Literature DB >> 28303145

Evolutionary Analyses of GRAS Transcription Factors in Angiosperms.

Alberto Cenci1, Mathieu Rouard1.   

Abstract

GRAS transcription factors (TFs) play critical roles in plant growth and development such as gibberellin and mycorrhizal signaling. Proteins belonging to this gene family contain a typical GRAS domain in the C-terminal sequence, whereas the N-terminal region is highly variable. Although, GRAS genes have been characterized in a number of plant species, their classification is still not completely resolved. Based on a panel of eight representative species of angiosperms, we identified 29 orthologous groups or orthogroups (OGs) for the GRAS gene family, suggesting that at least 29 ancestor genes were present in the angiosperm lineage before the "Amborella" evolutionary split. Interestingly, some taxonomic groups were missing members of one or more OGs. The gene number expansion usually observed in transcription factors was not observed in GRAS while the genome triplication ancestral to the eudicots (γ hexaploidization event) was detectable in a limited number of GRAS orthogroups. We also found conserved OG-specific motifs in the variable N-terminal region. Finally, we could regroup OGs in 17 subfamilies for which names were homogenized based on a literature review and described 5 new subfamilies (DLT, RAD1, RAM1, SCLA, and SCLB). This study establishes a consistent framework for the classification of GRAS members in angiosperm species, and thereby a tool to correctly establish the orthologous relationships of GRAS genes in most of the food crops in order to facilitate any subsequent functional analyses in the GRAS gene family. The multi-fasta file containing all the sequences used in our study could be used as database to perform diagnostic BLASTp to classify GRAS genes from other non-model species.

Entities:  

Keywords:  GRAS gene family; plant evolution; transcription factors

Year:  2017        PMID: 28303145      PMCID: PMC5332381          DOI: 10.3389/fpls.2017.00273

Source DB:  PubMed          Journal:  Front Plant Sci        ISSN: 1664-462X            Impact factor:   5.753


Introduction

Deep understanding of physiological mechanisms, biochemical reaction pathways or gene functions is required to improve plant performance, quality of production and environmental adaptability. However, most crops have features that constrain efficient experimentation (e.g., long generation time or large space needed for development). To circumvent these difficulties, physiological studies have been mostly performed on model plants chosen for their convenient experimental management. In particular, Arabidopsis thaliana, a small and short-lived plant belonging to the Brassicaceae family, is the model species most commonly used in plant research laboratories. Other plant species have been used as models to study more specific traits in taxonomic groups distantly related to A. thaliana or to study features not present in the model plant species. For instance, rice (Oryza sativa) has been extensively studied as a model for the Poales order (including other species having capital importance for human food security such as wheat, maize or sorghum) and Medicago truncatula as a model plant for symbiotic interactions between plant roots and nitrogen-fixing microorganisms. As knowledge gained on model species can be transferred to crops of interest, it is fundamental to establish the orthology relationships between the genes of the model and the species of interest. In fact, even if the orthology is not a guarantee for function conservation, orthologous genes remain the best candidates for functional annotation transfer. Various automated approaches have been developed and proposed for identifying orthologous groups (OGs) that are particularly accurate for single-copy genes of small OGs (Trachana et al., 2011; Altenhoff et al., 2013). However, for genes belonging to multigene families, such as plant transcription factors, the definition of orthologous relationships is a more challenging task (Conte et al., 2008). The first requirement is the availability of the gene sequences for all the members of a given gene family in the studied species. The availability of complete quality genome sequences now makes it possible to perform unbiased and comprehensive comparisons. In this study, we explored the evolution of the GRAS, a protein family that is involved in a wide range of different functions in plants. GRAS proteins appeared in land plants by lateral transfer from bacteria and underwent radiation in ancestors of bryophytes, lycophytes and higher plants (Zhang et al., 2012). Its name was derived from its first three identified members: GAI, RGA, and SCR (Pysh et al., 1999). It was suggested that GRAS proteins can act as transcription factors (Bolle, 2004; Hirsch and Oldroyd, 2009). The GRAS genes are almost all mono-exonic and encode for proteins with lengths between 360 and 850 amino acids (Supplementary Data 1). Several motifs have been recognized in their carboxyl (C-) termini: leucine heptad repeat I (LHR I), VHIID, leucine heptad repeat II (LHR II), PFYRE, and the SAW motifs. These five motifs constitute the GRAS domain. In contrast, the amino (N-) terminal part of GRAS proteins appears hypervariable (Pysh et al., 1999) and composed of intrinsically disordered domains that are involved in molecular recognition (Sun et al., 2011, 2012). Several genome-wide analyses have been conducted on the GRAS family: in A. thaliana (Lee et al., 2008), in both A. thaliana and O. sativa (Tian et al., 2004), in Brassica rapa (Song et al., 2014), in Pinus radiata (Abarca et al., 2014), in Prunus mume (Lu et al., 2015), in Populus trichocarpa (Liu and Widmer, 2014), in Solanum lycopersicum (Huang et al., 2015), Vitis vinifera (Grimplet et al., 2016; Sun et al., 2016), in Phyllostachys edulis (Zhao et al., 2016), in Ricinus communis (Xu et al., 2016), in Nelumbo nucifera (Wang et al., 2016) and on a selected panel of plants, including A. thaliana, O. sativa, Brachypodium distachyon, P. trichocarpa, Glycine max, Selaginella moellendorffii, and Physcomitrella patens (Wu et al., 2014). The GRAS family has been usually divided into subfamilies such as DELLA, HAM, LS, LISCL, NSP2, PAT1, SCR, SCL3, and SHR. However, all these studies reported a different number of subfamilies (8–13) defined on their respective phylogenetic results. In order to establish a consistent framework for the classification of GRAS members in angiosperm species, we performed a genome-wide study of the GRAS genes by reconstructing their evolutionary history and defining orthologous groups (Kuzniar et al., 2008) in the monocots' and dicots' lineages. An orthologous group includes all the gene family members derived from a common ancestor gene existing before the radiation of the considered species. In this study we considered the split between monocots and dicots as the reference to define the frameshift of orthology relationships. We selected eight species that we considered representative of the angiosperms because of their plant model status, the absence of lineage-specific whole genome duplications and/or their critical position in angiosperms, balanced between monocots and dicots. For monocots: Musa acuminata (Zingiberales), Phoenix dactylifera (Arecales) and O. sativa (model species and Poales); for dicots: A. thaliana (model species), V. vinifera, Theobroma cacao (rosids) and Coffea canephora (asterid); and Amborella trichopoda as the basal angiosperm and outgroup for monocots and dicots phylogenies. Here we identify and define orthogroups that are then individually discussed.

Materials and methods

Data sets

An initial cluster set of 413 protein sequences annotated in genomes of Arabidopsis thaliana (Kaul et al., 2000), Vitis vinifera (Jaillon et al., 2007), Theobroma cacao (Argout et al., 2011), Coffea canephora (Denoeud et al., 2014), Phoenix dactylifera (Al-Mssallem et al., 2013), Oryza sativa (Sequencing Project International Rice Genome, 2005), Musa acuminata (D'Hont et al., 2012), and Amborella trichopoda (Albert et al., 2013) were retrieved from GreenPhylDB (http://www.greenphyl.org/) (Rouard et al., 2011). All sequences were revised, compared to GenBank protein databases and, when needed, corrected and integrated with previously published studies to produce a subset of 397 validated sequences (Supplementary Data 1 and Supplementary Table 1).

Detection of orthologous groups (OGs) and their organization in subfamilies

The manually curated inference of OGs was performed on the basis of reciprocal BLASTp analyses, as described in Cenci et al. (2014). Briefly, a BLASTp analysis was performed for each GRAS sequence on protein databases of the studied species; for each species, proteins with best scores were grouped and those belonging to the OG confirmed by reciprocal BLASTp. In the case of species missing representatives in one or more OG, BLASTp analyses were performed on “nr” protein database (All non-redundant GenBank CDS translations + PDB + SwissProt + PIR + PRF excluding environmental samples from WGS projects) to look for the presence of OG members in wider taxonomic groups. In order to be consistent with GRAS classification in previous studies and to have a more detailed picture of the GRAS family in angiosperms, subfamilies were established. A subfamily is usually defined as a group of sequence displaying a significant degree a sequence similarity, regardless of phylogenetic events. Here, a subfamily is considered with regards to the orthogroups it contains. Consequently, as higher classification rank of OG, a subfamily can include one to several OGs. The subfamily names were defined based on the name assigned to the first described gene. The names of OGs included in a same subfamily were differentiated by a hyphen and a number (Table 1). Hyphens and numbers were not added in non-assembled OGs (in these cases a subfamily included only one OG).
Table 1

Numbers of GRAS genes of the studied species assigned to each OG.

Orthologous groupAmbMaPdOsVvTcAtCcTot
OG-SCR-11322111112
OG-SCR-221211111*10
OG-SCR-31a11*11b16
OG-SHR-11322111112
OG-SHR-2132c11b19
OG-SCL32-11321111*111
OG-SCL32-2111111b28
OG-NSP11121*11119
OG-LS1*442*111115
OG-SCL4/71321112112
OG-NSP2-1112111119
OG-NSP2-21a121db1*6
OG-NSP2-31eee32b28
NSP2-Amb22
OG-HAM-II1745223226
OG-HAM-I132c111110
OG-DELLA-11*4*2122*52*19
OG-DELLA-2112211b19
OG-PAT-11323334221
OG-PAT-214211*1f111
OG-PAT-31311211111
OG-PAT-47*22*111115
OG-SCL31339*3*31225
OG-RAD1-11111*22b210
OG-RAD1-21a1c11bg4
OG-RAM11*11111b17
OG-DLT13*21*111111
OG-SCLA122111b210
OG-SCLB4*a5c1*3b5*18
OG-LISCL17413*11*7711*61
Total3472595649443350397

Indicates presence of remnant(s) in the genome.

Missing in M. acuminata.

Missing in Brassicales.

Missing in Poales.

Missing in Malvales.

Missing in monocots.

Missing in Brassicaceae but present in other Brassicales.

Missing in C. canephora.

Os, Oryza sativa; At, Arabidopsis thaliana; Amb, Amborella trichopoda; Ma, Musa acuminata; Pd, Phoenix dactylifera; Vv, Vitis vinifera; Tc, Theobroma cacao; Cc, Coffea canephora.

Numbers of GRAS genes of the studied species assigned to each OG. Indicates presence of remnant(s) in the genome. Missing in M. acuminata. Missing in Brassicales. Missing in Poales. Missing in Malvales. Missing in monocots. Missing in Brassicaceae but present in other Brassicales. Missing in C. canephora. Os, Oryza sativa; At, Arabidopsis thaliana; Amb, Amborella trichopoda; Ma, Musa acuminata; Pd, Phoenix dactylifera; Vv, Vitis vinifera; Tc, Theobroma cacao; Cc, Coffea canephora.

Phylogenetic analyses

A phylogenetic reconstruction was performed for each OG, using all the GRAS sequences identified for each OG in the eight studied species. The phylogenetic analysis of the complete GRAS family was performed using all the member sequences of eight studied species and also with A. trichopoda, V. vinifera, and P. dactylifera. For both, protein sequences were aligned with MAFFT program (Katoh and Standley, 2013) via the EMBL-EBI bioinformatics interface (Li et al., 2015) using default parameters. Conserved blocks were extracted from the alignments with Gblocks (http://molevol.cmima.csic.es/castresana/Gblocks_server.html) (Castresana, 2000). The analysis was performed by allowing: (i) smaller final blocks, (ii) gap positions within the final blocks, and (iii) less strict flanking positions. Phylogenetic trees were built with PhyML (Guindon et al., 2009) available at http://phylogeny.lirmm.fr/ (Dereeper et al., 2008) using an LG substitution model and an Approximate Likelihood-Ratio Test (aLRT) as statistical tests for branch support. Phylogenetic trees were visualized with MEGA6 (Tamura et al., 2013) and iTOL (http://itol.embl.de/) (Letunic and Bork, 2016).

Conserved domain analysis

All OGs were scanned separately with MEME search using MEME v4.10 up to 10 domains (Bailey et al., 2015). One representative corresponding to the sequence with the smallest genetic distance in the gene tree for each OG was selected and a new MEME search was applied with domain limit up to 30.

Syntenic analyses

The location of the genes in syntenic blocks was retrieved using SynMap program (http://genomevolution.org/CoGe/SynMap.pl) obtained using a default parameter (Lyons et al., 2008) except for C. canephora which was studied with the Coffee Genome Hub (http://coffee-genome.org/syntenic_dotplot) (Dereeper et al., 2015).

Results

All protein sequences annotated as GRAS in eight angiosperm species were manually curated and, where necessary, gene structure corrections of the sequences were performed. A total of 397 sequences were retained for this study (Supplementary Data 1 and Supplementary Table 1). Twenty-nine orthologous groups (OGs) were defined for the GRAS gene family in our panel of species (Table 1; Figure 1; Supplementary Table 1). The GRAS sequences used in this study were stored in GreenPhylDB (http://www.greenphyl.org/cgi-bin/custom_family.cgi?p=id&custom_family_id=158789) (Rouard et al., 2011) and organized in OGs and in subfamilies. Specific gene losses were observed for some OGs, especially involving A. thaliana for which genes were absent in 12 OGs.
Figure 1

GRAS Gene distribution by orthogroup in 8 plant species. Numbers in the matrix represent the number of genes by OG specified in the header (with the exception of NSP2-AMB). The gradient color from yellow to red illustrates the abundance of genes. The WGD involving the ancestor of all the studied dicot species (γ event, hexaploidization) is indicated by an orange square.

GRAS Gene distribution by orthogroup in 8 plant species. Numbers in the matrix represent the number of genes by OG specified in the header (with the exception of NSP2-AMB). The gradient color from yellow to red illustrates the abundance of genes. The WGD involving the ancestor of all the studied dicot species (γ event, hexaploidization) is indicated by an orange square. A phylogenetic tree was built with the 397 GRAS protein sequences, belonging to the eight species studied (Figure 2). The phylogenetic tree was computed with 151 aligned positions, all belonging to the GRAS domain. Overall, the results were consistent with the OG definition but few exceptions were observed. HAM and NSP2 Subfamilies were not resolved. The HAM subfamily (OG-HAM-I and OG-HAM-II clusters) were included in a cluster with OG-NSP2-1 (aLRT support only 0.5) whereas the OG-NSP2-2 and OG-NSP2-3 formed another cluster with two Amborella sequences unassigned to any OG. Concerning the subfamily SHR, OG-SHR-2 sequences formed a cluster whereas OG-SHR-1 was not resolved as the sequences split in one monocot and one dicot cluster with an isolated Amborella sequence. The branch support of the most of the clusters is low (aLRT spanning between 0.74 and 0.94). Finally, the Amborella sequence assigned to OG-PAT-1 was not included in its respective cluster.
Figure 2

Unrooted ML phylogenetic tree based on GRAS sequences from . Branch support is based on aLRT score. The background colors differentiate subfamilies including more than one OG. OGs not grouped in subfamilies are differentiated by gray tones. Branches that were inconsistent with defined orthogroups were colored in red.

Unrooted ML phylogenetic tree based on GRAS sequences from . Branch support is based on aLRT score. The background colors differentiate subfamilies including more than one OG. OGs not grouped in subfamilies are differentiated by gray tones. Branches that were inconsistent with defined orthogroups were colored in red. Another phylogenetic tree was built with the 142 GRAS protein sequences of A. trichopoda, V. vinifera, and P. dactylifera (Figure 3). The phylogenetic tree was computed based on 180 aligned positions, all belonging to the conserved GRAS domain. The results of the analysis were highly consistent with the initial OG definition (with the only exception of the A. trichopoda sequence included in the OG-HAM-I that was not resolved in the correct cluster), showing 29 clusters including the respective sequences of 29 OGs and clustering all the OG included in subfamilies (Figure 2).
Figure 3

Unrooted ML phylogenetic tree based on GRAS sequences from . Branch support is based on aLRT score. Clades containing genes assigned to a same OG are collapsed. The colors differentiate subfamilies including more than one OG. OGs not grouped in subfamilies are in black. Individual sequences not associated to any OG are not collapsed.

Unrooted ML phylogenetic tree based on GRAS sequences from . Branch support is based on aLRT score. Clades containing genes assigned to a same OG are collapsed. The colors differentiate subfamilies including more than one OG. OGs not grouped in subfamilies are in black. Individual sequences not associated to any OG are not collapsed. For increased resolution, unrooted phylogenetic trees including all eight of the species were built for each OG and for each subfamilies (Supplementary Data 2; Supplementary Figures 1–38). The phylogenetic analyses were performed with a number of positions (belonging to both the GRAS domain and to the N-terminal region) spanning between 255 and 520 for the OGs and between 170 and 368 for the subfamilies. We also analyzed OG sequences by MEME search and almost all the conserved motifs were located in the GRAS domain. The analysis performed with a representative of all OGs did not detect any conserved regions outside of the GRAS domain. However, by investigating OGs individually, 19 OGs displayed one or two conserved motifs in the N-terminal region (Table 2).
Table 2

Conserved motifs identified by MEME software among defined gene clusters.

OGp-valueSequenceExceptions/missing
OG-SCR-11.4e-093MDDTAATAWIDGIIRDIIHSSNone
4.2e-217VSIPQLIHNVREIIHPCNPNLAAILEYRLRSLMNone
OG-SHR-11.1e-097CHHFYMDEDFFSSSSSKHYHPNone
OG-SCR32-18.0e-053HQIGPCLDLTMNKNQIHRTRPWPGFPTSKA. thaliana, O. sativa, M. acuminata (1) and A. trichopoda
OG-SCL4/72.6e-311MAYMCTDSGNLMAIAQQVIKQKQQQQQQQQQQQQQQQNone
3.8e-103EFDSDEWMESLMGGGDAEESDNMNone
OG-NSP2-11.8e-031DDFHDLIESMMCDNone
OG-HAM-I6.3e-049NNNNHFNCNLCYEPTSVLDPHLSPSPVTEA. thaliana
OG-DELLA-11.2e-429DCGMDELLAVLGYKVRSSDMADVAQKLEQLEMVMGNSQEDNNone
5.3e-299SHLASDTVHYNPSDLSTWVDSMLSELNPPPPPIPPPPPIPPA. thaliana (2)
OG-DELLA-21.0e-079EIDGLLAGAGYKVRSSDLHHVAHRLERLETAMVNAO. sativa (2)
6.0e-057ASEAVHYNPSDLTSWVDSMLSELNPO. sativa (2)
OG-DELLA-1,26.8e-531QDCGMDELLAVLGYKVRSSDMADVAQKLEQLEMVMGNAQEDO. sativa (2)
1.6e-405LASDTVHYNPSDLSTWVDSMLSELNPPPPO. sativa (2)
OG-PAT-13.6e-159FQQNSQSYPSDQHHSPDNTYGSPISGSCM. acuminata (1) and A. thaliana (1)
3.7e-170TDDPNDLKHKLRELETAMLGPNone
OG-PAT-21.1e-108QEIETVLMAPDTDEPTTSTNVECDENKQPQLTKQRSRTWTHNone
OG-PAT-31.5e-101IDYDEDEMRLKLQELEQALLNDNDEDLYDNone
OG-PAT-49.1e-105GGILKRSLTEMERQQQQQQQQNone
7.9e-094LQELEKQLLDDDDEENone
OG-PAT-12341.4e-421ITYDENDMKHKLQELETAMMGDDDDDEM. acuminata (1) and A. thaliana (1)
OG-SCL34.4e-127QQDDGSSSVTSSPLQFFSLMSLSPGTGSPO. sativa (8), P. dactylifera (1), V. vinifera (1) and T. cacao (1)
OG-DLT4.9e-074MGTQRLDLPCSFSRKNone
OG-RAM14.3e-033KGKGQSPLHKVFNSPNNQYMQA. trichopoda
OG-RAD1-14.6e-079NRNGSTNSTNSLPRLHFRDHIWTYKQRYLAAEAMEEAAAAMNone
OG-RAD1-21.5e-011SFNHDTAIRRFCPARIEQEQNone
4.7e-008PPSLAASEEDEFVDSFINMDWCDDYDNDNone
OG-SCLA2.1e-035DVCEGKFFGLLQARERMLKVDPKRKGMEDC. canephora (2)
OG-SCLB5.4e-171NYRSSHGRLCGEKENEPTDGVTYPTGGGDELSTEEVIRIAGAHYVYMGTHC. canephora (1) and T. cacao (1)

Bold characters are used to highlight conserved amino acids in motifs identified in OGs classified in the same subfamily. In subfamily DELLA, where two conserved motifs were detected, second motif amino acids are underlined. In the last column are reported the species (and the number of relative sequences) where the motif was not detected.

Conserved motifs identified by MEME software among defined gene clusters. Bold characters are used to highlight conserved amino acids in motifs identified in OGs classified in the same subfamily. In subfamily DELLA, where two conserved motifs were detected, second motif amino acids are underlined. In the last column are reported the species (and the number of relative sequences) where the motif was not detected. Hereafter, we described all subfamilies and orthogroups including reference and comparison to previously published results.

Scarecrow (SCR) subfamily

The SCR genes are involved in the A. thaliana bundle sheath and mesophyll cell fate (Cui et al., 2014) and contributing to ground tissue radial patterning in both embryonic root and shoot (Di Laurenzio et al., 1996; Wysocka-Diller et al., 2000; Heidstra et al., 2004). The scarecrow subfamily is composed of three orthologous groups (OG-SCR-1, -2, and -3; Table 1; Figure 2). Phylogenetic analyses performed with all sequences of these three OGs distinguished three clusters, perfectly consistent with the OG composition (Supplementary Figure 4). SCR (AT3G54220) and SCL23 (AT5G41920) genes from Arabidopsis are included in these OGs. All OG-SCR-1 sequences are characterized by an intron in a conserved position inside the GRAS domain, whereas the members of the two remaining groups have the typical mono-exonic structure. Two adjacent conserved motifs (21aa and 33aa, respectively) were found in the N-terminal region of OG-SCR-1 only (Table 2). In our global phylogenetic analyses, the SCR subfamily does not appear to have any close relationships with any other GRAS OG (Figures 2, 3).

Short root (SHR) subfamily

In A. thaliana, the SHR gene (AT4G37650) is known to be involved in the bundle sheath and mesophyll cell fate (Cui et al., 2014) by regulating the expression of SCR and SCL23. The SHR subfamily is composed of two OGs. Members of OG-SHR-2 were absent in O. sativa and A. thaliana and were also missing in the Poales and Brassicales orders (Table 1). Phylogenetic analysis clearly separates the members of the two OGs (Supplementary Figure 7). All genes are mono-exonic but the V. vinifera member of OG-SHR-1 (VITVI_LOC100263197) contains an intron. A 21aa-conserved motif was found in OG-SHR-1 proteins only (Table 2).

Scarecrow-like 32 (SCL32) subfamily

Since no function was assigned to the member of this subfamily, the name Scarecrow-like 32 (SCL32), derived from the A. thaliana member (AT3G49950), was chosen as OG identifier. In the phylogenetic analysis performed with all the members of the subfamily, two major clusters consistent with the defined OGs were identified in the phylogenetic analysis (Supplementary Figure 10). A 29aa-conserved motif was identified in almost all members of OG-SCR32-1 (Table 2), with the exception for A. thaliana, O. sativa, and A. trichopoda.

Nodulation signaling pathway 1 (OG-NSP1)

The function of a member of this OG was first characterized in Medicago truncatula (Supplementary Figure 35) where it regulates the expression of nodulation factors (Smit et al., 2005). However, the members of this group play a role also in non-legume species. Liu et al. (2011) showed the role of NSP1 (and NSP2) in the biosynthesis of strigolactone in M. truncatula and O. sativa. The OG-NSP1 includes the A. thaliana member AT3G13840 (SCL29) and at least a member for each analyzed species (Table 1; Supplementary Figure 11). Phylogenetic relationships were shown among OG-NSP1, SHR and SCL32 OGs based on A. thaliana and O. sativa member sequences (Tian et al., 2004; Lee et al., 2008; Wu et al., 2014). These relations were confirmed in Figure 2. A 14aa-motif was found conserved in all species except for A. trichopoda and P. dactylifera sequences (Table 2).

Lateral suppressor (OG-LS)

The first gene (Ls) of this OG was isolated in S. lycopersicum (Schumacher et al., 1999; Supplementary Data 3). The OG-LS includes two genes for which the function was characterized in the studied species: Lateral suppressor (LAS) in A. thaliana (AT1G55580) (Greb et al., 2003) and Monoculum1 in O. sativa (Li et al., 2003). In both plants, the orthologs control the formation of lateral shoots during vegetative development. In O. sativa a paralog is also present whereas in M. acuminata and P. dactylifera the ancestral gene was amplified with four members found in both genomes (Table 1). The phylogenetic analysis placed the A. trichopoda gene inside the dicot cluster, close to the A. thaliana gene (Supplementary Figure 12). Since both the A. trichopoda and A. thaliana genes have long branches, this unexpected position was suspected as a long-branch attraction (LBA) artifact. To test this hypothesis, the analysis was repeated removing the A. thaliana sequence. The resulting phylogenetic tree shows A. trichopoda to be no longer included in the dicot cluster (Supplementary Figure 13) suggesting the LBA as likely explanation of the anomalous position of the A. trichopoda gene.

Scarecrow-like 4 and 7 (OG-SCL4/7)

Since no function was assigned to the member of this OG, its name (OG-SCL4/7) name was derived by the two A. thaliana paralogs Scarecrow-like 4 (AT5G66770) and Scarecrow-like 7 (AT3G50650) included in this OG. A Populus euphratica ortholog (PeSCL7) was found overexpressed during the early stage of an induced severe salt-stress. Transgenic A. thaliana plants overexpressing this GRAS gene showed increased tolerance to salt and drought stresses (Ma et al., 2010). It is worth noting that, in contrast to other OGs, the first 19 amino acids of the OG-SCL4/7 members are highly conserved among all the species (MAYMC[A/T]DSGNLMAIAQQ[V/L]I) which corresponds to a coiled coils structures (http://embnet.vital-it.ch/software/COILS_form.html). This region was part of a 37aa-motif detected by MEME analysis along with another motif 23aa long (Table 2).

Nodulation signaling pathway 2 (NSP2) subfamily

The function of a member of this OG was first characterized in Medicago truncatula where it regulates the expression of Nodulation factors (Smit et al., 2005; Supplementary Data 3). The OG-NSP2-1 includes the A. thaliana member AT4G08250 (SCL26) and at least one member for each analyzed species (Table 1). The OG-NSP2-1 also contains the Nicotiana tabacum gene NtGRAS-R1, a topping responsive gene (Xu F. et al., 2015). The OG-NSP2-2 includes genes from O. sativa, P. dactylifera, V. vinifera and C. canephora, whereas members are missing in Brassicales and Malvales, as well as in Musa. The O. sativa gene DIP1 (DELLA Interacting Protein 1, Os12g06540) that interacts with SLR1 gene in rice and is involved in the arbuscular mycorrhizal symbiosis (Yu et al., 2014) is included in this OG. OG-NSP2-3 includes members from most of the analyzed dicots (V. vinifera, T. cacao, C. canephora) and A. trichopoda but no members were found in monocots (Table 1). Finally, two additional close A. trichopoda sequences do not have any close sequences in monocots or dicots. Even if the A. trichopoda specific sequences are located in tandem, identity and similarity between them is reduced (51 and 66%, respectively), suggesting they originated from an ancient tandem duplication event. A short conserved motif (13aa) was detected in OG-NSP2-1 sequences (Table 2).

Hairy meristem (HAM) subfamily

Hairy meristem mutation was described in Petunia hybrida (Stuurman et al., 2002; Supplementary Data 3), where it is essential and specific for maintaining the shoot apical meristem. In A. thaliana, three close and redundant genes (Atham1, 2, and 3; AT2G45160, AT3G60630 and AT4G00150, respectively) were described along with a fourth, more distantly related homolog (Atham4, AT4G36710) (Engstrom, 2011). Two OGs were recognized, including these genes, and are named based on classification in Engstrom et al. (2011): OG-Ham-II which contains the most of the Ham genes (included the P. hybrida one) and OG-Ham-I. One A. trichopoda sequence is included in OG-Ham-II (LOC18445615), whereas a second Ham gene in Amborella (LOC18445865) appears to belong to the OG-Ham-I (Table 1). A 29aa-long conserved motif was detected in OG-HAM-I sequences (Table 2).

DELLA subfamily

DELLA proteins are repressors of the Gibberellin responses and take their name from the presence of the conserved DELLA domain in the sequence of the N-terminal region. In A. thaliana, five members of this family were recognized: RGL1, 2, 3, RGA1, and GAI (AT1G66350, AT3G03450, AT5G17490, AT2G01570, and AT1G14920, respectively) (Silverstone et al., 1998; Park et al., 2013). All five genes are part of the OG-DELLA-1 as well as the O. sativa Slender rice 1 gene (SLR1, Ikeda et al., 2001). In addition to the above cited genes, other DELLA-like genes are part of the OG-DELLA-2. It is worth noting that both O. sativa genes on OG-DELLA-2, described as Slender like SLRL1 and SLRL2 (Itoh et al., 2005), corresponding to Os01g45860 and Os05g49930 respectively, lost their functional DELLA protein domain even though their inclusion in this OG is very well supported. A conserved motif corresponding to the DELLA domain was found in almost all sequences of both OGs and it was detected again when the sequences of both OGs were analyzed together (Table 2).

Phytochrome a signal transduction (PAT) subfamily

PAT1 gene was shown to be a positive regulator in transduction of Phytochrome A signal in A. thaliana (Bolle, 2004). Four OGs are included in the PAT subfamily. OG-PAT-1 includes the O. sativa chitin-inducible gibberellin-responsive protein 2 (CIGR2), the A. thaliana PAT1 genes (Bolle et al., 2000; Day et al., 2004) and several other genes (Table 1). OG-PAT-2 includes the O. sativa CIGR1 gene (Day et al., 2004) and members from all the analyzed species except A. thaliana. BLASTp analyses indicate that Brassicaceae lacks a member of this OG. However, members of OG-PAT-2 were found in Tarenaya hassleriana (LOC104798783 and LOC104817890) belonging to the sister group of the Cleomaceae, which indicates that OG-PAT-2 is represented in Brassicales and was probably lost only in the Brassicaceae family. OG-PAT-3 includes the A. thaliana gene SCL1 (AT1G21450) and at least one member for each other analyzed species; in monocots, two introns are present in the 3′ coding region, whereas in dicots the gene has the typical mono-exonic structure. OG-PAT-4 includes the A. thaliana gene SCL8 (AT5G52510) and at least one member for each other analyzed species with the exception of Amborella. One or two conserved motifs were detected for each one of these OGs and one region was detected when all the protein sequences of this subfamily were analyzed. A motif conserved among almost all the members of the PAT subfamily was partially overlapping with the motifs detected in OG-specific analysis (Table 2).

OG-SCL3

In A. thaliana, SCL3 was shown promoting gibberellin signaling (by antagonizing master growth repressor DELLA) (Zhang et al., 2011) and was associated with the nuclear hexokinase1 complex (Cho et al., 2006). In O. sativa the nine members of OG-SCL3 are the result of both tandem and segmental duplications. A 29aa motif was detected in most of the sequences of this OG, the exceptions all belonging to O. sativa (Table 2).

Dwarf and low-tillering (OG-DLT)

This newly identified OG-DLT was named from the rice member of this family, which is involved in brassinosteroid signaling and its alteration induces dwarf and low-tillering phenotype in rice (Tong et al., 2009). A 15aa conserved motif was detected in all the sequences (Table 2).

Reduced arbuscular mycorrhization 1 (OG-RAM1)

This newly identified OG was named from the RAM1 gene, involved in the mycorrhizal signaling in Medicago truncatula (Gobbato et al., 2012) (Supplementary Data 3). One member of OG-RAM1 was found in each of the analyzed species except A. thaliana (missing in all Brassicales). A 21aa-long conserved motif was found in all sequences of this OG, except the A. trichopoda one (Table 2).

Required for arbuscule development 1 (OG-RAD1) subfamily

This newly identified OG-RAD1-1 was named after the RAD1 gene, involved in mycorrhization of Lotus japonicus (Xue et al., 2015) (Supplementary Data 3). Members of this OG were found in all the analyzed species except A. thaliana (missing in all Brassicales). OG-RAD1-2 members were found only in A. trichopoda, P. dactylifera, V. vinifera, and T. cacao (Figure 1), but no functional information is available for any member of this OG. One (41aa) and two (20aa and 28aa) conserved motifs were detected in RAD1-1 and RAD1-2 respectively (Table 2).

Scarecrow-like (OG-SCLA and B)

In those two new subfamilies, no A. thaliana members were found for the Scarecrow-like OGs, nor is any functional information available, and consequently they are distinguished by letters. The OG-SCLA includes members from all analyzed species but does not contain any Brassicales member. A 29aa long conserved domain was detected for this member (Table 2). Members of A. thaliana and O. sativa are also missing in OG-SCLB, and no members of this OG were found in the M. acuminata genome. On the contrary, this OG experienced independent expansion in P. dactylifera and A. trichopoda, mainly by tandem duplication (Table 1). A 50aa-long conserved motif was detected in several proteins of this OG (Table 2).

OG-LISCL

This group was named after the Lilium longiflorum gene found to regulate meiosis-associated gene regulation (Morohashi et al., 2003) (Supplementary Data 3). The number of OG-LISCL members found in each species is clearly higher than in any other OG. The expansion of this gene family in each species occurred both by segmental and tandem duplications (blocks of consecutive annotation names in Supplementary Data 2). Phylogenetic analysis performed with members of this OG shows that duplications took place during the monocot and dicot radiations, but also by lineage-specific amplification. Members of this OG appear to be involved in different processes. Os04g50060 (alias OsGRAS23) was shown to be involved in drought-stress response and to regulate the expression of stress-responsive genes (Xu K. et al., 2015); At1g07530 (alias SCL14, alias AtGRAS2) is required for the activation of stress-inducible promoters (Fode et al., 2008). Another O. sativa gene OsAM18 (Os03g40080; in our study the sequence was considered a pseudogene due to large sequence rearrangements, but close to the OG-LISCL sequences), was found to be involved in mycorrhiza development (Fiorilli et al., 2015).

Discussion

In order to transfer genetic knowledge from extensively studied model species to important crops with non-optimal features to perform effective experimentation (non-model), it is critical to determine the correct orthology relationship between genes of model and non-model species. Even if the orthology is not a guarantee of function conservation (especially in multi-copy gene families), orthologous genes are still the best candidates for functional annotation transfer. An example of function conservation inside a GRAS is provided by three characterized genes in the LS orthogroup that are all involved in the formation of lateral shoots during vegetative development in phylogenetically distant angiosperm species [S. lycopersicum (dicot asterid), A. thaliana (dicot rosids) and O. sativa (monocot)]. This study aimed at defining the orthology relationships among the GRAS members in angiosperms.

Orthogroups and phylogeny of the GRAS family

Twenty-nine OGs were recognized in the GRAS family but several groups lacked members in one or more species. The BLASTp analysis on plant protein databases highlighted the absence of representatives of a given OG common to phylogenetically close species, suggesting that the loss predated the origin of some families or orders (Table 1). In particular A. thaliana, with a lower number of GRAS members (33), was missing members of 12 OGs as highlighted for other species (Lu et al., 2015; Xu et al., 2016). BLASTp failed to find members of 11 of these OGs in species belonging to the Brassicales order and the remaining one (OG-PAT-2) was missing only in the Brassicaceae family. To a lesser extent, four OGs appeared to have no members in O. sativa or in the Poales order. The loss of representative genes of several OGs is striking in contrast with the results of a similar study on another transcription factor family (Cenci et al., 2014). Indeed, among the 40 OGs comprising the NAC gene family (Cenci et al., 2014), 39 had at least one representative in the four species analyzed in the study (i.e., A. thaliana, V. vinifera, M. acuminata, and O. sativa) and only one was missing in monocots. Previous genome-wide studies of the GRAS transcription factors involved mainly members of only one or a few species (Tian et al., 2004; Lee et al., 2008; Abarca et al., 2014; Liu and Widmer, 2014; Song et al., 2014; Huang et al., 2015; Lu et al., 2015; Sun et al., 2016) and model species such as A. thaliana and O. sativa were often used as the reference. These two species have shown evidences of higher evolution rates than observed for V. vinifera (Yue et al., 2010) and M. acuminata, respectively (D'Hont et al., 2012; Cenci et al., 2013, 2014). Consistent with these observations, in most of the OG phylogenetic trees in this study, A. thaliana and O. sativa sequences showed longer branch lengths than other dicots and monocots, respectively. A higher evolution rate implies a greater divergence between sequences (more amino acid substitution) which makes the sequence alignment more challenging and increases the background noise that can affect phylogenetic signal. Consequently the A. thaliana and O. sativa genes, although considered as model plants, are not the optimal sequences to reconstruct difficult gene phylogenies in angiosperms. In order to establish the phylogenetic relationships among GRAS OGs, phylogenetic trees were built with the complete set of 397 sequences and with a subset of 142 sequences belonging to only three species (i.e., A. trichopoda, V. vinifera, and P. dactylifera). These three species were selected based on three criteria: (i) representation of main groups (basal angiosperm, dicots and monocots, respectively); (ii) representation of all OGs (with two exceptions: OG-NSP2-3 lacks members in P. dactylifera and in all monocots and OG-PAT4 lacks members of A. trichopoda); (iii) observed slower evolution rate. Overall, the phylogenetic results are consistent with the established OGs as well as with the organization of some OGs in subfamilies (Figures 2, 3). In the eight-species tree a higher number of inconsistencies with the OGs were observed. The inconsistencies could be due to the limited number of aligned positions retained for the analysis (151 and 180 in the eight-species and three-species trees, respectively). The phylogenetic consistencies of OG grouped in subfamilies was confirmed by conducting phylogenetic analyses on subsets of sequences belonging to these subfamilies (that are based on longer sequence alignments): clustering completely consistent with OG definition and high branch support (aLRT always higher than 0.9) were observed (Supplementary Data 2; Supplementary Figures 1–38). In the phylogenetic tree (Figure 3), the Amborella sequences that are not included in any OG (i.e., LOC18433705 and LOC18433702) are clustered with the NSP2 subfamily, as sister group of OG-NSP2-3. These two sequences form a very well supported cluster (aLRT = 0.999). The most likely scenario is the loss of the orthologous gene in the ancestor of the other angiosperms, although a duplication from the A. trichopoda sequence included in OG-NSP2-3 followed by extensive diversification cannot be ruled out. Concerning the deep nodes, i.e., the relationships among subfamilies and isolated OGs, the phylogenetic signal is less clear. Strong support was observed for the cluster, including SHR, SCL32, and NSP1 subfamilies (aLRT = 0.999), as already observed in previous studies (Tian et al., 2004; Lee et al., 2008; Wu et al., 2014) and for the clusters including also PAT subfamily (aLRT = 0.977). The remaining basal nodes have branch support lower than 0.9. According to Zhang et al. (2012), who rooted the phylogenetic tree of the GRAS gene family in A. thaliana with the bacterial GRAS genes, the first duplication separated the LISCL ancestor from the ancestor of all other GRAS families. However, the A. thaliana-specific lineage lost several GRAS members that could explain this result. In particular, the SCLB subfamily which is missing in A. thaliana, was clustered with OG-LISCL in our phylogenetic analysis (Figure 2). The presence of an A. trichopoda representative close to almost all OGs is consistent with an ancient diversification of the different clades, as shown in a phylogenetic analysis that includes basal Viridiplantae (Engstrom, 2011). The unique exception is OG-PAT-4, for which no close A. trichopoda gene was found. The most likely hypothesis is that A. trichopoda lost the gene corresponding to OG-PAT-4. In fact, the closest A. trichopoda gene to OG-PAT-4, i.e., LOC18432892, is included in the well supported OG-PAT-3 cluster (Supplementary Data 2; Supplementary Figure 29) and it is unlikely that it derived from the common ancestors OG-PAT-3 and -4. At least 29 ancestor genes were present in the angiosperm lineage before the Amborella split. Since all OGs based on the monocot-dicot split contain one or more A. trichopoda sequences, we can conclude that no GRAS gene duplication took place between the basal angiosperm Amborella split from the other angiosperms and the monocot-dicot split. This phylogenetic tree (Figure 2) is based on species with the most complete GRAS OG set and with extensive taxonomic representation. A detailed comparison of phylogenetic results with the ones obtained in previous study (that mainly focused on A. thaliana and O. sativa) has been complicated by the detected loss of GRAS members of these species in some OGs (12 and 4, respectively). The main clusters of sequences described in previous studies were consistently found in our analysis. In addition, the wide representation of angiosperm species allowed us to detect and describe five new and well differentiated subfamilies: DLT, RAD1 (including 2 OGs), RAM1, SCLA, and SCLB, the last two being not yet functionally characterized. The existence of new subfamilies was already partially detected by Grimplet et al. (2016) in their analysis of V. vinifera GRAS: GRAS8 group corresponds to OG-DLT and OG-SCLA, GRASV1 to RAD1 subfamily and OG-RAM1, and GRASV2 to SCLB. However, our analysis allowed us to classify with higher precision the suggested V. vinifera subfamilies (e.g., GRASV1 contains genes belonging to OG-RAD1-1, OG-RAD1-2, and RAM1). The variable number of groups or subfamilies that are defined according the different studies reflects both the presence/absence of GRAS members and the arbitrary choices of the authors. In our study, we grouped the OGs into 17 subfamilies (of which eight include two or more OGs) based on arbitrary thresholds of sequence similarity. However, these subfamilies could be decreased or increased in number if, for example, we decided to join the closer clusters NSP2 and HAM or to separate the cluster containing the OG-PAT-3 and -4 genes from the other PAT OGs (Figure 2). Conversely, the OGs are not based on sequence similarity, but they reflect the established phylogenetic history, as all the genes included in an OG derived from a common ancestor existing before the split between monocots and dicots. Obviously, one could base the orthology study on a different point of the phylogenetic history (e.g., the split between asterids and rosids) and obtain different OG numbers, even if using the same objective analysis. In our study, we focused on the monocot/dicot split that includes almost all the food crops to facilitate establishing the orthology relationships between models and plants of agronomic interest. In addition, unbiased comparisons could be performed with a similar study on NAC transcription factors, where the orthology definition was also based on the monocot/dicot split.

Conserved motifs

The GRAS family is characterized by the presence of the GRAS domain in the C-terminal sequence part which is composed of five subdomains. The MEME analysis performed on a set of sequences representative of all OGs confirmed the high level of conservation of the GRAS domain. The MEME analysis in each OG allowed identifying, in addition to the GRAS domain, one or two conserved motifs in the N-terminal portion of several OGs (Table 2). These motifs appear mainly OG-specific, and the analysis of subfamilies (grouping 2–4 OGs) failed to detect shared conserved motifs, with the exception of the DELLA domain in the OG-DELLA-1 and -2 and the conserved motifs in all 4 OGs included in the PAT family. The detected conserved motifs lie in a highly variable region, classed as an intrinsically disordered sequence (Sun et al., 2011, 2012). The conservation in orthologous genes of species spanning the angiosperm radiation implies that a selective pressure was exercised on these sequence parts and suggests their involvement in protein functionality.

Orthogroups evolution history and γ WGD of dicots

The evolutionary history of the GRAS family appears complex. Most of the duplications and diversification took place before the angiosperm radiation. Additional duplications could be observed during the evolution of angiosperm lineages. In particular, in 8 of 29 OGs (DELLA-1, HAM-II, LISCL, PAT-1, PAT-3, SCL3-1, SCL3-2, and SCLB), dicot-specific duplications or triplications were clearly observed. A WGD event (γ hexaploidization) pre-dated the radiation of all dicot species considered in this study (Figure 1; Jaillon et al., 2007; Cenci et al., 2010). Since Sun et al. (2016) identified some GRAS genes associated with γ WGD-duplicated blocks in the V. vinifera genome, we tried to verify if the observed dicot-specific duplications can be related to the γ WGD. The OG-DELLA-1 tree shows two eudicot clusters, each one containing at least one gene of each studied dicots species (Supplementary Figure 22). The V. vinifera genes are located in chromosomes 1 and 14, which contain, along with the chromosome 17, large duplicated segments. However, these genes are not included in any known duplicated segments. The clusters also include two C. canephora genes (Cc11_g08290 and Cc07_g13590). As for V. vinifera, chromosomes 11, 7, and 4 share large triplicated segments that do not include the GRAS gene. A closer examination of the surrounding genomic regions of the GRAS genes reveals the presence of a small duplicated segment, which includes the GRAS genes and 10 other gene pairs (Supplementary Table 2). This segment duplication was not detected in former analyses, likely due to its short size and a post-duplication amplification of genes in the chromosome 11 segment. Since the GRAS genes lie in an extension of regions assigned to γ WGD, their duplication can be considered associated with this event. In the OG-HAM-II tree, two clusters contain genes from C. canephora, V. vinifera, and T. cacao (Supplementary Figure 20). In V. vinifera, the GRAS genes are located at the end of a duplicated segment in Chromosomes 2 and 15 (Jaillon et al., 2007). C. canephora genes are located in a duplicated segment containing 37 genes (Denoeud et al., 2014). Both the duplicated segments were associated with γ WGD. The LISCL orthogroup contains a very large number of members originated by both segmental and tandem duplication in all studied angiosperm species, whereas only one sequence was found in A. trichopoda for this OG. In the dicot phylogenetic cluster (Supplementary Figure 38), three well-supported clusters can be observed: one contains only four genes, one member for each dicot species; a second cluster does not contain any A. thaliana members and a species-specific tandem amplification took place in chromosome 13 of V. vinifera; the third cluster is the largest one and contains additional segmental and tandem duplications involving all the studied dicots. In each one of the three above-described clusters a V. vinifera gene is included, assigned to a triplicated segment associated with the γ WGD (Sun et al., 2016). The dicot genes in OG-PAT-1 phylogenetic tree (Supplementary Figure 25) are organized in three clusters. Two V. vinifera and two T. cacao genes were found in duplication associated with the γ WGD (Argout et al., 2011; Sun et al., 2016); in both cases, the genes are included in the closer dicot specific clusters. For the third dicot cluster (the basal one), it is not possible to establish relationships with duplicated segments due to GRAS genes unassigned to V. vinifera or C. canephora chromosomes [LOC100245041 (V. vinifera) and Cc00_g06820 (C. canephora)] and the T. cacao gene TCM_030393 not included in duplication segments). Consequently the third block cannot be shown to originate from the γ WGD. In the OG-PAT-3 tree only a dicot cluster is present, but one of the two V. vinifera genes (LOC100854518) has an unexpected position, being basal for the complete cluster (Supplementary Figure 27). Since the V. vinifera genes were found associated with the γ WGD (Sun et al., 2016), it can be concluded that one of duplicated copies was retained in V. vinifera, whereas it was lost in all other analyzed dicots. The OG-SCL3 tree includes three dicot clusters (Supplementary Figure 30); one of them includes only two GRAS sequences from T. cacao and V. vinifera and has long branches. The unexpected position of this cluster inside the O. sativa specific cluster (Supplementary Figure 30) could be an artifact due to the LBA phenomenon. The other two dicot clusters, each containing sequences from T. cacao, V. vinifera and C. canephora, have expected positions in a well-supported dicot specific cluster and could result from the γ WGD. However, none of these genes could be associated with duplicated segments in V. vinifera, T. cacao, and C. canephora. In the OG-RAD1-1 tree, the dicot cluster is divided in two sub-clusters each containing a gene from V. vinifera, T. cacao, and C. canephora (Supplementary Figure 33). The C. canephora genes lie in duplicated segments containing 38 duplicated genes and the V. vinifera genes were found in duplicated segments associated with the γ WGD (Sun et al., 2016). The dicot cluster of the OG-SCLB tree appears divided in three sub-clusters, even though one has low support (aLRT = 0.67) (Supplementary Figure 37). Each dicot sub-cluster has at least one member of C. canephora and T. cacao. Two of these dicot sub-clusters appear to be the result of a tandem duplication taking place before the rosid/asterid split. In fact, the genes of these dicot sub-clusters are arranged in tandem in both T. cacao (TCM_021350 and TCM_021351) and C. canephora [Cc03-g00940-Cc03-g00950 and the unannotated Cc03:(712804.714285)]. The T. cacao and C. canephora genes in the third dicot sub-cluster lie in different chromosomes (Cc01_g07010 and TCM-04818) which excludes their origin from tandem duplication, and are thus not included in known duplicated segments. However, Sun et al. (2016) found the unique V. vinifera gene (in the OG-SCLB tree in segment of chromosome 7) duplicated in chromosome 5, where there is another V. vinifera gene that was considered as a pseudogene in this study. When this sequence was considered in the phylogenetic analysis (data not shown), it was included in the largest dicot sub-cluster, suggesting the γ WGD was involved in the dicot amplification of the OG-SCLB. In conclusion, for at least seven of the eight OGs for which dicot specific duplications were observed, the γ WGD appears to be involved, and in the remaining OG, the γ WGD cannot be ruled out. Moreover, segmental duplications and tandem duplications appear to participate in the gene number amplification as previously reported (Tian et al., 2004; Grimplet et al., 2016), especially in the OG-LISCL, which includes a dramatically higher number of GRAS genes.

GRAS family evolution in angiosperm

When compared with the evolution of the NAC TF family, the expansion of the GRAS gene family appears limited only to a few OGs, whereas the number of GRAS members was constant in the majority of its OGs. The preferential retention of copies during the whole genome duplication and following fragmentation observed for other transcription factors (Maere et al., 2005) seems to be less extensive in the GRAS gene family. An average of 50 GRAS members belonging to 29 OGs were counted in the eight species studied here, which strongly contrasts with the findings in NAC TFs where we defined 40 OGs for 100 NAC members were counted in the analyzed species (Cenci et al., 2014). If the number of annotated members of NAC and GRAS transcription factor is compared (Supplementary Figures 39, 40), it can be highlighted that the NAC gene family experienced an expansion in the higher plant lineages, as their member number is clearly higher than in P. patens and S. moellendorffii, a moss and a lycophyte, respectively. By contrast, in GRAS TFs the number of GRAS genes in these species is comparable. Moreover, the complete loss of OG members in a given species or lineage was not observed in a similar study performed on the NAC TFs (Cenci et al., 2014). It is worth underlining that most of the OGs that are missing members of one or more species belong to subfamilies that include more than one OG. That these OGs lack some lineages suggests that, in spite of their ancient differentiation, GRAS family members of close OGs maintained some degree of redundancy and the complete loss of OG representatives in a given lineage seems to be compensated by the presence of members of close OGs. These observations are consistent with the results of Lee et al. (2008) who reported normal phenotype for a panel of 23 loss-of-function mutants of different functionally uncharacterized A. thaliana GRAS genes. Partial redundancy was also shown in A. thaliana for four HAM genes belonging to the two close OG-HAM-I and -II (Engstrom et al., 2011). The analysis of GRAS TF in additional species' genomes, of which availability is increasing, might allow improving the global panorama of the GRAS gene family in angiosperms. However, since the panel of species used in this study was designed to provide a wide view of the angiosperms, the discovery of new GRAS OGs is highly unlikely. On the contrary, data from additional species will allow a more precise reconstruction of the history of duplication and loss of members in each OG. At the same time, a precise GRAS classification will help to better characterize the evolution of specific members (e.g., two O. sativa member of OG-DELLA-2 have lost their DELLA domain). Finally, the GRAS classification in OG is also expected to be a useful tool in studies that are not exclusively devoted to the GRAS family. As an example, a classification was performed on 18 GRAS genes found in a panel of 45 transcription factors up-regulated in Lotus japonicus roots with mycorrhizal colonization (Xue et al., 2015). The classification of these genes identified the OGs mainly responsive to the mycorrhiza development, i.e., the OG-SCL3 (4 genes), the OG-SCLB (3 genes), and that the RAD1 subfamily has the most of the up-regulated genes (4 genes). It also highlighted several OGs known to be involved in root development (SHR and SCR) in interaction with soil microorganisms involved in nodulation (NSP2) and arbuscular mycorrhiza formation (RAD1 and RAM1) (Supplementary Table 3). Therefore, this study provides a solid framework of the orthology relationships in the angiosperm GRAS transcription factors, thus increasing the accuracy of ortholog identification in model species and facilitating the identification of agronomically important genes related to various traits such abiotic stress tolerance.

Author contributions

MR and AC conceived and designed the experiments. AC conducted genome evolution analyses including gene family and phylogenetic analysis. MR and AC conducted protein domain analyses. MR and AC wrote the manuscript.

Funding

This work was supported by CGIAR Fund Donors and CGIAR Research Programme on Roots, Tubers and Bananas.

Conflict of interest statement

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
  73 in total

1.  Selection of conserved blocks from multiple alignments for their use in phylogenetic analysis.

Authors:  J Castresana
Journal:  Mol Biol Evol       Date:  2000-04       Impact factor: 16.240

2.  A characterization of grapevine of GRAS domain transcription factor gene family.

Authors:  Xin Sun; Zhengqiang Xie; Cheng Zhang; Qian Mu; Weimin Wu; Baoju Wang; Jinggui Fang
Journal:  Funct Integr Genomics       Date:  2016-02-03       Impact factor: 3.410

3.  Modeling gene and genome duplications in eukaryotes.

Authors:  Steven Maere; Stefanie De Bodt; Jeroen Raes; Tineke Casneuf; Marc Van Montagu; Martin Kuiper; Yves Van de Peer
Journal:  Proc Natl Acad Sci U S A       Date:  2005-03-30       Impact factor: 11.205

4.  Bacterial GRAS domain proteins throw new light on gibberellic acid response mechanisms.

Authors:  Dapeng Zhang; Lakshminarayan M Iyer; L Aravind
Journal:  Bioinformatics       Date:  2012-07-24       Impact factor: 6.937

5.  Phylogenetic analysis of GRAS proteins from moss, lycophyte and vascular plant lineages reveals that GRAS genes arose and underwent substantial diversification in the ancestral lineage common to bryophytes and vascular plants.

Authors:  Eric M Engstrom
Journal:  Plant Signal Behav       Date:  2011-06-01

6.  MAFFT multiple sequence alignment software version 7: improvements in performance and usability.

Authors:  Kazutaka Katoh; Daron M Standley
Journal:  Mol Biol Evol       Date:  2013-01-16       Impact factor: 16.240

7.  Genome-wide analysis of the GRAS gene family in Prunus mume.

Authors:  Jiuxing Lu; Tao Wang; Zongda Xu; Lidan Sun; Qixiang Zhang
Journal:  Mol Genet Genomics       Date:  2014-09-23       Impact factor: 3.291

8.  Molecular analysis of SCARECROW function reveals a radial patterning mechanism common to root and shoot.

Authors:  J W Wysocka-Diller; Y Helariutta; H Fukaki; J E Malamy; P N Benfey
Journal:  Development       Date:  2000-02       Impact factor: 6.868

9.  Genome-wide investigation reveals high evolutionary rates in annual model plants.

Authors:  Jia-Xing Yue; Jinpeng Li; Dan Wang; Hitoshi Araki; Dacheng Tian; Sihai Yang
Journal:  BMC Plant Biol       Date:  2010-11-09       Impact factor: 4.215

10.  Structural and Functional Analysis of the GRAS Gene Family in Grapevine Indicates a Role of GRAS Proteins in the Control of Development and Stress Responses.

Authors:  Jérôme Grimplet; Patricia Agudelo-Romero; Rita T Teixeira; Jose M Martinez-Zapater; Ana M Fortes
Journal:  Front Plant Sci       Date:  2016-03-30       Impact factor: 5.753

View more
  27 in total

1.  Step by step evolution of Indeterminate Domain (IDD) transcriptional regulators: from algae to angiosperms.

Authors:  Santiago Prochetto; Renata Reinheimer
Journal:  Ann Bot       Date:  2020-06-19       Impact factor: 4.357

2.  A novel SCARECROW-LIKE3 transcription factor LjGRAS36 in Lotus japonicus regulates the development of arbuscular mycorrhizal symbiosis.

Authors:  Yunjian Xu; Fang Liu; Fulang Wu; Manli Zhao; Ruifan Zou; Jianping Wu; Xiaoyu Li
Journal:  Physiol Mol Biol Plants       Date:  2022-03-29

3.  Genome-wide identification and expression analysis of the GRAS gene family in response to drought stress in chickpea (Cicer arietinum L.).

Authors:  Sheel Yadav; Yashwant K Yadava; Deshika Kohli; Shashi Meena; Vijay Paul; P K Jain
Journal:  3 Biotech       Date:  2022-02-09       Impact factor: 2.406

4.  Exploring the GRAS gene family in common bean (Phaseolus vulgaris L.): characterization, evolutionary relationships, and expression analyses in response to abiotic stresses.

Authors:  Parbej Laskar; Saswati Bhattacharya; Atreyee Chaudhuri; Anirban Kundu
Journal:  Planta       Date:  2021-09-24       Impact factor: 4.116

Review 5.  GRAS transcription factors emerging regulator in plants growth, development, and multiple stresses.

Authors:  Muhammad Waseem; Oswald Nkurikiyimfura; Sylvain Niyitanga; Bello Hassan Jakada; Iffat Shaheen; Mehtab Muhammad Aslam
Journal:  Mol Biol Rep       Date:  2022-06-17       Impact factor: 2.742

6.  Constitutive Overexpression of RAM1 Leads to an Increase in Arbuscule Density in Brachypodium distachyon.

Authors:  Lena M Müller; Lidia Campos-Soriano; Veronique Levesque-Tremblay; Armando Bravo; Dierdra A Daniels; Sunita Pathak; Hee-Jin Park; Maria J Harrison
Journal:  Plant Physiol       Date:  2020-09-01       Impact factor: 8.340

7.  Genome-wide survey and expression analyses of the GRAS gene family in Brassica napus reveals their roles in root development and stress response.

Authors:  Pengcheng Guo; Jing Wen; Jin Yang; Yunzhuo Ke; Mangmang Wang; Mingming Liu; Feng Ran; Yunwen Wu; Pengfeng Li; Jiana Li; Hai Du
Journal:  Planta       Date:  2019-06-03       Impact factor: 4.116

8.  Genome-wide Identification and Characterization of the GRAS Transcription Factors in Garlic (Allium sativum L.).

Authors:  Xueyu Zhang; Xiai Yang; Qiaoyun He; Yanzhou Wang; Guolu Liang; Touming Liu
Journal:  Front Plant Sci       Date:  2022-04-12       Impact factor: 6.627

9.  GWAS Mediated Elucidation of Heterosis for Metric Traits in Cotton (Gossypium hirsutum L.) Across Multiple Environments.

Authors:  Zareen Sarfraz; Muhammad Shahid Iqbal; Xiaoli Geng; Muhammad Sajid Iqbal; Mian Faisal Nazir; Haris Ahmed; Shoupu He; Yinhua Jia; Zhaoe Pan; Gaofei Sun; Saghir Ahmad; Qinglian Wang; Hongde Qin; Jinhai Liu; Hui Liu; Jun Yang; Zhiying Ma; Dongyong Xu; Jinlong Yang; Jinbiao Zhang; Zhikun Li; Zhongmin Cai; Xuelin Zhang; Xin Zhang; Aifen Huang; Xianda Yi; Guanyin Zhou; Lin Li; Haiyong Zhu; Baoyin Pang; Liru Wang; Junling Sun; Xiongming Du
Journal:  Front Plant Sci       Date:  2021-05-20       Impact factor: 5.753

10.  Cloning and Characterization of ThSHRs and ThSCR Transcription Factors in Taxodium Hybrid 'Zhongshanshan 406'.

Authors:  Zhiquan Wang; Yunlong Yin; Jianfeng Hua; Wencai Fan; Chaoguang Yu; Lei Xuan; Fangyuan Yu
Journal:  Genes (Basel)       Date:  2017-07-20       Impact factor: 4.096

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.