| Literature DB >> 28042565 |
Huixin Liu1, Wei Liu1, Xuexia Hou1, Lin Zhang1, Qin Hao1, Kanglin Wan1.
Abstract
The 41 kD flagellin of Borrelia burgdorferi (B. burgdorferi) is a major component of periplasmic flagellar filament core and a good candidate for serodiagnosis in early stage of Lyme disease. Here, we chose 89 B. burgdorferi strains in China, amplified the gene encoding the 41 kD flagellin, and compared the sequences. The results showed that genetic diversity presented in the 41 kD flagellin genes of all 89 strains among the four genotypes of B. burgdorferi, especially in the genotype of B. garinii. Some specific mutation sites for each genotype of the 41 kD flagellin genes were found, which could be used for genotyping B. burgdorferi strains in China. Human B-cell epitope analysis showed that thirteen of 15 nonsynonymous mutations occurred in the epitope region of 41 kD flagellin and thirty of 42 B-cell epitopes were altered due to all 13 nonsynonymous mutations in the epitope region, which may affect the function of the antigen. Nonsynonymous mutations and changed human B-cell epitopes exist in 41 kD flagellin of B. burgdorferi sensu lato strains; these changes should be considered in serodiagnosis of Lyme disease.Entities:
Mesh:
Substances:
Year: 2016 PMID: 28042565 PMCID: PMC5155069 DOI: 10.1155/2016/1327320
Source DB: PubMed Journal: Biomed Res Int Impact factor: 3.411
Distribution of strains in different areas of China.
| Areas | Number of isolates |
|---|---|
| Jilin Province | 31 |
| Guangdong Province | 2 |
| Inner Mongolia (Neimeng) | 11 |
| Shandong Province | 1 |
| Liaoning Province | 2 |
| Guizhou Province | 7 |
| Sichuan Province | 6 |
| Heilongjiang Province | 9 |
| Xinjiang Uygur Autonomous Region | 15 |
| Beijing Municipality | 3 |
| Hebei Province | 1 |
| Hunan Province | 1 |
| Total | 89 |
Genotypes of 89 Chinese strains by MLSA.
| MLSA genotypes | Number of strains |
|---|---|
|
| 1 |
|
| 67 |
|
| 16 |
|
| 5 |
| Total | 89 |
Base changes (nonsynonymous mutations) in 41 kD flagellin&.
| Base change | AA position | Number of changed strains | Distribution | |||
|---|---|---|---|---|---|---|
|
|
|
|
| |||
| GGC(G)-GCC(A) | 17 | — | — | 16 | — | ER# |
| GCA(A)-TCA(S) | 105 | — | — | 16 | 5 | NER# |
| TCT(S)-GCT(A) | 142 | — | — | — | 5 | ER |
| AGA(R)-AAA(K) | 146 | — | — | 16 | 5 | ER |
| GCA(A)-TCA(S) | 191 | — | — | 16 | — | ER |
| TCT(S)-GCT(A) | 199 | — | — | 16 | — | ER |
| ACT(T)-GCT(A) | 205 | — | 66 | 16 | — | ER |
| ACT(T)-TCT(S) | 205 | — | — | — | 5 | ER |
| GCT(A)-ACT(T) | 208 | — | 66 | — | — | ER |
| GAG(E)-GAC(D) | 213 | — | 1 | — | — | ER |
| GTT(V)-GCT(A) | 215 | — | 66 | 16 | 5 | ER |
| CAG(Q)-GAG(E) | 216 | — | — | 16 | — | ER |
| GCA(A)-ACA(T) | 224 | — | 1 | 16 | — | ER |
| TCT(S)-ACT(T) | 230 | — | — | 16 | — | ER |
| ATA(I)-GTG(V) | 260 | — | — | — | 5 | ER |
| AAT(N)-GAT(D) | 279 | — | 50 | — | — | NER |
&The CDS of 41 kD flagellin of Borrelia burgdorferi sensu stricto B31 has been used as the reference sequence.
#ER: epitope region; #NER: nonepitope region.
Amino acid changes of the B-cell epitopes included in 41 kD flagellin antigen.
| IEDB-ID | Epitopes | Base change |
|---|---|---|
| 26607 | IINHNTSAINASRNN | GGC(G)-GCC(A) |
| 27732 | INRIADQAQY | No change |
| 27733 | INRIADQAQYNQMHMLSNKSA | TCT(S)-GCT(A), AGA(R)-AAA(K) |
| 54118 | RIADQAQYNQ | No change |
| 752 | ADQAQYNQMH | No change |
| 50350 | QAQYNQMHML | No change |
| 53012 | QYNQMHMLSN | No change |
| 45589 | NQMHMLSNKS | No change |
| 41667 | MHMLSNKSA | TCT(S)-GCT(A) |
| 42062 | MLSNKSA | TCT(S)-GCT(A) |
| 59856 | SNKSA | TCT(S)-GCT(A), AGA(R)-AAA(K) |
| 7895 | DEAIAVNIY | GCA(A)-TCA(S), TCT(S)-GCT(A), |
| 35977 | LF | TCT(S)-GCT(A), ACT(T)-G(T)CT(A S)GCT(A)-ACT(T), GAG(E)-GAC(D), |
| 3341 | ANLF | TCT(S)-GCT(A), ACT(T)-G(T)CT(A S) |
| 58007 |
| TCT(S)-GCT(A), ACT(T)-G(T)CT(A S), |
| 52474 | Q | ACT(T)-G(T)CT(A S), GCT(A)-ACT(T) |
| 62967 |
| ACT(T)-G(T)CT(A S), GCT(A)-ACT(T) |
| 62968 |
| ACT(T)-G(T)CT(A S), GCT(A)-ACT(T) |
| 50213 | Q | GCT(A)-ACT(T), GAG(E)-GAC(D) |
| 379 |
| GCT(A)-ACT(T), GAG(E)-GAC(D) |
| 3893 | APVQ | GAG(E)-GAC(D), GTT(V)-GCT(A) |
| 70549 | VQ | GAG(E)-GAC(D), GTT(V)-GCT(A) |
| 70550 | VQ | GAG(E)-GAC(D), GTT(V)-GCT(A) |
| 50610 | Q | GAG(E)-GAC(D), GTT(V)-GCT(A) |
| 12306 |
| GAG(E)-GAC(D), GTT(V)-GCT(A), |
| 12307 |
| GAG(E)-GAC(D), GTT(V)-GCT(A) |
| 70628 |
| GTT(V)-GCT(A), CAG(Q)-GAG(E), |
| 52010 | Q | CAG(Q)-GAG(E), GCA(A)-ACA(T) |
| 50597 |
| CAG(Q)-GAG(E), GCA(A)-ACA(T) |
| 51693 | QP | GCA(A)-ACA(T), TCT(S)-ACT(T) |
| 3820 | AP | TCT(S)-ACT(T) |
| 3821 | AP | TCT(S)-ACT(T), ATA(I)-GTG(V) |
| 25890 | IENAIRM | ATA(I)-GTG(V) |
| 43169 | NAIRM | ATA(I)-GTG(V) |
| 28340 | IRM | ATA(I)-GTG(V) |
| 41672 | M | ATA(I)-GTG(V) |
| 57265 | SDQRANLGAF | No change |
| 52186 | QRANLGAFQN | No change |
| 3342 | ANLGAFQNRL | No change |
| 36055 | LGAFQNRLES | No change |
| 1379 | AFQNRLESIK | No change |
| 65265 | TMTDEVVAATTNSILTQSAMAMIAQANQVPQYVLSLLR | No change |
Note: letters in bold font in the table represent the mutated amino acids in epitopes.
Figure 1Phylogenetic analysis of 89 strains based on amino acid sequence of 41 kD flagellin.