Literature DB >> 28450454

Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes.

Xiang Pan1, Nava Zaarur1, Maneet Singh1, Peter Morin2, Konstantin V Kandror3.   

Abstract

Sortilin is a multiligand sorting receptor responsible for the anterograde transport of lysosomal enzymes and substrates. Here we demonstrate that sortilin is also involved in retrograde protein traffic. In cultured 3T3-L1 adipocytes, sortilin together with retromer rescues Glut4 from degradation in lysosomes and retrieves it to the TGN, where insulin--responsive vesicles are formed. Mechanistically, the luminal Vps10p domain of sortilin interacts with the first luminal loop of Glut4, and the cytoplasmic tail of sortilin binds to retromer. Ablation of the retromer does not affect insulin signaling but decreases the stability of sortilin and Glut4 and blocks their entry into the small vesicular carriers. As a result, Glut4 cannot reach the insulin-responsive compartment, and insulin-stimulated glucose uptake in adipocytes is suppressed. We suggest that sortilin- and retromer-mediated Glut4 retrieval from endosomes may represent a step in the Glut4 pathway vulnerable to the development of insulin resistance and diabetes.
© 2017 Pan et al. This article is distributed by The American Society for Cell Biology under license from the author(s). Two months after publication it is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

Entities:  

Mesh:

Substances:

Year:  2017        PMID: 28450454      PMCID: PMC5469609          DOI: 10.1091/mbc.E16-11-0777

Source DB:  PubMed          Journal:  Mol Biol Cell        ISSN: 1059-1524            Impact factor:   4.138


INTRODUCTION

The regulation of blood glucose levels in mammals is achieved by insulin-dependent translocation of the glucose transporter isoform 4 (Glut4) to the plasma membrane in fat and skeletal muscle cells. Many transgenic models (reviewed in Charron ; Minokoshi ; Graham and Kahn, 2007), as well as nuclear magnetic resonance experiments in humans (reviewed in Shulman, 2000), show that Glut4 is responsible for the rate-limiting step in overall insulin-stimulated glucose disposal in vivo. In insulin resistance and type 2 diabetes, insulin responsiveness of Glut4 in skeletal muscle is reduced in spite of its seemingly normal expression levels, whereas in adipose tissue, Glut4 protein is also decreased (Shepherd and Kahn, 1999; Graham and Kahn, 2007; Huang and Czech, 2007; Bogan, 2012). The latter effect is highly significant because down-regulation of the Glut4 protein specifically in adipocytes leads to systemic insulin resistance (Abel ; Herman ), whereas even a moderate increase in Glut4 levels improves insulin sensitivity (Atkinson ). Down-regulation of Glut4 has been associated with decreased expression of its mRNA (Sivitz ). This, however, may not represent the only factor affecting Glut4 protein levels because prolonged insulin stimulation decreases the half-life of the Glut4 protein more than threefold and causes insulin resistance (Sargeant and Paquet, 1993; Ma ). The explanation of this phenomenon is likely to lie in the cell biology of Glut4 recycling. From the plasma membrane, Glut4 is internalized into peripheral endosomes, from where it is retrieved to a perinuclear compartment, likely the trans-Golgi network (TGN), in order to escape degradation in lysosomes (Slot ; Foster ; Shewan ). Insulin-responsive vesicles (IRVs) are believed to derive from the TGN donor membranes (Bogan and Kandror, 2010). Because Glut4 has a very long half-life in spite of multiple cycles of translocation to and from the plasma membrane, its retrieval from endosomes to the TGN should be extremely efficient under normal conditions. However, in insulin resistance and diabetes, retrieval of Glut4 from endosomes may be compromised, and, correspondingly, more Glut4 molecules undergo a default trafficking pathway from endosomes to lysosomes. Indeed, a recent report shows that prolonged insulin stimulation suppresses Glut4 retrieval from endosomes and increases its lysosomal degradation (Ma ). The mechanism of Glut4 retrieval from endosomes is not well understood and needs to be explored. To this end, it has been shown that in human skeletal muscle, retrograde trafficking of Glut4 from endosomes to the TGN involves syntaxin 10 (Esk ) and the specific CHC22 isoform of clathrin heavy chain (Vassilopoulos ). However, retrieval of Glut4 in adipocytes remains poorly studied. Here we demonstrate that a sorting receptor, sortilin, plays a central role in the retrieval of Glut4 from endosomes. Specifically, the luminal Vps10 p domain of sortilin interacts with the first luminal loop of Glut4, and the cytoplasmic tail of sortilin binds to retromer, an evolutionary conserved protein complex responsible for protein selection and export from endosomes to the TGN (Bonifacino and Rojas, 2006). Thus sortilin may work as a transmembrane scaffold that links Glut4 to retromer, rerouting it from the degradative to the recycling pathway.

RESULTS

In undifferentiated 3T3-L1 preadipocytes, ectopically expressed myc7-Glut4 is localized primarily in endosomes and has a short half-life (t1/2 < 2 h; Shi and Kandror, 2005; Liu ). On adipocyte differentiation, myc7-Glut4 becomes much more stable, and its half-life increases to >40 h (Shi and Kandror, 2005). In agreement with these results, we show here that in undifferentiated preadipocytes, a significant fraction of myc7-Glut4 is colocalized with LysoTracker, presumably in late endosomes and lysosomes, whereas in differentiated adipocytes, colocalization between myc7-Glut4 and LysoTracker is virtually undetectable (Figure 1 and Table 1, lines 1 and 2).
FIGURE 1:

Ectopically expressed myc7-Glut4 is colocalized with LysoTracker in undifferentiated (Fb) but not in differentiated (Ad) 3T3-L1 cells. 3T3-L1 cells stably expressing myc7-Glut4 were incubated with LysoTracker, fixed, and stained with monoclonal anti-myc antibody and FITC-conjugated donkey anti-mouse IgG and analyzed by double immunofluorescence.

TABLE 1:

Quantitative analysis of protein colocalization.

LineCell typeTransfected construct(s)Staining 1Staining 2Corresponding figurePearson’s R
1Preadipocytemyc7-Glut4mycLysoTrackerFigure 1 (top)0.88 ± 0.04
2Adipocytemyc7-Glut4mycLysoTrackerFigure 1 (bottom)0.48 ± 0.09
3Preadipocytemyc7-Glut4mycVps35Figure 2B (top)0.28 ± 0.13
4Adipocytemyc7-Glut4mycVps35Figure 2B (middle)0.76 ± 0.08
5Adipocytemyc7-Glut4mycSortilinFigure 4A0.80 ± 0.08
6Adipocytemyc7-Glut4mycLysoTrackerFigure 3B (bottom)0.86 ± 0.06
Sortilin shRNA
7Adipocytemyc7-Glut4mycVps35Figure 3B (top)0.50 ± 0.08
Sortilin shRNA
8Preadipocytemyc7-Glut4Glut4LysoTrackerFigure 5 (bottom)0.43 ± 0.08
Sortilin-myc/His
9Preadipocytemyc7-Glut4Glut4Vps35Figure 5 (top)0.67 ± 0.10
Sortilin-myc/His
10AdipocyteNoneGlut4LysoTrackerFigure 8C (top)0.52 ± 0.11
11AdipocyteNoneGlut4Vps35Figure 2B (bottom)0.82 ± 0.09
12AdipocyteVps35 CRISPRGlut4LysoTrackerFigure 8C (bottom)0.82 ± 0.06

Pearson’s R was determined by ImageJ analysis of 12–14 randomly selected cells.

Ectopically expressed myc7-Glut4 is colocalized with LysoTracker in undifferentiated (Fb) but not in differentiated (Ad) 3T3-L1 cells. 3T3-L1 cells stably expressing myc7-Glut4 were incubated with LysoTracker, fixed, and stained with monoclonal anti-myc antibody and FITC-conjugated donkey anti-mouse IgG and analyzed by double immunofluorescence. Quantitative analysis of protein colocalization. Pearson’s R was determined by ImageJ analysis of 12–14 randomly selected cells. Because undifferentiated 3T3-L1 cells do not express Glut4 and lack an insulin-responsive vesicular compartment, which normally represents a major “sink” for the transporter (Shi and Kandror, 2005), one possible interpretation of these results is that in undifferentiated cells, ectopically expressed Glut4 cannot be faithfully compartmentalized in the IRVs and thus undergoes rapid degradation. Alternatively, undifferentiated cells may not be able to retrieve Glut4 from endosomes to the TGN where the IRVs are formed; correspondingly, Glut4 is captured by the default pathway from endosomes to lysosomes. Retrograde transport of proteins from endosomes to TGN depends on the sorting process performed by retromer. Mammalian retromer consists of the trimeric complex of Vps26, Vps29, and Vps35, which functions together with sorting nexins (SNX) and other auxiliary proteins (Seaman, 2012; Lucas ) to perform this function. Undifferentiated cells express a normal amount of retromer (Figure 2A; Yang ). However, we have not been able to detect significant colocalization between retromer and ectopically expressed myc7-Glut4 in preadipocytes (Figure 2B, top, and Table 1, line 3); on the contrary, such colocalization becomes apparent on cell differentiation (Figure 2B, middle, and Table 1, line 4). In addition, wild-type 3T3-L1 adipocytes demonstrate significant colocalization between retromer and endogenously expressed Glut4 (Figure 2B, bottom, and Table 1, line 11). These results suggest that the retrograde traffic of Glut4 from endosomes to the TGN is inefficient in undifferentiated preadipocytes and is established on cell differentiation. To explain this phenomenon, we hypothesize that undifferentiated cells do not express a protein that couples Glut4 to retromer.
FIGURE 2:

Glut4 is colocalized with Vps35 in differentiated (Ad) but not in undifferentiated (Fb) 3T3-L1 cells. (A) Total lysates (40 µg/lane) of differentiated and undifferentiated 3T3-L1 cells were analyzed by Western blotting. (B) Top and middle, 3T3-L1 cells stably expressing myc7-Glut4 were stained with goat polyclonal antibody against Vps35 and mouse monoclonal anti-myc antibody, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-mouse IgG and analyzed by double immunofluorescence. Bottom, wild-type 3T3-L1 adipocytes were stained with goat polyclonal antibody against Vps35 and rabbit polyclonal antibody against Glut4, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-rabbit IgG.

Glut4 is colocalized with Vps35 in differentiated (Ad) but not in undifferentiated (Fb) 3T3-L1 cells. (A) Total lysates (40 µg/lane) of differentiated and undifferentiated 3T3-L1 cells were analyzed by Western blotting. (B) Top and middle, 3T3-L1 cells stably expressing myc7-Glut4 were stained with goat polyclonal antibody against Vps35 and mouse monoclonal anti-myc antibody, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-mouse IgG and analyzed by double immunofluorescence. Bottom, wild-type 3T3-L1 adipocytes were stained with goat polyclonal antibody against Vps35 and rabbit polyclonal antibody against Glut4, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-rabbit IgG. One such protein could be sortilin, which plays a pivotal role in the formation of the IRVs (Shi and Kandror, 2005; Ariga ). In differentiating adipocytes, endogenous sortilin is expressed ∼24 h before Glut4 (Shi and Kandror, 2005), increases its stability (Shi and Kandror, 2005), and generates “static” behavior of Glut4 typical of differentiated adipocytes (Hatakeyama and Kanzaki, 2011). To test this hypothesis, we knocked down sortilin from 3T3-L1 adipocytes that ectopically express myc7-Glut4 (Figure 3A). In line with our model, depletion of sortilin decreases colocalization of myc7-Glut4 with Vps35 (Figure 3B, top; compare line 7 to line 4 in Table 1) and, correspondingly, increases its colocalization with LysoTracker (Figure 3B, bottom; compare line 6 to line 2 in Table 1).
FIGURE 3:

Knockdown of sortilin decreases colocalization of myc7-Glut4 with Vps35 and increases its presence in lysosomes. (A) Total lysates (40 µg/lane) prepared from 3T3-L1 adipocytes stably transfected with myc7-Glut4 and shRNA against sortilin were analyzed by Western blotting. (B) Top: 3T3-L1 adipocytes stably transfected with myc7-Glut4 and shRNA against sortilin were stained with goat polyclonal antibody against Vps35 and mouse monoclonal anti-myc antibody, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-mouse IgG. Bottom: 3T3-L1 adipocytes stably transfected with myc7-Glut4 and shRNA against sortilin were incubated with LysoTracker and stained with mouse monoclonal anti-myc antibody, followed by FITC-conjugated donkey anti-mouse IgG.

Knockdown of sortilin decreases colocalization of myc7-Glut4 with Vps35 and increases its presence in lysosomes. (A) Total lysates (40 µg/lane) prepared from 3T3-L1 adipocytes stably transfected with myc7-Glut4 and shRNA against sortilin were analyzed by Western blotting. (B) Top: 3T3-L1 adipocytes stably transfected with myc7-Glut4 and shRNA against sortilin were stained with goat polyclonal antibody against Vps35 and mouse monoclonal anti-myc antibody, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-mouse IgG. Bottom: 3T3-L1 adipocytes stably transfected with myc7-Glut4 and shRNA against sortilin were incubated with LysoTracker and stained with mouse monoclonal anti-myc antibody, followed by FITC-conjugated donkey anti-mouse IgG. Our results are somewhat inconsistent with a recent report of significant colocalization between Vps35 and Glut4 in both differentiated and undifferentiated cells (Yang ). We believe that this difference might be due to the level of Glut4 overexpression. In our experiments, we infected 3T3-L1 preadipocytes with myc7-Glut4–encoding lentivirus and selected for cells that ectopically express myc7-Glut4 at <10% of endogenous Glut4 levels (unpublished data), whereas the other study used electroporation, which usually results in massive overexpression of proteins, which can overflow to other compartments. In 3T3-L1 adipocytes, sortilin shows considerable colocalization with myc7-Glut4 (Figure 4A and Table 1, line 5); however, our attempts to coimmunoprecipitate sortilin and Glut4 did not bring clear-cut results, probably because interaction of the protein-binding Vps10p domain of sortilin with its ligands is sensitive to detergents. At the same time, sortilin can be cross-linked to myc7-Glut4 using the membrane-permeable cross-linker dithiobis(succinimidyl propionate) (DSP; Shi and Kandror, 2005). In addition, yeast two-hybrid experiments suggest that the Vps10p domain interacts with the first liminal loop of Glut4 (Kim and Kandror, 2012). To confirm these results, we used the chemically synthesized peptide corresponding to the first luminal loop of Glut4 and found that it interacts with the isolated sortilin in the absence of detergents at both pH 6 (which roughly corresponds to intraendosomal pH) and pH 8 (Figure 4B). Thus three independent lines of evidence—chemical cross-­linking (Shi and Kandror, 2005), the yeast two-hybrid technique (Kim and Kandror, 2012), and peptide binding (Figure 4B)—suggest that the luminal Vps10p domain of sortilin can bind to the first luminal loop of Glut4.
FIGURE 4:

Sortilin interacts with the first luminal loop of Glut4 and retromer. (A) 3T3-L1 adipocytes stably transfected with myc7-Glut4 were stained with mouse monoclonal anti-myc antibody and rabbit polyclonal sortilin antibody, followed by Texas red–conjugated donkey anti-mouse IgG and FITC-conjugated donkey anti-rabbit IgG and analyzed by double immunofluorescence. (B) Total lysates (0.5 mg) prepared from wild-type (WT) 3T3-L1 adipocytes and 3T3-L1 adipocytes stably transfected with sortilin-myc/His (S) were incubated with HisPur cobalt resin; beads were washed and additionally incubated with the peptide (100 ng) corresponding to the first luminal loop of Glut4. Eluates were analyzed by electrophoresis in Tricine gels and Western blotting. A representative result of three independent experiments. (C) The cytoplasmic tail of sortilin (CT) in the GST vector along with GST alone as a control were prebound to glutathione beads and then incubated with the cytoplasmic extract (0.5 mg) from insulin-treated and untreated 3T3-L1 adipocytes. Eluates along with input and unbound material (equal volume aliquots) were analyzed by SDS electrophoresis and Western blotting. A representative result of three independent experiments. (D) 3T3-L1 adipocytes stably expressing myc7-Glut4 were stained with mouse monoclonal anti-myc antibody, goat polyclonal antibody against Vps35, and rabbit polyclonal antibody against sortilin, followed by Alexa Fluor 647–conjugated donkey anti-mouse IgG, Alexa Fluor 546–conjugated donkey anti-goat IgG, and FITC-conjugated donkey anti-rabbit IgG and analyzed by immunofluorescence. (E) 3T3-L1 adipocytes stably expressing myc7-Glut4 or myc7-Glut4 along with sortilin-myc/His were cross-linked with DSP; sortilin-myc/His-containing complexes were isolated on HisPur cobalt resin as described in Materials and Methods and analyzed by Western blotting. A representative result of three independent experiments. (F) Sortilin may work as a transmembrane scaffold linking Glut4 to the retromer-mediated protein traffic.

Sortilin interacts with the first luminal loop of Glut4 and retromer. (A) 3T3-L1 adipocytes stably transfected with myc7-Glut4 were stained with mouse monoclonal anti-myc antibody and rabbit polyclonal sortilin antibody, followed by Texas red–conjugated donkey anti-mouse IgG and FITC-conjugated donkey anti-rabbit IgG and analyzed by double immunofluorescence. (B) Total lysates (0.5 mg) prepared from wild-type (WT) 3T3-L1 adipocytes and 3T3-L1 adipocytes stably transfected with sortilin-myc/His (S) were incubated with HisPur cobalt resin; beads were washed and additionally incubated with the peptide (100 ng) corresponding to the first luminal loop of Glut4. Eluates were analyzed by electrophoresis in Tricine gels and Western blotting. A representative result of three independent experiments. (C) The cytoplasmic tail of sortilin (CT) in the GST vector along with GST alone as a control were prebound to glutathione beads and then incubated with the cytoplasmic extract (0.5 mg) from insulin-treated and untreated 3T3-L1 adipocytes. Eluates along with input and unbound material (equal volume aliquots) were analyzed by SDS electrophoresis and Western blotting. A representative result of three independent experiments. (D) 3T3-L1 adipocytes stably expressing myc7-Glut4 were stained with mouse monoclonal anti-myc antibody, goat polyclonal antibody against Vps35, and rabbit polyclonal antibody against sortilin, followed by Alexa Fluor 647–conjugated donkey anti-mouse IgG, Alexa Fluor 546–conjugated donkey anti-goat IgG, and FITC-conjugated donkey anti-rabbit IgG and analyzed by immunofluorescence. (E) 3T3-L1 adipocytes stably expressing myc7-Glut4 or myc7-Glut4 along with sortilin-myc/His were cross-linked with DSP; sortilin-myc/His-containing complexes were isolated on HisPur cobalt resin as described in Materials and Methods and analyzed by Western blotting. A representative result of three independent experiments. (F) Sortilin may work as a transmembrane scaffold linking Glut4 to the retromer-mediated protein traffic. In parallel, it has been shown that sortilin traffics from endosomes to the TGN in a retromer-dependent manner (Seaman, 2004; Mari ), contains an endosome-to-TGN retrieval motif, FLV (Seaman, 2007), and coimmunoprecipitates with the retromer subunit Vps26 (Canuel ). Because we were unable to coimmunoprecipitate sortilin and retromer with a significant yield (unpublished data), we subcloned the cytoplasmic tail of sortilin into the glutathione S-transferase (GST) vector as explained in Materials and Methods and demonstrated that in the absence of detergents, the cytoplasmic C-terminus tail of sortilin pulls down retromer, as evidenced by its subunit Vps35 (Figure 4C). Furthermore, using three-way immunofluorescence microscopy, we found that a fraction of sortilin simultaneously colocalizes with Glut4 and Vps35 (Figure 4D), suggesting that a transient complex may exist between sortilin, retromer, and Glut4. To test this idea further, we performed cross-linking of 3T3-L1 adipocytes stably expressing myc7-Glut4 and sortilin-myc/histidine (His) using the membrane-permeable, cleavable cross-linker DSP followed by the isolation of sortilin-myc/His–containing complexes on cobalt resin, which binds to His-tagged proteins. Cells that express only myc7-Glut4 served as a control for these experiments. In agreement with our previous results (Shi and Kandror, 2005), Figure 4E shows that sortilin can be cross-linked with myc7-Glut4. In addition, retromer subunits Vps26, SNX2, and, to a lesser extent, Vps35 have been found in association with sortilin-myc/His (Figure 4E). We believe that our results are consistent with those of Lucas ), who showed that cargo proteins may interact with the interface between Vps26 and SNX and not with Vps35 as was believed previously. We thus conclude that sortilin may work as a transmembrane scaffold that links Glut4 to retromer (Figure 4F). Indeed, double expression of myc7-Glut4 and sortilin-myc/His in undifferentiated 3T3-L1 cells increases colocalization between Glut4 and Vps35 (Figure 5, top; compare line 9 to line 3 in Table 1), leads to redistribution of Glut4 from peripheral endosomes to the perinuclear compartment, and dramatically decreases colocalization of Glut4 with LysoTracker (Figure 5 bottom; compare lines 8 and 1 in Table 1).
FIGURE 5:

myc7-Glut4 is colocalized with Vps35 but not with LysoTracker in undifferentiated 3T3-L1 cells that express both myc7-Glut4 and sortilin-myc/His. Top: Cells were stained with goat polyclonal antibody against Vps35 and rabbit polyclonal antibody against Glut4, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-rabbit IgG. Bottom: Cells were incubated with LysoTracker, fixed, and stained with rabbit polyclonal antibody against Glut4, followed by FITC-conjugated donkey anti-rabbit IgG and analyzed by double immunofluorescence.

myc7-Glut4 is colocalized with Vps35 but not with LysoTracker in undifferentiated 3T3-L1 cells that express both myc7-Glut4 and sortilin-myc/His. Top: Cells were stained with goat polyclonal antibody against Vps35 and rabbit polyclonal antibody against Glut4, followed by Texas red–conjugated donkey anti-goat IgG and FITC-conjugated donkey anti-rabbit IgG. Bottom: Cells were incubated with LysoTracker, fixed, and stained with rabbit polyclonal antibody against Glut4, followed by FITC-conjugated donkey anti-rabbit IgG and analyzed by double immunofluorescence. To estimate the functional significance of retromer in the intracellular trafficking of sortilin and Glut4, we used the clustered regularly interspaced short palindromic repeats (CRISPR)/Cas9 system to knock out Vps35. We selected several single-cell colonies and a pooled clone of the “engineered” cells, and we used the latter for the following experiments. Figure 6A demonstrates that knockout of Vps35 decreases the expression of the two other retromer subunits, Vps29 and Vps26. Total levels of Glut4 and sortilin are also decreased. This effect can be attributed to the substantial reduction of the half-life of both proteins (Figure 6, B and C) likely due to their poor retrieval from endosomes. Because both Glut4 and sortilin are very stable proteins with t1/2 significantly >24 h, calculation of their actual half-lives in wild-type adipocytes is limited by prolonged use of inhibitors that may produce off-target effects. Knockout of Vps35 decreases t1/2 of Glut4 and sortilin to 8 ± 2 and 3 ± h, respectively, and incubation of “engineered” cells with bafilomycin A stabilizes Glut4 and sortilin and increases t1/2 of both to >20 h (Figure 6, B and C).
FIGURE 6:

Knockout of Vps35 in wild-type 3T3-L1 adipocytes decreases stability of sortilin and Glut4 in a bafilomycin A–sensitive manner. (A) total lysates (80 µg) of wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes were analyzed by Western blotting. (B) Half-life of sortilin and Glut4 was measured in wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes in the absence and presence of bafilomycin A as described in Materials and Methods. A representative result of three interdependent experiments. (C) Quantification of data shown in B. Each data point represents normalized mean value ± SE of three experiments.

Knockout of Vps35 in wild-type 3T3-L1 adipocytes decreases stability of sortilin and Glut4 in a bafilomycin A–sensitive manner. (A) total lysates (80 µg) of wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes were analyzed by Western blotting. (B) Half-life of sortilin and Glut4 was measured in wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes in the absence and presence of bafilomycin A as described in Materials and Methods. A representative result of three interdependent experiments. (C) Quantification of data shown in B. Each data point represents normalized mean value ± SE of three experiments. Of note, it has been shown previously that knockdown of Vps26, Vps35, and SNX27 decreases intracellular levels of the Glut4 protein (Ma ; Yang ), and knockdown of SNX1 reduces the expression of sortilin (Mari ). Our study suggests that these two events are functionally connected, that is, retromer may be responsible for retrieval of the sortilinGlut4 complex. Knockout of Vps35 does not affect insulin signaling (Figure 7A) but inhibits insulin-stimulated glucose uptake in adipocytes virtually completely (Figure 7B). We suggest that blocking the retrograde transport of Glut4 from endosomes to TGN may prevent Glut4 from entering the IRVs and hence translocation to the plasma membrane.
FIGURE 7:

Knockout of Vps35 in 3T3-L1 adipocytes inhibits insulin-stimulated glucose uptake but not insulin signaling. (A) Total lysates (80 µg) of wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes treated and not treated with 100 nM insulin for 15 min were analyzed by Western blotting. (B) Insulin-stimulated glucose uptake was measured in wild-type and CRISPR/Cas9- edited 3T3-L1 adipocytes as described in Materials and Methods. **p < 0.01; NS, not significant. Results were analyzed by Student’s t test. A representative result of three independent experiments.

Knockout of Vps35 in 3T3-L1 adipocytes inhibits insulin-stimulated glucose uptake but not insulin signaling. (A) Total lysates (80 µg) of wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes treated and not treated with 100 nM insulin for 15 min were analyzed by Western blotting. (B) Insulin-stimulated glucose uptake was measured in wild-type and CRISPR/Cas9- edited 3T3-L1 adipocytes as described in Materials and Methods. **p < 0.01; NS, not significant. Results were analyzed by Student’s t test. A representative result of three independent experiments. To test this idea, we separated an adipocyte extract by differential centrifugation into a heavy membrane fraction (P1), which includes endoplasmic reticulum, plasma membrane (PM), and large endosomes and TGN membranes, and a vesicular fraction (P2), which includes the IRVs and small transport vesicles (Figure 8A). In wild-type 3T3-L1 adipocytes, ∼20% of Glut4 and sortilin are localized in the vesicular fraction (Figure 8B), whereas most syntaxin 6 (TGN marker) and caveolin 1 (PM marker) are recovered in heavy membranes. Knockout of Vps35 eliminates the presence of Glut4 and sortilin in small transport vesicles presumably by blocking exit of both proteins from endosomes. In agreement with this model, the amount of Glut4 in the heavy membrane fraction is proportionally increased (Figure 8B). Immunofluorescence staining also shows that knockout of Vps35 leads to redistribution of Glut4 from the perinuclear TGN compartment in wild-type 3T3-L1 adipocytes to peripheral endosomes/lysosomes (compare Figure 8C, top and bottom) and increases colocalization of Glut4 with LysoTracker (compare lines 10 and 12 in Table 1). At the same time, neither total expression levels nor the biochemical distributions of syntaxin 6 and caveolin 1 are altered in Vps35-knockout cells (Figure 8A).
FIGURE 8:

Knockout of Vps35 in 3T3-L1 adipocytes inhibits formation of small transport vesicles containing sortilin and Glut4 and blocks their delivery from peripheral endosomes to the perinuclear compartment. (A) Total lysates (L) prepared from wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes were fractionated into heavy membrane pellet (P1) and vesicular fractions (P2), which were analyzed by Western blotting (20 µg/lane). (B) Relative distribution of Glut4 and sortilin between fractions. Presence of each protein in total lysates (L) of wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes is 100%. **p < 0.01; *p < 0.05. Results were analyzed by Student’s t test. A representative result of three independent experiments. (C) Wild- type (top) and CRISPR/Cas9-edited (bottom) 3T3-L1 adipocytes were incubated with LysoTracker, fixed, and stained with rabbit polyclonal antibody against Glut4, followed by FITC-conjugated donkey anti-rabbit IgG, and analyzed by double immunofluorescence.

Knockout of Vps35 in 3T3-L1 adipocytes inhibits formation of small transport vesicles containing sortilin and Glut4 and blocks their delivery from peripheral endosomes to the perinuclear compartment. (A) Total lysates (L) prepared from wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes were fractionated into heavy membrane pellet (P1) and vesicular fractions (P2), which were analyzed by Western blotting (20 µg/lane). (B) Relative distribution of Glut4 and sortilin between fractions. Presence of each protein in total lysates (L) of wild-type and CRISPR/Cas9-edited 3T3-L1 adipocytes is 100%. **p < 0.01; *p < 0.05. Results were analyzed by Student’s t test. A representative result of three independent experiments. (C) Wild- type (top) and CRISPR/Cas9-edited (bottom) 3T3-L1 adipocytes were incubated with LysoTracker, fixed, and stained with rabbit polyclonal antibody against Glut4, followed by FITC-conjugated donkey anti-rabbit IgG, and analyzed by double immunofluorescence.

DISCUSSION

Sortilin and MPR represent multiligand sorting receptors that are known to be involved in anterograde transport of lysosomal enzymes and substrates (Bonifacino and Rojas, 2006; Burd, 2011; Coutinho ). It is usually believed, within the framework of this model, that both sortilin and MPR carry their ligands from the TGN to endosomes and are retrieved back to TGN “empty handed”—that is, not carrying any ligand. The central finding of our study is that sortilin transports Glut4 in the opposite, retrograde, direction, thus rerouting the transporter from the degradative to the recycling pathway. In other words, sortilin may target one set of ligands from the TGN to endosomes and a different set of ligands (in our experiments, Glut4) back from endosomes to the TGN. Another substantial finding is that interaction of sortilin with retromer plays a central role in the retrograde traffic of Glut4. In undifferentiated 3T3-L1 preadipocytes, which express retromer but not sortilin, ectopically expressed Glut4 has a short half-life (Shi and Kandror, 2005; Liu ) and is found largely in endosomes/lysosomes (Figure 1). Overexpression of sortilin together with Glut4 in undifferentiated cells stabilizes Glut4 and reroutes it to the recycling pathway (Figure 5; Shi and Kandror, 2005). On the contrary, knockdown of sortilin or retromer decreases the half-life of Glut4 and blocks its delivery to the insulin-responsive vesicular compartment. Mechanistically, sortilin binds to the first luminal loop of Glut4 via its luminal Vps10p domain, thus recruiting Glut4 to the retromer-dependent retrograde trafficking machinery. In a recent report, Yang ) suggested that retromer in conjunction with SNX27 mediates insulin-dependent translocation of Glut4 to the plasma membrane. Although we cannot exclude this possibility, we did not detect significant translocation of retromer to the plasma membrane in response to insulin stimulation (unpublished data). Thus we favor a model according to which retromer delivers the sortilin/Glut4 complex from endosomes to the TGN, where the IRVs are formed. Previously we showed that sortilin plays an important role not only in Glut4 retrieval from endosomes, as demonstrated here, but also in the process of IRV formation on donor TGN membranes (Huang ). Of interest, the adaptor proteins that mediate formation of the IRVs are likely to be Golgi-localized, γ-ear-containing, Arf-binding proteins (GGAs; Li and Kandror, 2005). In other words, retromer is responsible for the formation of Glut4/sortilin-containing endosome-to-TGN transport carriers (see also Mari ), whereas GGAs may drive the formation of the IRVs on the TGN. We believe that our findings are physiologically significant because a strong reverse correlation between levels of sortilin expression and insulin resistance has been revealed by several research groups. Thus exposure of cultured cells to saturated fatty acids (Tsuchiya ; Bi ) or inhibitors of phosphoinositide 3-kinase and Akt (Li ) decreases sortilin expression in vitro. In vivo, expression of sortilin is attenuated in ob/ob, db/db, and high fat diet–fed mice (Keller ; Kaddai ; Ai ) and obese humans (Kaddai ; Bi ). By the same token, expression of Vps35 is decreased in mouse models of diabetes (Morabito ), and a recent genome-wide association study identified a type 2 diabetes–related single-nucleotide polymorphism at the Vps26 locus (Kooner ). Thus sortilin- and retromer-mediated Glut4 retrieval from endosomes may represent a “weak” step in the Glut4 pathway susceptible to the development of insulin resistance and diabetes.

MATERIALS AND METHODS

Reagents and antibodies

Insulin and other chemicals were obtained from Sigma-Aldrich (St, Louis, MO). Bovine serum and fetal bovine serum (FBS) were from Atlanta Biologicals (Lawrenceville, GA). DMEM, Opti-MEM, and Dulbecco’s phosphate-buffered saline (PBS) were purchased from Invitrogen (Carlsbad, CA). [3H]2-Deoxyglucose was purchased from PerkinElmer (Waltham, MA). Mouse monoclonal antibodies against the myc epitope and β-actin, rabbit polyclonal antibodies against cyclophilin A, Akt, phospho-Akt (Ser-473), phospho-Akt (Thr-308), and phospho-AS160 (Thr-642) were from Cell Signaling Technology (Danvers, MA). Rabbit polyclonal antibodies against the myc epitope, sortilin, Vps26, and Glut4 were from Abcam (Cambridge, MA), against Vps29 from Novus Biologicals (Littleton, CO), and against GST from Millipore (Billerica, MA). Mouse monoclonal antibody against sortilin, syntaxin 6, and SNX2 and rabbit polyclonal antibody against caveolin 1 were from BD Bioscience Pharmingen (San Diego, CA). Goat polyclonal antibody against Vps35 was from Imgenex (San Diego, CA). Chicken polyclonal antibody against the C-terminus of AS160/TBC1D4 (HPTNDKAKAGNKP), generated by Quality Controlled Biochemicals (Hopkinton, MA), was a kind gift of Michael Czech (University of Massachusetts Medical School). Horseradish peroxidase (HRP)–conjugated anti-mouse and anti-rabbit immunoglobulin G (IgG) were from Cell Signaling Technology. HRP-conjugated anti-goat IgG, fluorescein isothiocyanate (FITC)–conjugated donkey anti-rabbit antibody, Texas red–conjugated donkey anti-mouse antibody, Alexa Fluor 647–conjugated donkey anti-mouse antibody, Alexa Fluor 546–conjugated donkey anti-goat antibody, LysoTracker Red DND-99, ProLong Gold Antifade Mountant with DAPI, and Halt Protease and Phosphatase Inhibitor Cocktail were from Thermo Fisher Scientific (Waltham, MA).

Stable cell lines

Preparation, culturing, and differentiation of 3T3-L1 cells stably transfected with pBabe-myc7-Glut4, mLNCX2-sortilin-myc/His, and double transfected with pBabe-myc7-Glut4 and mLNCX2-sortilin-myc/His, as well as cells depleted of sortilin with the help of pBabe–short hairpin RNA, were described previously (Shi and Kandror, 2005). Cells were grown in DMEM containing 10% calf bovine serum. Two days after confluence, cells were transferred to the differentiation medium (DMEM with 10% FBS, 0.174 μM insulin, 1 μM dexamethasone, and 0.5 mM 3-isobutyl-1-methylxanthine). After 48 h, differentiation medium was replaced with DMEM containing 10% FBS.

Immunofluorescence

Undifferentiated and differentiated 3T3-L1 cells were grown on coverslips coated with collagen IV (Sigma-Aldrich). Serum-starved cells were fixed with 4% paraformaldehyde in PBS (pH 7.4) for 10 min and permeabilized with 0.2% Triton X-100 for 3 min at room temperature. After blocking with 5% donkey serum for 1 h, cells were stained overnight at 4°C with primary antibodies, followed by incubation with secondary antibody for 1 h at room temperature. In several experiments, cells before fixing were incubated with LysoTracker (0.4 μM) for 40 min at 37°C. Antifade solution was used for mounting cells on slides. Slides were examined with the help of the Axio Observer Z1 fluorescence microscope equipped with the Hamamatsu digital camera C10600/ORCA-R2 and AxioVision 4.8.1 program (Carl Zeiss, Thornwood, NY). Each scale bar is 5 μm. Each image shows a representative result of at least three independent experiments.

GST pull-down experiments with the C-terminus of sortilin

The 252–base pair oligonucleotide corresponding to the cytoplasmic C-terminus of human sortilin was amplified by PCR from the full-length sortilin cDNA (purchased from OriGene, Rockville, MD) using the forward primer 5′-CGGGGTACCAAACAGA­ATTCCAA­GTCA-3′ and the reverse primer 5′-CGCGGATCCTATTCCAAGAGGTCCTCATC-3′ (underlined sequences represent the KpnI and BamHI restriction sites). Amplified sequence was cloned into the pGEM-T vector (Promega, Madison, WI). For bacterial expression, pET-42a vector (with the GST-His tag; Millipore) and pGEM-T vector with the sortilin C-terminus were digested with KpnI and BamHI. A digested fragment corresponding to the sortilin tail, as well as pET-42a vector, was gel purified, ligated and transformed into Escherichia coli BL21-CodonPlus (DE3)-RIPL strain (Agilent Technologies, Santa Clara, CA) according to manufacturer’s instructions. Individual colonies were grown overnight in 10 ml of Luria–Bertani broth (LB; 10 g/l tryptone, 5 g/l yeast extract, 10 g/l NaCl, pH 7.5). The overnight culture was added to fresh LB (1:100 vol) containing 1 mM of isopropyl β-d-1 thiogalactopyranoside, incubated at 37°C for 5 h at 250 rpm, and pelleted. The cell pellet was resuspended in PBS with protease inhibitor cocktail, sonicated three times for 45 s on ice, and centrifuged at 12,000 rpm for 10 min. The supernatant was then incubated with Glutathione Sepharose 4B beads (GE Healthcare LifeSciences, Pittsburgh, PA) at 4°C overnight on an orbital shaker. Beads were then washed three times with PBS. 3T3L1 adipocytes were serum starved for 4 h and treated with either insulin (100 nM) or carrier (5 µM HCl) for 15 min. Cells were washed and collected in PBS with protease inhibitor cocktail and homogenized with 10 strokes through the ball-bearing cell cracker (Isobiotec, Heidelberg, Germany). Homogenates were then centrifuged at 200,000 × g for 2 h. The supernatant was then incubated with GST-sortilin C-terminus- as well as control GST-glutathione beads overnight at 4°C on an orbital shaker. On the next day, beads were washed with PBS three times and eluted with Laemmli sample buffer, and eluted proteins were analyzed by Western blotting.

Binding of sortilin to the first luminal loop of Glut4

A myc-tagged (underlined) peptide corresponding to the first luminal loop of Glut4 EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA was synthesized by GeneScript (Piscataway, NJ). Wild-type and S 3T3-L1 preadipocytes were lysed in 30 mM NaCl, 10 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES), 5% glycerol, 0.5% Triton X-100, and 10 mM imidazole with protease inhibitors at pH 7.4, and cell lysates were incubated with HisPur cobalt resin (Thermo Scientific, Grand Island, NY) for 90 min on an orbital shaker at 4°C. Beads were washed four times with washing buffer (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, and 20 mM imidazole) with pH 6.5 or 8 and incubated with the peptide (100 ng in 100 µl) in the washing buffer with the corresponding pH for 30 min at 4°C. After that, the beads were washed four times with the washing buffer at pH 6.5 or 8. The proteins were eluted with tricine sample buffer (Bio-Rad, Hercules, CA). Eluates were analyzed by electrophoresis in tricine gradient gels (10–20%), followed by Western blotting with anti-myc antibody.

Cross-linking and isolation of His-tagged proteins

Cross-linking was performed as previously described (Shi and Kandror, 2005) with minor modifications. Briefly, cells were washed twice with PBS and once with KRP buffer (12.5 mM HEPES, 120 mM NaCl, 6 mM KCl, 1.2 mM MgSO4, 1.0 mM CaCl2, 0.6 mM Na2HPO4, 0.4 mM NaH2PO4, 2.5 mM d-glucose, pH 7.4), and DSP was added to final concentration 2 mM for 30 min at room temperature. Then quenching buffer (50 mM Tris, 150 mM NaCl, pH 7.4) was added for 15 min at 4°C, followed by two washes with the same buffer. Cells were lysed in lysis buffer (10 mM HEPES, 30 mM NaCl, 5% glycerol, 10 mM imidazole, 0.5% Triton X-100, pH 7.4) with the protease inhibitor cocktail specialized for the isolation of His-tagged proteins (Thermo Fisher Scientific), and cell lysates were cleared by centrifugation at 16,000 × g for 20 min. The lysate was incubated with the HisPur cobalt resin at 4°C for 4 h with rotation and then washed four times with wash buffer (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 20 mM imidazole, pH 7.4). Elution was carried out with elution buffer (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 300 mM imidazole, pH 7.4) with 50 mM dithiothreitol at 37°C for 30 min, and eluted proteins were analyzed by Western blotting.

CRISPR/Cas9 genome editing

Genomic editing was performed in 3T3-L1 preadipocytes using the CRISPR/Cas9 system as previously described (Sanjana ). Briefly, four single guide RNAs (sgRNAs) targeting exons 2–5 of the Vps35 gene (5′-ATGACTGAACCTTCACAGCC -3′, 5′-GAGCTCTCCAAGCATATTGG-3′, 5′-TGATGAACTGCACTAC­TTGG-3′, and 5′-GATTTGGTAGAAATGTGCCG-3′, respectively) were designed using online software (http://crispr.mit.edu; http://chopchop.cbu.uib.no). The lentiCRISPR v2 plasmid (52961; Addgene) was used to express sgRNAs and the Cas9 protein along with the envelope plasmid pCMV-VSV-G and the packaging plasmid psPAX2. Cells infected with lentiviruses were treated with puromycin (3 μg/ml) for the selection of stable transfectants, and single-cell colonies were isolated and grown in the medium with 3 μg/ml puromycin. The genomic region surrounding the sgRNA target site was amplified by PCR and sequenced. The primers used for the PCR were as follows: 2F, TCCTACCACAGGTTTCTTT­GATGCC; 2R, TCAGGGCTCTTTGTTCCTGAGTCTC; 3F, TAT­AG­CCCTGGTGAGGAGTTAGGC; 3R, ATCCATTTCAGAGGAG­GCA­GGGTG; 4F, CCATGGACCTCTCTCTGTGCCAGG; 4R, ATGTCT­CTGCAGCTAAGTGCTGGGA; 5F, GGGACTGACCACTGAAATCA­GTCA; and 5R, CAGTGAGTAC­CAGCCACTCAAAGCC.

Measurements of protein stability

Aqueous solutions of cycloheximide (50 μg/ml) or emetine (10 μM) with or without bafilomycin A (100 nM) were added to plates at time zero. At the indicated time intervals, the cells were rinsed three times with PBS and harvested in ice-cold RIPA buffer (Millipore) with the protease inhibitor cocktail. Cell lysates were vortexed, rotated at 4°C for 30 min, and spun for 20 min at 16,000 × g in a microcentrifuge at 4°C. The presence of the individual proteins in supernatants was analyzed by Western blotting.

[3H]2-deoxyglucose uptake

This assay was performed in six-well plates. Cells were washed three times with serum-free DMEM, starved for 4 h, washed twice with warm Krebs-Ringer-HEPES (KRH) buffer without glucose (121 mM NaCl, 4.9 mM KCl, 1.2 mM MgSO4, 0.33 mM CaCl2, 12 mM HEPES, pH 7.4), and treated with either 100 nM insulin or carrier (5 µM HCl) at 37°C for 15 min. Radioactive 2-deoxyglucose (0.1 mM, 0.625 μCi/ml) was added to cells for 5 min. The assay was terminated by aspirating the radioactive medium and the cells were washed three times with 2 ml of ice-cold KRH containing 25 mM d-glucose. Each well was then extracted with 400 μl of 0.1% SDS in KRH buffer without glucose, and 300-μl aliquots were removed for determination of radioactivity by liquid scintillation counting. Measurements were made in triplicate and corrected for specific activity and nonspecific diffusion (as determined in the presence of 5 μM cytochalasin B), which was <5% of the total uptake. The protein concentration was determined using the BCA Protein Assay Kit (Thermo Fisher Scientific) and used to normalize counts.

Subcellular fractionation of 3T3-L1 cells

3T3-Ll adipocytes or preadipocytes were washed three times with serum-free DMEM, warmed to 37°C, and starved in the same medium for 2 h. Cells were treated with 100 nM insulin or carrier (5 mM HCl at 1000 × dilution) in DMEM for 15 min at 37°C. Cells were then washed three times with cold HES buffer (250 mM sucrose, 20 mM HEPES, 1 mM EDTA, pH 7.4) with protease inhibitor cocktail and harvested in the same buffer (0.3–1 ml/10-cm dish). Homogenization was performed in a ball-bearing homogenizer (Isobiotec) with a 12-µm clearance by 10 strokes for adipocytes and 15 strokes for preadipocytes. Homogenates were centrifuged at 14,000 × g for 20 min (P1). Membrane vesicles in supernatants (P2) were concentrated by pelleting at 200,000 × g for 90 min. Pellets were resuspended in 0.1–0.25 ml of HES buffer.

Gel electrophoresis and Western blotting

Proteins were separated in SDSpolyacrylamide gels according to Laemmli (1970) and transferred to Immobilon-P membranes (Millipore). After transfer, the membrane was blocked with 5% BSA in PBS with 0.5% Tween 20 for 1 h. Blots were probed overnight with specific primary antibodies at 4°C, followed by 1-h incubation at room temperature with HRP-conjugated secondary antibodies. Protein bands were detected with the enhanced chemiluminescence substrate kit (PerkinElmer Life Sciences, Boston, MA) using a Bio-Rad ChemiDoc XRS+ System (Hercules, CA).
  46 in total

Review 1.  Glucose transporters and insulin action--implications for insulin resistance and diabetes mellitus.

Authors:  P R Shepherd; B B Kahn
Journal:  N Engl J Med       Date:  1999-07-22       Impact factor: 91.245

2.  The SUMO conjugating enzyme Ubc9 is a regulator of GLUT4 turnover and targeting to the insulin-responsive storage compartment in 3T3-L1 adipocytes.

Authors:  Li-Bin Liu; Waka Omata; Itaru Kojima; Hiroshi Shibata
Journal:  Diabetes       Date:  2007-05-29       Impact factor: 9.461

3.  Cleavage of structural proteins during the assembly of the head of bacteriophage T4.

Authors:  U K Laemmli
Journal:  Nature       Date:  1970-08-15       Impact factor: 49.962

4.  Activation of ER stress and mTORC1 suppresses hepatic sortilin-1 levels in obese mice.

Authors:  Ding Ai; Juan M Baez; Hongfeng Jiang; Donna M Conlon; Antonio Hernandez-Ono; Maria Frank-Kamenetsky; Stuart Milstein; Kevin Fitzgerald; Andrew J Murphy; Connie W Woo; Alanna Strong; Henry N Ginsberg; Ira Tabas; Daniel J Rader; Alan R Tall
Journal:  J Clin Invest       Date:  2012-04-02       Impact factor: 14.808

5.  Palmitate-induced down-regulation of sortilin and impaired GLUT4 trafficking in C2C12 myotubes.

Authors:  Yo Tsuchiya; Hiroyasu Hatakeyama; Natsumi Emoto; Fumie Wagatsuma; Shinichi Matsushita; Makoto Kanzaki
Journal:  J Biol Chem       Date:  2010-08-30       Impact factor: 5.157

6.  Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.

Authors:  Jaspal S Kooner; Danish Saleheen; Xueling Sim; Joban Sehmi; Weihua Zhang; Philippe Frossard; Latonya F Been; Kee-Seng Chia; Antigone S Dimas; Neelam Hassanali; Tazeen Jafar; Jeremy B M Jowett; Xinzhong Li; Venkatesan Radha; Simon D Rees; Fumihiko Takeuchi; Robin Young; Tin Aung; Abdul Basit; Manickam Chidambaram; Debashish Das; Elin Grundberg; Asa K Hedman; Zafar I Hydrie; Muhammed Islam; Chiea-Chuen Khor; Sudhir Kowlessur; Malene M Kristensen; Samuel Liju; Wei-Yen Lim; David R Matthews; Jianjun Liu; Andrew P Morris; Alexandra C Nica; Janani M Pinidiyapathirage; Inga Prokopenko; Asif Rasheed; Maria Samuel; Nabi Shah; A Samad Shera; Kerrin S Small; Chen Suo; Ananda R Wickremasinghe; Tien Yin Wong; Mingyu Yang; Fan Zhang; Goncalo R Abecasis; Anthony H Barnett; Mark Caulfield; Panos Deloukas; Timothy M Frayling; Philippe Froguel; Norihiro Kato; Prasad Katulanda; M Ann Kelly; Junbin Liang; Viswanathan Mohan; Dharambir K Sanghera; James Scott; Mark Seielstad; Paul Z Zimmet; Paul Elliott; Yik Ying Teo; Mark I McCarthy; John Danesh; E Shyong Tai; John C Chambers
Journal:  Nat Genet       Date:  2011-08-28       Impact factor: 38.330

7.  Hyperleucinemia causes hippocampal retromer deficiency linking diabetes to Alzheimer's disease.

Authors:  Michael V Morabito; Diego E Berman; Remy T Schneider; Yiying Zhang; Rudolph L Leibel; Scott A Small
Journal:  Neurobiol Dis       Date:  2014-01-14       Impact factor: 5.996

8.  The clathrin heavy chain isoform CHC22 functions in a novel endosomal sorting step.

Authors:  Christopher Esk; Chih-Ying Chen; Ludger Johannes; Frances M Brodsky
Journal:  J Cell Biol       Date:  2010-01-11       Impact factor: 10.539

9.  Identification of a novel conserved sorting motif required for retromer-mediated endosome-to-TGN retrieval.

Authors:  Matthew N J Seaman
Journal:  J Cell Sci       Date:  2007-07-15       Impact factor: 5.285

10.  Cargo-selective endosomal sorting for retrieval to the Golgi requires retromer.

Authors:  Matthew N J Seaman
Journal:  J Cell Biol       Date:  2004-04       Impact factor: 10.539

View more
  34 in total

Review 1.  Thirty sweet years of GLUT4.

Authors:  Amira Klip; Timothy E McGraw; David E James
Journal:  J Biol Chem       Date:  2019-06-07       Impact factor: 5.157

2.  Detection of Detergent-sensitive Interactions Between Membrane Proteins.

Authors:  Nava Zaarur; Xiang Pan; Konstantin V Kandror
Journal:  J Vis Exp       Date:  2018-03-07       Impact factor: 1.355

3.  Tankyrase modulates insulin sensitivity in skeletal muscle cells by regulating the stability of GLUT4 vesicle proteins.

Authors:  Zhiduan Su; Vinita Deshpande; David E James; Jacqueline Stöckli
Journal:  J Biol Chem       Date:  2018-04-18       Impact factor: 5.157

Review 4.  Endosomal trafficking in metabolic homeostasis and diseases.

Authors:  Jerome Gilleron; Anja Zeigerer
Journal:  Nat Rev Endocrinol       Date:  2022-10-10       Impact factor: 47.564

5.  Metabolomic Analysis of Serum and Tear Samples from Patients with Obesity and Type 2 Diabetes Mellitus.

Authors:  Erdenetsetseg Nokhoijav; Andrea Guba; Ajneesh Kumar; Balázs Kunkli; Gergő Kalló; Miklós Káplár; Sándor Somodi; Ildikó Garai; Adrienne Csutak; Noémi Tóth; Miklós Emri; József Tőzsér; Éva Csősz
Journal:  Int J Mol Sci       Date:  2022-04-20       Impact factor: 6.208

6.  An Allosteric Binding Site on Sortilin Regulates the Trafficking of VLDL, PCSK9, and LDLR in Hepatocytes.

Authors:  Robert P Sparks; Andres S Arango; Jermaine L Jenkins; Wayne C Guida; Emad Tajkhorshid; Charles E Sparks; Janet D Sparks; Rutilio A Fratti
Journal:  Biochemistry       Date:  2020-11-05       Impact factor: 3.162

7.  Usp25m protease regulates ubiquitin-like processing of TUG proteins to control GLUT4 glucose transporter translocation in adipocytes.

Authors:  Estifanos N Habtemichael; Don T Li; Abel Alcázar-Román; Xavier O Westergaard; Muyi Li; Max C Petersen; Hanbing Li; Stephen G DeVries; Eric Li; Omar Julca-Zevallos; Joseph S Wolenski; Jonathan S Bogan
Journal:  J Biol Chem       Date:  2018-05-17       Impact factor: 5.157

8.  Inducible Exoc7/Exo70 knockout reveals a critical role of the exocyst in insulin-regulated GLUT4 exocytosis.

Authors:  Shifeng Wang; Lauren Crisman; Jessica Miller; Ishara Datta; Daniel R Gulbranson; Yuan Tian; Qian Yin; Haijia Yu; Jingshi Shen
Journal:  J Biol Chem       Date:  2019-11-18       Impact factor: 5.157

9.  Sortilin restricts secretion of apolipoprotein B-100 by hepatocytes under stressed but not basal conditions.

Authors:  Donna M Conlon; Carolin V Schneider; Yi-An Ko; Amrith Rodrigues; Kathy Guo; Nicholas J Hand; Daniel J Rader
Journal:  J Clin Invest       Date:  2022-03-15       Impact factor: 14.808

10.  Dimerization of sortilin regulates its trafficking to extracellular vesicles.

Authors:  Shinsuke Itoh; Ken Mizuno; Masanori Aikawa; Elena Aikawa
Journal:  J Biol Chem       Date:  2018-01-30       Impact factor: 5.157

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.