Literature DB >> 27832785

Parasitological correlates of Plasmodium ovale curtisi and Plasmodium ovale wallikeri infection.

Melissa S Phuong1, Rachel Lau2, Filip Ralevski2, Andrea K Boggild3,4,5.   

Abstract

BACKGROUND: Malaria, due to Plasmodium ovale, can be challenging to diagnose due to clinically mild disease and low parasite burden. Two genetically distinct sub-species of P. ovale exist: Plasmodium ovale curtisi (classic) and Plasmodium ovale wallikeri (variant). It is presently unknown if the sub-species causing infection affects performance of malaria diagnostic tests. The aim of this work was to understand how the genetically distinct sub-species, P. o. curtisi and P. o. wallikeri, affect malaria diagnostic tests.
METHODS: Plasmodium ovale-positive whole blood specimens were sub-speciated by PCR and sequencing of 18S rRNA and dhfr-ts. Parasitaemia, morphology, pan-aldolase positivity, 18S copy number, and dhfr-ts sequences were compared between sub-species.
RESULTS: From 2006 to 2015, 49 P. ovale isolates were identified, of which 22 were P. o. curtisi and 27 P. o. wallikeri; 80% were identified in the last five years, and 88% were acquired in West Africa. Sub-species did not differ by parasitaemia, 18S copy number, or pan-aldolase positivity. Lack of Schüffner's stippling was over-represented among P. o. wallikeri isolates (p = 0.02). Several nucleotide polymorphisms between the sub-species were observed, but they do not occur at sites believed to relate to antifolate binding.
CONCLUSIONS: Plasmodium ovale is increasing among travellers to West Africa, although sub-species do not differ significantly by parasitologic features such as parasitaemia. Absence of Schüffner's stippling may be a feature specific to P. o. wallikeri and is a novel finding.

Entities:  

Keywords:  Malaria diagnosis; Microscopy; PCR; Plasmodium ovale; Rapid antigen detection test

Mesh:

Substances:

Year:  2016        PMID: 27832785      PMCID: PMC5103354          DOI: 10.1186/s12936-016-1601-2

Source DB:  PubMed          Journal:  Malar J        ISSN: 1475-2875            Impact factor:   2.979


Background

Plasmodium ovale is one species of malaria parasites that is pathogenic to humans [1]. Prevalent in West and East Africa and the Asia–Pacific [1], P. ovale infections can be challenging to diagnose in part due to the typical presentation of clinically mild disease and low parasite burden [2]. Consequently, conventional diagnostic tools, such as microscopy of blood films and rapid diagnostic tests (RDT), have limited performance in detecting P. ovale infection [3-5], often resulting in the use of molecular techniques to confirm the diagnosis [5]. Two genetically distinct sub-species of P. ovale exist: Plasmodium ovale curtisi and Plasmodium ovale wallikeri [7, 8], which are known as the classic and variant types, respectively. First recognized in 2010, these two sub-species are believed to have diverged one to two million years ago [7, 9]. Clinical differences between the two sub-species have not been clearly elucidated, although there have been differences found in latency period [9] and thrombocytopaenia [10]. At present, it is unknown if the performance of malaria diagnostic tests may differ between the sub-species, causing infection. It is known that the dihydrofolate reductase-thymidylate synthase (dhfr-ts) domain, a common anti-malarial drug target and a region that can be linked to antifolate resistance, has been thoroughly investigated in Plasmodium falciparum and Plasmodium vivax. However, investigations into this region have only recently begun for P. ovale isolates [2, 8, 11]. Previous reports have implicated specific sites in the peptide sequence that may interfere with antifolate binding at the active site, which include D53, F57, S58, T61, S113, S116, I169, and T190 [8, 11]. R499/503 and C519/523 (P. ovale curtisi/P. ovale wallikeri) are also believed to be significant for thymidylate synthase activity, specifically [8]. As atovaquone-proguanil, the proguanil component of which is an antifolate, is one of the most commonly and empirically used anti-malarials for travel-acquired malaria, it is important to understand if mutations in regions of dhfr-ts known to confer resistance in other species of malaria are present in P. ovale isolates, and if these mutations are specific to one sub-species over another. Further understanding of parasitologic correlates of P. ovale sub-species may have important implications for diagnosis and management. The potential differences in parasite burden, RDT performance, morphology, and molecular diagnosis between P. ovale curtisi and P. ovale wallikeri were investigated. The DHFR-TS peptide sequence was also compared between isolates to investigate potential mutations in regions known to confer antifolate resistance in other species of malaria.

Methods

Specimens

Plasmodium ovale-positive, whole blood specimens stored in the malaria biobank at Public Health Ontario Laboratories (PHOL) from October 2006 to July 2015 were identified and retrieved. For the staining procedure, 2 mL of standard Giemsa stain was diluted in 48 mL of phosphate buffer (pH 7.1) prior to use. The phosphate buffer consists of 65 mL of Na2HPO4, 35 mL of NaH2PO4, and 900 mL of distilled water, resulting in 4.35 and 2.33 mM concentrations, respectively. For thin films, the slide was immersed in methanol for 10 s, allowed to dry, and then immersed in the working Giemsa solution for 10 min. The slide was then immersed in phosphate buffer solution for 10 s and air dried. Thick films were immersed in the working Giemsa solution for 10 min, immersed in the phosphate buffer for 30 s, and air dried. With each working solution prepared, a control P. falciparum slide was prepared and examined. Parasitaemia, morphological features, pan-aldolase antigen-positivity as determined by the BinaxNOW Malaria test (Alere, Ottawa, ON, Canada), year of import, and country of acquisition that were recorded in the biobank database following initial diagnostic processing were collected and analysed. The study was approved by the Research Ethics Board of Public Health Ontario.

DNA extraction

DNA of all specimens was extracted using the DNA Mini Kit Blood or Body Fluid Spin Protocol (Qiagen, Germantown, MD, USA). Prior to use, DNA was stored at −20 °C.

Qualitative and quantitative real-time PCR

Plasmodium falciparum/P. vivax species-specific duplex [6] and Plasmodium malariae/P. ovale species-specific duplex real-time PCR (qPCR) assays were conducted to confirm microscopy species identification as previously described [12]. All qPCR assays were run under the following conditions using the ABI 7900HT qPCR system: 50 °C for 2 min, 95 °C for 10 min, 95 °C for 15 s, and 60 °C for 1 min (45 cycles); 12.5 µl of TaqMan universal PCR master mix (Life Technologies, Burlington, ON, Canada) and 5 µl of DNA primers and probes with concentrations as previously reported [6, 12, 13] were used, for a final volume of 25 µl per reaction. All qPCR amplification curves were analysed using a manual threshold cycle of 0.02 and an automatic baseline. A cycle threshold (Ct) of <38 was considered to be a positive result. 18S rRNA gene copy numbers were quantified by running the P. malariae/P. ovale species-specific duplex qPCR assay and including serial dilutions of a P. ovale clone (ATCC, Manassas, VA, USA) alongside specimen DNA in triplicates. A linear regression was then constructed based on the logarithm of the gene copy number and Ct values for each concentration of the clone. This equation could then be used to calculate the gene copy number for each banked specimen.

Sequencing of 18S rRNA and dihydrofolate reductase-thymidylate synthase

Endpoint PCR of target regions, visualization of the amplicons on agarose gel, and Sanger sequencing were conducted as previously described [12]. Specifically, endpoint PCR of a 396-bp product from the 18S rRNA region was conducted with high-fidelity polymerase AccuPrime Pfx Supermix (Life Technologies, Burlington, ON, Canada) and 200 nM (each) of the primers Plasmo 18S forward (5′-ATTCAGATGTCAGAGGTGAAATTCT-3′) and Plasmo 18S reverse (5′-TCAATCCTACTCTTGTCTTAAACTA-3′). Using an ABI Veriti fast thermal cycler, the cycling conditions were 95 °C for 5 min, followed by 95 °C for 15 s, 58 °C for 30 s, and 68 °C for 30 s for 45 cycles, and then 68 °C for 5 min. Amplicons were visualized on 1% agarose gels with ethidium bromide prior to Sanger sequencing. For sequencing, the same forward and reverse primers were used along with a BigDye Terminator v3.1 cycle sequencing kit (Life Technologies, Burlington, ON, Canada), which was run according to the manufacturer’s recommended conditions. The products were purified by a BigDye XTerminator (Life Technologies, Burlington, ON, Canada) and analysed with an ABI 3130xl genetic analyzer. Forward and reverse sequences of each sample were aligned using Vector NTI software (Life Technologies, Burlington, ON, Canada), and the sequences were verified using a BLAST search to confirm the sub-species identification [14]. Primers for sequencing the dhfr-ts gene were newly designed for this study. All primers were designed using Primer3 [15, 16] and predominantly conserved regions of the complete sequence of the P. ovale dhfr-ts gene (GenBank: EU266602). Degenerate nucleotides were included based on the dhfr-ts gene for P. o. curtisi (GenBank: KP050414) and P. o. wallikeri (GenBank: KP050415). Endpoint PCR of the dihydrofolate reductase-thymidylate synthase region was conducted on all specimens with high-fidelity polymerase Phusion (New England BioLabs, Ipswich, MA, USA) and 200 nM (each) of the primers PocPowDHFR-exF (5′-YTCWACCTTCAGGGGTATCG-3′) and PocPowDHFR-exR (5′-AGTTTWAGCGTGGGRAAAGG-3′), generating an approximately 1700-bp product that covers the 99th amino acid to 1814–1826th amino acid of the sequence, where the end target varies based on the sub-species. The cycling conditions were 98 °C for 30 min, followed by 98 °C for 10 s, 64 °C for 30 s, and 72 °C for 1 min for 40 cycles, and then 72 °C for 10 min using an ABI Veriti fast thermal cycler. Visualization and Sanger sequencing of the PCR products were performed identically compared to the 18S rRNA methodology with the exception of the primers used. For sequencing, PocPowDHFR-exF, PocPowDHFR-exR, and a third internal primer, PocPowDHFR-inR (5′-TTTCCATTKGTTTCCCCTCT-3′) were used. Sequences for each specimen were aligned and verified using a BLAST search to further confirm the sub-species identification. Alignments of P. ovale sequences were performed using Mega6 software [17]. Genetic and peptide sequences between the enrolled specimens and complete P. ovale sequences that were previously reported (GenBank: EU266601, EU266604–EU266618, GQ250090, GQ250091, KP050409, and KP05413–KP050415) [2, 7, 18] were compared.

Statistical analysis

Reported parasitaemia, morphological features (including Schüffner’s stippling), pan-aldolase antigen-positivity, 18S gene copy number, year of import, and region of acquisition were compared between the two sub-species. Parasitaemia was treated as categorical data by recording if the percentage of parasites observed were <0.1 or ≥0.1%, as the former category is a convention used by PHOL laboratory technicians. Categorical variables were compared using Yates’ corrected Chi squared analysis or Fisher’s exact test, and continuous variables using Mann–Whitney U tests using GraphPad Prism 6 (GraphPad Software, CA, USA). Level of significance was set at p < 0.05.

Results

Of 49 isolates of P. ovale identified from October 2006 to July 2015, ten (20.4%) were identified through 2010, while 39 (79.6%) were identified in or after the year 2011, with 24 (49%) identified in 2013 or 2014, the last two full years in the enrolment period. Country of exposure data were available for 17/49 (34.7%) specimens, with Nigeria being the most well represented source country (n = 9, 18.4%). Of the 17 isolates with an attached travel history, 15 (88.2%) were acquired in West Africa, with represented source countries of Nigeria, Ghana (n = 2), Ivory Coast (n = 1), Liberia (n = 1), Sierra Leone (n = 1), Congo (n = 1), and Cameroon (n = 1). Two isolates were imported from East or Saharan Africa, one each from Tanzania and the Sudan. Of 49 total isolates, 22 P. ovale curtisi and 27 P. ovale wallikeri isolates were identified by 18S rRNA sequencing (Table 1). Region of acquisition did not differ between sub-species (p = 1.00). Both sub-species appeared to emerge simultaneously in the past five years, with no difference between sub-species: six (27.3%) isolates of P. ovale curtisi were identified prior to 2011, and 16 (72.7%) in or after 2011, compared to four (14.8%) isolates of P. ovale wallikeri identified prior to 2011, and 23 (85.2%) in or after 2011 (p = 0.31) (Fig. 1).
Table 1

Pan-aldolase antigen-positivity (T2), parasitaemia, 18S rRNA gene copy number, reported Schüffner’s stippling, and the number of days between blood collection and processing Plasmodium ovale curtisi and Plasmodium ovale wallikeri specimens are recorded

Specimen numberSub-speciesAldolaseParasitaemia (%)18S rRNA gene copy number/µL bloodSchüffner’s stipplingNumber of days between blood collection and processingYear of importCountry of acquisition
1 P. ovale curtisi +0.811,649+12014Ivory Coast
2 P. ovale curtisi +0.65054+12014Nigeria
3 P. ovale curtisi 0.32132+72014Unknown
4 P. ovale curtisi +0.31928+12014Unknown
5 P. ovale curtisi +0.216,807+02012Unknown
6 P. ovale curtisi +0.2626+02014Unknown
7 P. ovale curtisi +0.2831+02014Unknown
8 P. ovale curtisi +0.13093NANA2006Unknown
9 P. ovale curtisi +0.18445+12011Ghana; Nigeria
10 P. ovale curtisi <0.18264+12009Unknown
11 P. ovale curtisi <0.13285+NA2009Nigeria
12 P. ovale curtisi <0.11765+02010Unknown
13 P. ovale curtisi <0.1931+02010Unknown
14 P. ovale curtisi <0.11972+02011Ghana
15 P. ovale curtisi +<0.14962+NA2007Unknown
16 P. ovale curtisi <0.1302+12012Unknown
17 P. ovale curtisi <0.1855+02014Nigeria
18 P. ovale curtisi +<0.12088+12015Nigeria
19 P. ovale curtisi <0.1538+12013Tanzania
20 P. ovale curtisi +<0.12991+NA2014Unknown
21 P. ovale curtisi <0.1325+12014Unknown
22 P. ovale curtisi <0.12637+12013Unknown
23 P. ovale wallikeri 0.512,70902011Unknown
24 P. ovale wallikeri +0.5283502014Unknown
25 P. ovale wallikeri +0.45013+02013Unknown
26 P. ovale wallikeri +0.37107+12008Unknown
27 P. ovale wallikeri 0.36826+02011Sudan
28 P. ovale wallikeri +0.315,840+42012Liberia
29 P. ovale wallikeri +0.38697+02012Nigeria
30 P. ovale wallikeri +0.33897+02014Unknown
31 P. ovale wallikeri 0.15114+12013Unknown
32 P. ovale wallikeri +0.12160+02013Unknown
33 P. ovale wallikeri 0.191+02014Unknown
34 P. ovale wallikeri <0.198502009Unknown
35 P. ovale wallikeri +<0.14402+12010Unknown
36 P. ovale wallikeri <0.1752+12011Unknown
37 P. ovale wallikeri <0.1935+02011Sierra Leone
38 P. ovale wallikeri <0.1538+12012Unknown
39 P. ovale wallikeri <0.173912013Unknown
40 P. ovale wallikeri NA<0.14+22009Nigeria
41 P. ovale wallikeri <0.1364+02012Congo
42 P. ovale wallikeri +<0.11898NA2013Cameroon
43 P. ovale wallikeri +<0.1435+02014Unknown
44 P. ovale wallikeri <0.151+02013Nigeria
45 P. ovale wallikeri +<0.145+12014Unknown
46 P. ovale wallikeri <0.125612013Nigeria
47 P. ovale wallikeri <0.1488+02013Unknown
48 P. ovale wallikeri <0.1187NA2012Unknown
49 P. ovale wallikeri <0.157102015Unknown

NA not available

Fig. 1

Plasmodium ovale isolates confirmed by Public Health Ontario Laboratories by year of import. 2006 and 2015 represent partial calendar years (October–December 2006, and January–June 2015). Emergence of P. ovale was equally distributed among the two sub-species, with six (27.3%) isolates of P. ovale curtisi identified prior to 2011, and 16 (72.7%) in or after 2011, compared to four (14.8%) isolates of P. ovale wallikeri identified prior to 2011, and 23 (85.2%) in or after 2011 (p = 0.31)

Pan-aldolase antigen-positivity (T2), parasitaemia, 18S rRNA gene copy number, reported Schüffner’s stippling, and the number of days between blood collection and processing Plasmodium ovale curtisi and Plasmodium ovale wallikeri specimens are recorded NA not available Plasmodium ovale isolates confirmed by Public Health Ontario Laboratories by year of import. 2006 and 2015 represent partial calendar years (October–December 2006, and January–June 2015). Emergence of P. ovale was equally distributed among the two sub-species, with six (27.3%) isolates of P. ovale curtisi identified prior to 2011, and 16 (72.7%) in or after 2011, compared to four (14.8%) isolates of P. ovale wallikeri identified prior to 2011, and 23 (85.2%) in or after 2011 (p = 0.31)

Microscopy and RDT

Records of pan-aldolase antigen result and morphological features were absent for one specimen, resulting in the omission of this isolate from relevant calculations. Median parasitaemia (by microscopy) of specimens positive for P. ovale curtisi was <0.1% (range <0.1–0.8%), while for P. ovale wallikeri it was <0.1% (range <0.1–0.5%), and no difference was found (p = 0.99). There was no difference found in pan-aldolase antigen-positivity, where it was detectable in 11 (50.0%) specimens containing P. ovale curtisi and 11 (42.3%) specimens containing P. ovale wallikeri (p = 0.81). Pan-aldolase positivity for all specimens was 45.8%. When comparing morphological features (Table 2), it was noted that all eight P. ovale parasites without Schüffner’s stippling were P. ovale wallikeri (p = 0.02) (Fig. 2). Parasitaemia (p = 0.20), 18S rRNA gene copy number (p = 0.50), and pan-aldolase antigen positivity (p = 0.40), were not found to be differentially associated with Schüffner’s stippling. Data on time between specimen collection and receipt were missing for two P. ovale wallikeri specimens without Schüffner’s stippling, and four P. ovale curtisi specimens, where three P. ovale curtisi specimens had Schüffner’s stippling and the other specimen had no morphological features recorded. No significant difference in time for specimen processing between specimens with and without Schüffner’s stippling was noted (p = 0.57).
Table 2

Number of isolates with Schüffner’s stippling noted at Giemsa-stained microscopy of specimens positive for Plasmodium ovale

Plasmodium ovale sub-speciesSchüffner’s stippling notedSchüffner’s stippling not noted
Plasmodium ovale curtisi 210
Plasmodium ovale wallikeri 198
Fig. 2

Giemsa-stained microscopy of Plasmodium ovale. Note prominent Schüffner’s stippling in a, compared to the absence of Schüffner’s stippling in b

Number of isolates with Schüffner’s stippling noted at Giemsa-stained microscopy of specimens positive for Plasmodium ovale Giemsa-stained microscopy of Plasmodium ovale. Note prominent Schüffner’s stippling in a, compared to the absence of Schüffner’s stippling in b

18S gene copy number

18S rRNA gene copy number was found to be not normally distributed among all samples based on the D’Agostino-Pearson normality test, p < 0.0001. Median 18S rRNA gene copy number for P. ovale curtisi and P. ovale wallikeri were 2110/µL (range 302–16,807/µL) and 844/µL (range 4–15,840/µL), respectively (p = 0.09).

Dihydrofolate reductase-thymidylate synthase (dhfr-ts)

Partial sequences of dfhr-ts could be obtained in 16 P. ovale wallikeri and seven P. ovale curtisi. In 26/49 isolates, the dhfr-ts region selected could not be amplified by the selected primer set. Several differences in the peptide sequences between P. ovale curtisi and P. ovale wallikeri were observed (Table 3). Non-synonymous mutations were observed within the P. ovale wallikeri isolates as previously reported [2]. Specifically, deletions of two or four amino acids (i.e., TA252–253 or TATA252–255) were identified in six and one P. ovale wallikeri isolates, respectively (Table 3). Furthermore, due to an ambiguity in the nucleic acid sequence, potential Y359F and Y366F mutations were observed. Finally, for one specimen, a H285Q mutation was recorded for one P. ovale wallikeri isolate. While Y359F and Y366F mutations are not expected to change any amino acid properties, a H285Q indicates a change from a basic histidine to a polar, uncharged glutamine. Among the sequences analysed in this study, polymorphisms specific to either sub-species were not observed (Table 4). One P. ovale wallikeri specimen did have a I169L mutation, although this does not reflect any changes in amino acid properties.
Table 3

Discrepant amino acids at the Plasmodium ovale DHFR-TS domain, either between sub-species or within sub-species

Specimen numberAmino acid number in Dhfr-ts domain
187204207209252–255267269280285296300306309320339342350355359366370374409450482501
2VEKTDELETEDDTYHVSKTEGAS/TP/QYYIN/KNDNDNDND
4VEKTDELETEDDTYHVSKTEGATQYYIKNDNDNDND
8VEKTDELETEDDTYHVSKTEGATQYYIKINDL
9VEKTDELETEDDTYHVSKTEGATQYYIKINNDND
17NDNDNDNDNDNDNDNDNDVSKTEGATQYYIKNDNDNDND
21VEKTDELETEDDTYHVSKTEGATQYYIKNDNDNDND
22VEKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi KP050414.1VEKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi KP050413.1VEKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi EU266611VEKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi EU266608VEKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi EU266609VEKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi EU266610VGKTDELETEDDTYHVSKTEGATQYYIKINDL
P. ovale curtisi EU266606VEKTDELETEDDTYHVSKTEGATQYYIKIKDL
P. ovale curtisi EU266607VEKTDELETEDDTYHVSKTEGATQYYIKINDL
23IDEATATAASFQGGGADMVSQYYMKVKET
24IDEATATAASFHGGGADMVSQYYMKVKET
26IDEATATAASFHGGGADMVSQY/FY/FMKVKET
27IDEADELETEDASFHGGGADMVSQY/FY/FMKVKET
28IDEATATAASFHGGGADMVSQYYMKVKET
29IDEATA–ASFHGGGADMVSQYYMKVKET
30IDEATATAASFHGGGADMVSQYYMKVKET
33IDEATA–ASFHGGGADMVSQY/FYMKVKET
34IDEATATAASFHGGGADMVSQYYMKVKET
35IDEATATAASFHGGGADMVSQYYMKVKET
37IDEATATAASFHGGGADMVSQYYMKVKET
39IDEATA–ASFHGGGADMVSQYYMKVKET
41IDEATA–ASFHGGGADMVSQYYMKVKET
42IDEATATAASFHGGGADMVSQYYMKVKET
43IDEATA–ASFHGGGADMVSQYYMKVKET
44IDEATATAASFHGGGADMVSQYYMKVKNDND
P. ovale wallikeri KP050415.1IDEATATAASFHGGGADMVSQYYMKVKET
P. ovale wallikeri KP050409.1IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266612IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266613IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266614IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266615IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266617IDETTA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri GQ250090IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266616IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266618IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri GQ250091IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266601IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266604IDEATATAASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266603IDEATA–ASFHGGGADMVSQYYMKVKET
P. ovale wallikeri EU266605IDEATATAASFHGGGADMVSQYYMKVKET

ND not determined

Table 4

Amino acids at the Dhfr-ts domain believed to affect antifolate binding

Plasmodium ovale isolateAmino acid number in Dhfr-ts domain relevant to antifolate binding
53575861113116169190503523
P. ovale curtisi KP050414.1
 2NDNDNDNDNDNDITNDND
 4NDFSTSSITRC
 8NDFSTSSITRC
 9NDFSTSSITRC
 17NDNDNDNDNDNDNDNDNDND
 21NDNDNDNDNDNDITNDND
 22NDFSTSSITRC
P. ovale curtisi EU266611DFSTSSITRC
P. ovale curtisi EU266608DFSTSSITRC
P. ovale curtisi EU266609DFSTSSITRC
P. ovale curtisi EU266610DFSTSSITRC
P. ovale curtisi EU266606DFSTSSITRC
P. ovale curtisi EU266607DFSTSSITRC
 23NDNDNDNDSSITRC
 24DFSTSSITRC
 26NDFSTSSLTRC
 27NDNDNDNDSSITRC
 28NDFSTSSITRC
 29NDNDNDNDSSITRC
 30DFSTSSITRC
 33NDFSTSSITRC
 34NDFSTSSITRC
 35DFSTSSITRC
 37DFSTSSITRC
 39NDFSTSSITRC
 41DFSTSSITRC
 42NDFSTSSITRC
 43NDNDNDNDSSITRC
 44NDNDNDNDSSITRC
P. ovale wallikeri KP050415.1DFSTSSITRC
P. ovale wallikeri KP050409.1DLRTSSITRC
P. ovale wallikeri EU266612DFSTSSITRC
P. ovale wallikeri EU266613DFSTSSITRC
P. ovale wallikeri EU266614DFSTSSITRC
P. ovale wallikeri EU266615DFSTSSITRC
P. ovale wallikeri EU266617DFSTSSITRC
P. ovale wallikeri GQ250090DFSTSSITRC
P. ovale wallikeri EU266616DFSTSSITRC
P. ovale wallikeri EU266618DFSTSSITRC
P. ovale wallikeri GQ250091DFSTSSITRC
P. ovale wallikeri EU266601DFSTSSITRC
P. ovale wallikeri EU266604DFSTSSITRC
P. ovale wallikeri EU266603DFSTSSITRC
P. ovale wallikeri EU266605DFSTSSITRC

ND not determined

Discrepant amino acids at the Plasmodium ovale DHFR-TS domain, either between sub-species or within sub-species ND not determined Amino acids at the Dhfr-ts domain believed to affect antifolate binding ND not determined

Discussion

Plasmodium ovale is increasingly observed among travellers, and due to its ability to relapse months to years after primary infection; unlike the more common and severe P. falciparum, its ability to inflict acute morbidity continues long after the immediate post-travel period. The data reported herein underscore the anecdotal impression among laboratory personnel that P. ovale is increasing among travellers returning from West Africa, with almost 80% of imports to PHOL occurring in the last five years. Between 2007 and 2012, P. ovale diagnoses climbed from one per year to eight per year at PHOL [12]. Although it appeared in this study that many more P. ovale wallikeri isolates were imported in the past five years compared to P. ovale curtisi, this difference was not significant, although with higher numbers over a longer enrolment period such a difference may emerge. Due to widespread attrition of trained microscopists in laboratories of non-malaria endemic regions, such as North America, diagnosis of malaria is becoming increasingly reliant on RDT and molecular methods. However, given the extremely poor sensitivity of standard RDT for P. ovale infection [19], as well as typically low parasitaemia, under- and delayed diagnosis are increasingly likely. In addition, diagnostic morphologic features may not be demonstrable in the setting of extremely low parasitaemia, prompting empiric use of anti-malarials for a patient whose malaria screen is initially reported as “Plasmodium spp.” pending confirmatory molecular analysis. Standard choice of empiric oral therapy for uncomplicated malaria in North America is usually either atovaquoneproguanil (AP), or more rarely, artemether-lumefantrine. As resistance to the proguanil component of AP is conferred in P. falciparum by step-wise mutations of the Dhfr gene, understanding whether or not similar mutations can accumulate in P. ovale, and whether such mutations are over-represented among a particular sub-species of P. ovale, is important for informing empiric choice of anti-malarials in a patient with unspeciated malaria. Among peptide sequences of DHFR-TS in isolates of P. ovale curtisi and P. ovale wallikeri studied herein, mutations known to confer antifolate resistance in other species of malaria, notably P. falciparum were not demonstrated Furthermore, non-synonymous mutations within each sub-species, P. ovale wallikeri in particular, were also observed, confirming previous reports [2]. While there are variations in the peptide sequences between sub-species, it is unknown how these polymorphisms influence enzyme activity. Amino acids in the DHFR-TS that are believed to be involved in antifolate binding, and which are believed to be synonymous with amino acids found in other Plasmodium species, were found to be consistent throughout all examined P. ovale specimens, regardless of sub-species. These findings suggest that the lack of clinical treatment failures observed in patients with P. ovale correlate well to gene sequences free of known markers of resistance, and are reassuring from the perspective of empiric choice of anti-malarials. It would be very unlikely, and unfortunate, for a traveller from West Africa with unspeciated malaria to be started empirically on chloroquine, which is actually the drug of choice for P. ovale, rather than AP. Many reports have documented the existence of the two sub-species of P. ovale; it was previously unknown if parasitaemia, 18S rRNA gene copy number and the detection of the pan-aldolase antigen in BinaxNow RDT could differ between them. The results reported herein indicate that P. ovale curtisi and P. ovale wallikeri do not differ significantly by parasitaemia, pan-aldolase antigen-positivity or 18S rRNA gene copy number. A general low pan-aldolase antigen-positivity rate among all specimens was observed, which is consistent with previous literature [19, 20]. A lack of discernible Schüffner’s stippling may be a feature specific to P. ovale wallikeri, and may further challenge microscopists who rely on this as one of the features to distinguish P. ovale from the similarly low parasitaemic P. malariae, particularly when not all differentiating morphologies are present on the slide. As previously noted, P. ovale wallikeri cases appeared to increase more so than P. ovale curtisi in the past five years, and if this trend were to continue, the lack of Schüffner’s stippling may further hinder interpretation of microscopy and RDT results. The lack of Schüffner’s stippling among P. ovale wallikeri isolates joins other findings that the sub-species have distinguishing clinical characteristics, such as latency and degree of thrombocytopaenia, in addition to their genotype [9, 10]. That said, molecular techniques are still the most accurate and specific method for determining sub-species of P. ovale. Limitations of the study include a relatively small sample size which limited the ability to comment on the possible emergence of variant over classic P. ovale, an inability to investigate DHFR-TS enzyme activity, and possible variation in Schüffner’s stippling visualization due to factors such as the age of the Giemsa stain or operator experience. As well, the attempt to account for time for specimen processing may be limited in terms of precision, as the exact time when blood was collected from patients was unavailable, meaning that this variable could only be analysed on the order of days rather than hours, the latter of which would have been ideal. Full clinical linkage of specimens was lacking and therefore data on latency of P. ovale infection or full travel details were unavailable. The limited availability of gene sequences in GenBank also restricted the ability to investigate the full dhfr-ts region and other potential virulence factors that could theoretically differ between the sub-species. Future studies, including whole genome sequencing of P. ovale, will facilitate identification of genes of other known Plasmodium virulence factors that have not been previously investigated in P. ovale. In particular, nucleotide and peptide heterogeneity between the two sub-species can be further explored across a larger sample size to extrapolate potential consequences in protein structure. Clinical outcomes can also be investigated prospectively to determine whether specific polymorphisms have any effect on delayed parasite clearance and treatment failure. Future prospective investigation of the Schüffner’s stippling finding in P. ovale wallikeri versus P. ovale curtisi by diligent exclusion of competing factors, such as time to specimen processing, would further add to the literature around morphological identification, considering that microscopy remains the gold standard diagnostic test in malaria, and is often the only diagnostic test available in under-resourced settings.

Conclusions

This study demonstrates that the two P. ovale sub-species, P. ovale curtisi and P. ovale wallikeri, are increasing among travellers to West Africa, and do not differ significantly by parasitaemia, RDT positivity, or 18S rRNA gene copy number, and may therefore be treated similarly from a clinical management perspective. A lack of discernible Schüffner’s stippling on microscopic examination may be a feature specific to P. ovale wallikeri, and one which may significantly challenge the diagnosis of this typically low parasitaemic species, especially as loss of technical expertise in diagnostic laboratories continues. Although nucleotide polymorphisms in dhfr-ts were identified, it is unknown if they could lead to antifolate resistance, as they did not occur in regions known to confer antifolate resistance in other species such as P. falciparum. Further interrogation of the relevance of such genetic differences is warranted.
  20 in total

1.  Enhancements and modifications of primer design program Primer3.

Authors:  Triinu Koressaar; Maido Remm
Journal:  Bioinformatics       Date:  2007-03-22       Impact factor: 6.937

2.  MEGA6: Molecular Evolutionary Genetics Analysis version 6.0.

Authors:  Koichiro Tamura; Glen Stecher; Daniel Peterson; Alan Filipski; Sudhir Kumar
Journal:  Mol Biol Evol       Date:  2013-10-16       Impact factor: 16.240

3.  Ineffectiveness of the Binax NOW malaria test for diagnosis of Plasmodium ovale malaria.

Authors:  Christine Bigaillon; Eléonore Fontan; Jean-Didier Cavallo; Eric Hernandez; André Spiegel
Journal:  J Clin Microbiol       Date:  2005-02       Impact factor: 5.948

Review 4.  Malaria rapid diagnostic tests in travel medicine.

Authors:  J Maltha; P Gillet; J Jacobs
Journal:  Clin Microbiol Infect       Date:  2013-02-01       Impact factor: 8.067

5.  Evaluation of the intra- and inter-specific genetic variability of Plasmodium lactate dehydrogenase.

Authors:  Arthur M Talman; Linda Duval; Eric Legrand; Véronique Hubert; Seiha Yen; David Bell; Jacques Le Bras; Frédéric Ariey; Sandrine Houze
Journal:  Malar J       Date:  2007-10-25       Impact factor: 2.979

6.  Multiplexed real-time PCR assay for discrimination of Plasmodium species with improved sensitivity for mixed infections.

Authors:  Sandra E Shokoples; Momar Ndao; Kinga Kowalewska-Grochowska; Stephanie K Yanow
Journal:  J Clin Microbiol       Date:  2009-02-25       Impact factor: 5.948

7.  Cloning and heterologous expression of Plasmodium ovale dihydrofolate reductase-thymidylate synthase gene.

Authors:  Srisuda Tirakarn; Pinpunya Riangrungroj; Palangpon Kongsaeree; Mallika Imwong; Yongyuth Yuthavong; Ubolsree Leartsakulpanich
Journal:  Parasitol Int       Date:  2012-01-02       Impact factor: 2.230

8.  Multiplex real-time quantitative PCR, microscopy and rapid diagnostic immuno-chromatographic tests for the detection of Plasmodium spp: performance, limit of detection analysis and quality assurance.

Authors:  Krishna Khairnar; Donald Martin; Rachel Lau; Filip Ralevski; Dylan R Pillai
Journal:  Malar J       Date:  2009-12-09       Impact factor: 2.979

9.  A 20-year longitudinal study of Plasmodium ovale and Plasmodium malariae prevalence and morbidity in a West African population.

Authors:  Clémentine Roucher; Christophe Rogier; Cheikh Sokhna; Adama Tall; Jean-François Trape
Journal:  PLoS One       Date:  2014-02-10       Impact factor: 3.240

10.  Molecular characterization of misidentified Plasmodium ovale imported cases in Singapore.

Authors:  Jean-Marc Chavatte; Sarah Bee Hui Tan; Georges Snounou; Raymond Tzer Pin Valentine Lin
Journal:  Malar J       Date:  2015-11-14       Impact factor: 2.979

View more
  7 in total

1.  Distinction of Plasmodium ovale wallikeri and Plasmodium ovale curtisi using quantitative Polymerase Chain Reaction with High Resolution Melting revelation.

Authors:  V Joste; C Kamaliddin; E Kendjo; V Hubert; N Argy; S Houzé
Journal:  Sci Rep       Date:  2018-01-10       Impact factor: 4.379

2.  Polymorphism analysis of propeller domain of k13 gene in Plasmodium ovale curtisi and Plasmodium ovale wallikeri isolates original infection from Myanmar and Africa in Yunnan Province, China.

Authors:  Mengni Chen; Ying Dong; Yan Deng; Yanchun Xu; Yan Liu; Canglin Zhang; Herong Huang
Journal:  Malar J       Date:  2020-07-13       Impact factor: 2.979

3.  A comparison of two PCR protocols for the differentiation of Plasmodium ovale species and implications for clinical management in travellers returning to Germany: a 10-year cross-sectional study.

Authors:  Hagen Frickmann; Christine Wegner; Stefanie Ruben; Ulrike Loderstädt; Egbert Tannich
Journal:  Malar J       Date:  2019-08-09       Impact factor: 2.979

4.  Plasmodium ovale wallikeri and P. ovale curtisi Infections and Diagnostic Approaches to Imported Malaria, France, 2013-2018.

Authors:  Valentin Joste; Justine Bailly; Véronique Hubert; Cécile Pauc; Mathieu Gendrot; Emilie Guillochon; Marylin Madamet; Marc Thellier; Eric Kendjo; Nicolas Argy; Bruno Pradines; Sandrine Houzé
Journal:  Emerg Infect Dis       Date:  2021-02       Impact factor: 6.883

Review 5.  Parasite-Host Interaction and Pathophysiology Studies of the Human Relapsing Malarias Plasmodium vivax and Plasmodium ovale Infections in Non-Human Primates.

Authors:  Erica M Pasini; Clemens H M Kocken
Journal:  Front Cell Infect Microbiol       Date:  2021-02-17       Impact factor: 5.293

6.  Prospective comparative multi-centre study on imported Plasmodium ovale wallikeri and Plasmodium ovale curtisi infections.

Authors:  Gerardo Rojo-Marcos; José Miguel Rubio-Muñoz; Andrea Angheben; Stephane Jaureguiberry; Silvia García-Bujalance; Lina Rachele Tomasoni; Natalia Rodríguez-Valero; José Manuel Ruiz-Giardín; Joaquín Salas-Coronas; Juan Cuadros-González; Magdalena García-Rodríguez; Israel Molina-Romero; Rogelio López-Vélez; Federico Gobbi; María Calderón-Moreno; Esteban Martin-Echevarría; Matilde Elía-López; José Llovo-Taboada
Journal:  Malar J       Date:  2018-10-30       Impact factor: 2.979

7.  Identification of Reticulocyte Binding Domain of Plasmodium ovale curtisi Duffy Binding Protein (PocDBP) Involved in Reticulocyte Invasion.

Authors:  Mohammad Rafiul Hoque; Myat Htut Nyunt; Jin-Hee Han; Fauzi Muh; Seong-Kyun Lee; Ji-Hoon Park; Feng Lu; Won Sun Park; Eun-Taek Han; Sunghun Na
Journal:  Front Cell Infect Microbiol       Date:  2021-12-10       Impact factor: 5.293

  7 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.