivator, has some advantages compared to most small-molecule antiviral drugs that target the viral replication stages inside the target cell, such as protease inhibitors. Z2 can inhibit ZIKV infection before viral entry and is, therefore, beneficial for treatment of ZIKV viraemia, especially for women of child-bearing age and their partners. The low toxicity in vitro and in vivo of Z2 ensures the safety of Z2 for pregnant women and their fetuses. Protease inhibitors, on the other hand, will not work until the virus enters into the cells, which, in turn, may allow more influx of virions to fetuses. Without the specificity against ZIKV, protease inhibitors may cause harmful effect to high-risk pregnant women. Therefore, combinational use of Z2 with a protease inhibitor for treatment of ZIKV infection may have synergistic effect, resulting in the reduction of dose, and thus the toxicity of the protease inhibitor. Actually, ZIKV can infect pregnant woman and cause severe congenital brain developmental abnormalities in fetus, as well as can infect testis and cause damage that leads to male infertility5253. Therefore, we also detected the distribution of Z2 in the genital organs of male mice. Supplementary Fig. 13 shows that Z2 could distribute to the genital organs of male mice, suggesting that it may prevent testis damage caused by ZIKV. However, further experiments need to be carried out to confirm this finding. More versatile than traditional drugs, Z2 may be converted into bullets to target the virus in the fetal brain. Coupled with blood–brain barrier shuttle peptides, such as angiopep-2, glutathione, or peptides derived from transferrin (TfR1), or low-density lipoproteins (LDLRs)54, Z2 may acquire the ability to penetrate through the fetal blood–brain barrier. It should also be disclosed that peptides, as a drug, have some unfavourable features, such as immunogenicity and short half-life. Our study showed that intraperitoneal administration of Z2 peptide without an adjuvant did not induce anti-Z2 antibodies. The half-life time of Z2 is 2.767 h (Supplementary Fig. 14 and Supplementary Table 1). Nowadays, many ways have been found to prolong the half-life of peptide drugs, such as protecting N and C termini by N-acetylation and C-amidation, substituting L-amino acids with D-amino acids, and modification of amino acids with polyethylene glycol (PEG), albumin or lipopeptides5556. In conclusion, peptide Z2 from the stem region of ZIKV envelope protein exhibits potent anti-ZIKV activity, and excellent safety and pharmacological profiles, indicating its potential for further development as a novel antiviral drug to treat ZIKV infection in high-risk populations, particularly the pregnant women.

Methods

Ethics statements and mice

All animal experimental procedures were carried out according to ethical guidelines and approval by Institutional Laboratory Animal Care and Use Committee at Fudan University (20160927-2), Beijing Institute of Microbiology and Epidemiology (IACUC-13-2016-001), and Shanghai Public Health Clinical Center (2016-A021-01), respectively. The specific pathogen-free ICR pregnant mice and C57BL/6 pregnant mice at embryonic day 12–14 (E12–14) were purchased from Vital River Laboratories in Beijing and bred at the Department of Laboratory Animal Science of Fudan University. Specific pathogen-free A129 mice (female, 4 weeks of age) were bred at the Beijing Institute of Microbiology and Epidemiology. Specific pathogen-free AG6 mice (female, 6 weeks of age) were bred at the Animal Facility of Shanghai Public Health Clinical Center.

Cells and viruses

C6/36 (gift from Dr Yunwen Hu at Shanghai Public Health Clinical Center), BHK21 (American Type Culture Collection (ATCC), #CCL-10), Vero (ATCC, #CCL-81), 293T (ATCC, #CRL-3216) and Huh7 (Cell Bank of Chinese Academy of Science, #TCHu182) cells were cultured in Dulbecco’s modified Eagle’s medium (DMEM, Invitrogen, Carlsbad, CA) containing 10% fetal bovine serum (FBS, Biowest, France). ZIKV strain SZ01/2016 (GenBank number: KU866423) was isolated from a patient who returned from Samoa57. ZIKV strain GZ01/2016 (GenBank number: KU820898) was isolated from a patient who returned from Venezuela58. YFV strain 17D was obtained from Beijing Tiantan Biological products., Ltd and prepared as described previously59. ZIKV strains FLR (#VR1844) and MR766 (#VR1838) were obtained from ATCC. DENV-2 was kindly provided by Drs Yunwen Hu and Zhigang Song at the Shanghai Public Health Clinical Center. All the flaviviruses were propagated in C6/36 cells for the in vitro and in vivo experiments. The virus stock titre was calculated and diluted to 0.01 multiplicity of infection for in vitro experiments.

Petides synthesis

Peptides Z2(MAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAF), Z2-Cy5 and the scrambled peptide of Z2 (Z2-scr, LDIIAGLSAGFQGGATFVDAHGMVKASFLGGNW) were synthesized at GL Biochem (Shanghai, China) with 95% purity.

Assays for antiviral activity

Peptides (Z2 or Z2-scr) were dissolved in DMSO and serially diluted in serum-free DMEM. Then, 50 μl of virus (ZIKV, DENV-2 or YFV17D) were added to 50 μl peptide solution. After incubation at 37 °C for 1.5 h, the mixture was added to the cells seeded in 96-well plates, followed by incubation at 37 °C for 12 h. The culture supernatant was replaced with fresh DMEM containing 2% FBS. About 8 days later when ZIKV-induced CPE became evident, antiviral activity was detected using Cell Counting Kit-8 (CCK8, Dojindo, Japan) according to the instruction manual. Data were then collected by microplate reader (Infinite M200PRO, Tecan, USA). The pseudotyped VSV and MERS-CoV were set as unrelated virus controls and prepared as previously described6061. Briefly, 293T cells were co-transfected with a plasmid encoding MERS-CoV S protein provided by Dr Lanying Du at the New York Blood Center or VSV-G protein (gift from Dr Yan Wang at the Shanghai Institutes for Biological Sciences) and pNL4-3.luc.RE (obtained from NIH AIDS Reagent Program) using VigoFect (Vigorous Biotechnology, Beijing, China). Supernatants containing pseudotyped MERS-CoV or VSV were collected 48 h post transfection. Huh7 cells were infected by these control viruses as described above. After 3 days, the inhibitory activity of Z2 on pseudovirus infection was measured using the luciferase assay system according to the instruction manual (Promega Co., Madison, WI)62.

Immunofluorescence staining

To determine the inhibitory activity of Z2 on ZIKV infection in BHK21 or Vero cells, cells (1 × 105) were seeded onto coverslips in a 24-well plate the day before infection. Then, ZIKV was mixed with equal volume of Z2 serially diluted (20, 10 and 5 μM) or Z2-scr (20 μM) in serum-free DMEM. After incubation for 1.5 h at 37 °C, the mixture was added to cells. Twelve hours later, the culture supernatant was replaced with DMEM containing 2% FBS. After 4 days, the cells were fixed by 4% paraformaldehyde (PFA; Sigma-Aldrich, St Louis, MO), perforated by 0.2% Triton X-100 and blocked with 3% BSA (Amresco, LLC, Solon, OH). Then, the cells were incubated overnight with anti-E mAb 4G2 (10 μg ml−1, provided by Drs Lifang Jiang and Danyun Fang at Sun Yat-sen University) at 4 °C. After five washes, the cells were incubated with Alexa Fluor 488-labelled donkey anti-mouse IgG (1:1,000, Thermo Fisher Scientific, Wilmington, DE, USA) at room temperature for 1 h. After five washes, the coverslips were sealed with Prolong Gold Antifade reagent with 4,6-diamidino-2-phenylindole (Thermo Fisher Scientific) and scanned with the Leica SP8 confocal microscope. To detect the expression of ZIKV E protein, 293T cells (5 × 104) seeded on coverslips were transfected with pcDNA3.1-Env provided by Dr Lanying Du at the New York Blood Center, or empty vector pcDNA3.1 (Thermo Fisher Scientific) using VigoFect. After culture for 48 h, immunofluorescence staining was performed using anti-E mAb 4G2 as described above. To test the binding of Z2 to ZIKV-infected BHK21 cells, BHK21 cells seeded in coverslips were ZIKV- or mock-infected, fixed with 4% PFA, perforated by 0.2% Triton X-100 and blocked with 3% BSA. The cells were then incubated with anti-E mAb 4G2. After five washes, the cells were incubated with Alexa Fluor 488-labelled donkey anti-mouse antibody and Z2-Cy5 at room temperature for 1 h. After another five washes, the coverslips were sealed for scanning with the Leica SP8 confocal microscope.

Flow cytometry assay

The 293T cells (2 × 105) were seeded into a six-well plate. After culture at 37 °C for 16 h, the cells were transfected by pcDNA3.1-Env or pcDNA3.1 with VigoFect for 48 h. The cells were digested by EDTA buffer to obtain a single-cell suspension and then treated with 25 nM Z2-Cy5 for 30 min. The untreated cells were tested as the blank control. After three washes, the data of Z2-Cy5 binding to cells with or without E protein expression were collected with a BD Accuri C6 Flow Cytometer.

RNase digestion assay and RT–qPCR

The released genomic RNA from the ZIKV particles was detected by RNase digestion assay and RT–qPCR as previously described28. Briefly, about 1 × 103 plaque-forming units (p.f.u.) of ZIKV was incubated with Z2 or Z2-scr at room temperature for 2 h. The released genomic RNA from the treated ZIKV particles was then digested with micrococcal nuclease (New England BioLabs, MA) at 37 °C for 1 h. After inactivation of the residual RNase, the undigested genomic RNA in the intact viral particles was extracted using the Qiagen QIAamp Viral RNA Mini Kit (Valencia, CA) and reversed by using RT Reagent Kit (Takara Bio, Shiga, Japan). ZIKV RNA genome was quantified by SYBR PremixExTaqII (TliRNase H Plus from Takara Bio) and the Master Cycler Ep Realplex PCR System (Eppendorf, Hamburg, Germany) according to the manufacturers’ instructions. The following primers were used to detect the RNA sequences in viral genome coding precursor membrane protein (PrM), E and capsid (Cap) proteins, respectively (Fig. 3c,d): PrM F1 (5′-CTTGGACAGAAACGATGCTGGG-3′)/PrM R1 (5′-TGATGGCAGGTTCCGTACACAA-3′); E F1 (5′-TGGAGGCTGAGATGGATGG-3′)/E R1 (5′-GAACGCTGCGGTACACAAGGA-3′); and Cap F1 (5′-TCACGGCAATCAAGCCATCACT-3′)/Cap R1 (5′-GCCTCGTCTCTTCTTCTCCTT-3′).

Sucrose density gradient assay

Approximately 3 × 105 p.f.u. of ZIKV was treated with PBS containing 1% (v/v) DMSO, 100 μΜ Z2 or Z2-scr in PBS containing 1% (v/v) DMSO or PBS containing 1% (v/v) Triton X-100 at 37 °C for 2 h. Then the treated virions were gently loaded to the top of sucrose step gradient (20, 30, 40, 50, 60 and 70%) and then centrifuged in a swinging bucket rotor (SW41Ti, Beckman Coulter, Brea, CA) in an Optima L-100 XP ultracentrifuge (Beckman Coulter) for 3 h at 107,170g at 4 °C. Fractions from top to bottom were collected and assayed for viral genomic RNA by RT–qPCR and E protein by western blot. Anti-E mAb 4G2 (10 μg ml−1) was used to detect the E protein50.

Assay to detect inactivated ZIKV virions

Inactivated ZIKV particles were separated and detected as previously described36. Briefly, 100 μl Z2 or Z2-scr at graded concentration (2, 10, 20, 50 and 100 μM) were added to 100 μl ZIKV (5 × 103 p.f.u. per ml), followed by incubation at room temperature for 2 h. Then, 50% PEG-8000 (Amresco) and 5 M NaCl were added to the treated virus at final concentration of 10% and 0.67 M, respectively. After incubation on ice for 2 h, the mixture was centrifuged at 20,200g for 1 h. The supernatant containing the free peptide was removed, and the pellet containing the viral particles was washed with 3% PEG-8000 in PBS containing 10 mg ml−1 BSA (Amresco). After centrifugation, the pellet was resuspended in 200 μl DMEM containing 2% FBS. The infectivity of the ZIKV particles in the pellet was determined using BHK21 cells as described above.

In vivo fluorescence imaging

Six pregnant ICR mice (10–12 weeks old, E12–14) were assigned randomly to two groups and injected intravenously with 100 μg Z2-Cy5 in 100 μl PBS (n=3) or 100 μl PBS without peptide (n=3) as control (for background fluorescence measurement). One hour later, mice were imaged for distribution of Z2-Cy5 by the IVIS lumina K series III in vivo imaging system (PerkinElmer, Waltham, MA) and the radiant efficiency (p s−1 cm−2 sr−1)(μW−1 cm2) was calculated by Living image 4.4 software63. To determine the distribution of Z2-Cy5 in organs, all pregnant mice were killed by intraperitoneal injection of sodium pentobarbital and the dissected livers, kidneys, spleens, hearts, uteruses and fetuses were imaged and the average radiant efficiency was calculated. The fetuses in the uteruses of two groups were applied to PFA-fixed paraffin sections to demonstrate the distribution of Z2 in the placenta and fetus.

Safety of Z2 for pregnant ICR mice and fetuses

Thirty-one pregnant ICR mice (10–12 weeks old, E12–14) were assigned randomly to six groups and injected intravenously with Z2 at 10 (n=5), 20 (n=6), 40 (n=5), 80 (n=5) and 120 mg kg−1 (n=5) of body weight, or PBS (n=5) as control every day for 3 consecutive days. Body weight changes of mothers at different prenatal and postnatal time points and pups at various postnatal time points were monitored. ALT and creatinine in the sera collected from the tails were measured using the ALT and creatinine assay kits (NJJCBIO, Nanjing, China) before the first injection and 4 h, 1, 3 and 5 days, respectively, after the third injection of Z2. Specific antibody response elicited by Z2 in mice was evaluated by enzyme-linked immunosorbent assay at 1 or 2 weeks after the third injection of Z2 or PBS. Three weeks after the pups were born, two mothers and their pups in each group were killed and the livers, kidneys, spleens and brains were collected for haematoxylin and eosin staining. All animal studies with ICR mice were carried out according to the ethical guidelines and approval by the Institutional Laboratory Animal Care and Use Committee at Fudan University (20160927-2).

Antiviral efficacy of Z2 in pregnant C57BL/6 mice

Antiviral efficacy of Z2 in pregnant mice was evaluated using the method as previously reported39. Briefly, 24 pregnant C57BL/6 mice (10–12 weeks old, E12–14) were assigned randomly to two groups and infected i.p. with 1 × 105 p.f.u. of ZIKV (SZ01). One hour later, the infected mice were i.p. administered with Z2 at 10 mg kg−1 of body weight (n=12) or vehicle control (n=12). At day 1 post infection, mice were retro-orbitally bled to measure viraemia by RT–qPCR. Two embryos of each pregnant mouse were randomly collected and the viral RNA load in placenta and fetal head of each collected embryo was determined by RT–qPCR.

Antiviral efficacy of Z2 in A129 or AG6 mice

Antiviral efficacy of Z2 in an A129 or AG6 mouse model was evaluated as previously reported154041. Briefly, sixteen 4-week-old female A129 mice were assigned randomly to two groups and infected i.p. with 1 × 105 p.f.u. of ZIKV (GZ01). Then, the infected mice were i.p. administered with Z2 at 10 mg kg−1 of body weight (n=8) or vehicle control (n=8) every day for 6 consecutive d.p.i. Mice were observed daily for signs of illness and mortality. Animals that survived to day 21 were deemed to be protected. Meanwhile, viral RNA loads in sera on day 2 d.p.i. were measured by RT–qPCR. Twelve 6-week-old sex-matched AG6 mice were assigned randomly to two groups and infected with 1 × 103 p.f.u. of ZIKV (SZ01) via a subcutaneous route in the footpad. Then, the infected mice were i.p. administered with Z2 at 10 mg kg−1 of body weight (n=6) or vehicle control (n=6) every day for 6 consecutive d.p.i. Then the observation and examination on AG6 mice were done as described above. All animal studies with infectious ZIKV were conducted in a Biosafety Level 2 facility at Beijing Institute of Microbiology and Epidemiology or Shanghai Public Health Clinical Center with Institutional Biosafety Committee approval.

Statistical analysis

Statistical methods were performed as follows: the log-rank (Mantel Cox) test to compare the MST between ZIKV-infected mice treated with Z2 or vehicle; Student’s unpaired two-tailed t-test to monitor the distribution of Z2 in ICR mice; and the non-parametric Mann–Whitney test to examine the effect of Z2 on the levels of ALT and creatinine between the Z2 group and PBS group at one time point. The non-parametric Mann–Whitney test also to determine differences of viral RNA loads in the sera of mice treated with Z2 or vehicle. Statistical analyses were carried out by SPSS 13.0 and GraphPad Prism Software. *P<0.05; **P<0.01; ***P<0.001.

Data availability

All relevant data are available from the authors on request.

Additional information

How to cite this article: Yu, Y. et al. A peptide-based viral inactivator inhibits Zika virus infection in pregnant mice and fetuses. Nat. Commun. 8, 15672 doi: 10.1038/ncomms15672 (2017). Publisher’s note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
  63 in total

1.  Evidence of viral capsid dynamics using limited proteolysis and mass spectrometry.

Authors:  B Bothner; X F Dong; L Bibbs; J E Johnson; G Siuzdak
Journal:  J Biol Chem       Date:  1998-01-09       Impact factor: 5.157

2.  Salvage Regimens Containing Darunavir, Etravirine, Raltegravir, or Enfuvirtide in Highly Treatment-Experienced Perinatally Infected Pregnant Women.

Authors:  Gail F Shust; Jennifer Jao; Gabriela Rodriguez-Caprio; Roberto Posada; Katherine T Chen; Amelia Averitt; Rhoda S Sperling
Journal:  J Pediatric Infect Dis Soc       Date:  2013-04-12       Impact factor: 3.164

3.  Coinfection With Zika and Dengue-2 Viruses in a Traveler Returning From Haiti, 2016: Clinical Presentation and Genetic Analysis.

Authors:  Nicole M Iovine; John Lednicky; Kartikeya Cherabuddi; Hannah Crooke; Sarah K White; Julia C Loeb; Eleonora Cella; Massimo Ciccozzi; Marco Salemi; J Glenn Morris
Journal:  Clin Infect Dis       Date:  2016-09-29       Impact factor: 9.079

4.  Novel antiviral activity and mechanism of bromocriptine as a Zika virus NS2B-NS3 protease inhibitor.

Authors:  Jasper Fuk-Woo Chan; Kenn Ka-Heng Chik; Shuofeng Yuan; Cyril Chik-Yan Yip; Zheng Zhu; Kah-Meng Tee; Jessica Oi-Ling Tsang; Chris Chung-Sing Chan; Vincent Kwok-Man Poon; Gang Lu; Anna Jinxia Zhang; Kin-Kui Lai; Kwok-Hung Chan; Richard Yi-Tsun Kao; Kwok-Yung Yuen
Journal:  Antiviral Res       Date:  2017-02-07       Impact factor: 5.970

5.  Specificity, cross-reactivity, and function of antibodies elicited by Zika virus infection.

Authors:  Karin Stettler; Martina Beltramello; Diego A Espinosa; Victoria Graham; Antonino Cassotta; Siro Bianchi; Fabrizia Vanzetta; Andrea Minola; Stefano Jaconi; Federico Mele; Mathilde Foglierini; Mattia Pedotti; Luca Simonelli; Stuart Dowall; Barry Atkinson; Elena Percivalle; Cameron P Simmons; Luca Varani; Johannes Blum; Fausto Baldanti; Elisabetta Cameroni; Roger Hewson; Eva Harris; Antonio Lanzavecchia; Federica Sallusto; Davide Corti
Journal:  Science       Date:  2016-07-14       Impact factor: 47.728

6.  Isolation, identification and genomic characterization of the Asian lineage Zika virus imported to China.

Authors:  Yong-Qiang Deng; Hui Zhao; Xiao-Feng Li; Na-Na Zhang; Zhong-Yu Liu; Tao Jiang; Da-Yong Gu; Lei Shi; Jian-An He; Hong-Jiang Wang; Zhao-Zeng Sun; Qing Ye; Dong-Yang Xie; Wu-Chun Cao; Cheng-Feng Qin
Journal:  Sci China Life Sci       Date:  2016-03-18       Impact factor: 6.038

7.  Guillain-Barré syndrome associated with Zika virus infection.

Authors:  Patrícia Brasil; Patricia Carvalho Sequeira; Andrea D'Avila Freitas; Heruza Einsfeld Zogbi; Guilherme Amaral Calvet; Rogerio Valls de Souza; André Machado Siqueira; Marcos Cesar Lima de Mendonca; Rita Maria Ribeiro Nogueira; Ana Maria Bispo de Filippis; Tom Solomon
Journal:  Lancet       Date:  2016-04-02       Impact factor: 79.321

8.  Excretion of infectious Zika virus in urine.

Authors:  Fu-Chun Zhang; Xiao-Feng Li; Yong-Qiang Deng; Yi-Gang Tong; Cheng-Feng Qin
Journal:  Lancet Infect Dis       Date:  2016-05-13       Impact factor: 25.071

9.  Peptide inhibitors of dengue virus and West Nile virus infectivity.

Authors:  Yancey M Hrobowski; Robert F Garry; Scott F Michael
Journal:  Virol J       Date:  2005-06-01       Impact factor: 4.099

10.  Flavivirus NS1 protein in infected host sera enhances viral acquisition by mosquitoes.

Authors:  Jianying Liu; Yang Liu; Kaixiao Nie; Senyan Du; Jingjun Qiu; Xiaojing Pang; Penghua Wang; Gong Cheng
Journal:  Nat Microbiol       Date:  2016-06-20       Impact factor: 17.745

View more
  40 in total

Review 1.  Therapeutic Approaches for Zika Virus Infection of the Nervous System.

Authors:  Rachel P M Abrams; Jamie Solis; Avindra Nath
Journal:  Neurotherapeutics       Date:  2017-10       Impact factor: 7.620

2.  Flavivirus Entry Inhibitors.

Authors:  Yufeng Yu; Lulu Si; Yu Meng
Journal:  Adv Exp Med Biol       Date:  2022       Impact factor: 2.622

3.  Rottlerin plays an antiviral role at early and late steps of Zika virus infection.

Authors:  Shili Zhou; Quanshi Lin; Changbai Huang; Xiaotong Luo; Xu Tian; Chao Liu; Ping Zhang
Journal:  Virol Sin       Date:  2022-08-05       Impact factor: 6.947

Review 4.  Mosquito-Borne Flaviviruses and Current Therapeutic Advances.

Authors:  Xijing Qian; Zhongtian Qi
Journal:  Viruses       Date:  2022-06-05       Impact factor: 5.818

5.  Potential of antiviral peptide-based SARS-CoV-2 inactivators to combat COVID-19.

Authors:  Arun Bahadur Gurung; Mohammad Ajmal Ali; Joongku Lee; Mohamed El-Zaidy; Reem M Aljowaie; Saeedah M Almutairi
Journal:  PLoS One       Date:  2022-06-03       Impact factor: 3.752

6.  A gossypol derivative effectively protects against Zika and dengue virus infection without toxicity.

Authors:  Yaning Gao; Wanbo Tai; Xinyi Wang; Shibo Jiang; Asim K Debnath; Lanying Du; Shizhong Chen
Journal:  BMC Biol       Date:  2022-06-15       Impact factor: 7.364

7.  Zika virus pathogenesis and current therapeutic advances.

Authors:  Caroline Mwaliko; Raphael Nyaruaba; Lu Zhao; Evans Atoni; Samuel Karungu; Matilu Mwau; Dimitri Lavillette; Han Xia; Zhiming Yuan
Journal:  Pathog Glob Health       Date:  2020-11-14       Impact factor: 2.894

8.  Receptor-Based Peptides for Inhibition of Leukotoxin Activity.

Authors:  Eric Krueger; Shannon Hayes; En Hyung Chang; Shailagne Yutuc; Angela C Brown
Journal:  ACS Infect Dis       Date:  2018-05-17       Impact factor: 5.084

9.  Compelling Evidence for the Activity of Antiviral Peptides against SARS-CoV-2.

Authors:  Miray Tonk; Daniel Růžek; Andreas Vilcinskas
Journal:  Viruses       Date:  2021-05-14       Impact factor: 5.048

10.  Mechanism through Which Retrocyclin Targets Flavivirus Multiplication.

Authors:  Xiaoying Jia; Jiao Guo; Weirong Yuan; Lingling Sun; Yang Liu; Minmin Zhou; Gengfu Xiao; Wuyuan Lu; Alfredo Garzino-Demo; Wei Wang
Journal:  J Virol       Date:  2021-07-12       Impact factor: 5.103

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.