Literature DB >> 27625661

The SOD Gene Family in Tomato: Identification, Phylogenetic Relationships, and Expression Patterns.

Kun Feng1, Jiahong Yu2, Yuan Cheng3, Meiying Ruan3, Rongqing Wang3, Qingjing Ye3, Guozhi Zhou3, Zhimiao Li3, Zhuping Yao3, Yuejian Yang3, Qingsong Zheng4, Hongjian Wan3.   

Abstract

Superoxide dismutases (SODs) are critical antioxidant enzymes that protect organisms from reactive oxygen species (ROS) caused by adverse conditions, and have been widely found in the cytoplasm, chloroplasts, and mitochondria of eukaryotic and prokaryotic cells. Tomato (Solanum lycopersicum L.) is an important economic crop and is cultivated worldwide. However, abiotic and biotic stresses severely hinder growth and development of the plant, which affects the production and quality of the crop. To reveal the potential roles of SOD genes under various stresses, we performed a systematic analysis of the tomato SOD gene family and analyzed the expression patterns of SlSOD genes in response to abiotic stresses at the whole-genome level. The characteristics of the SlSOD gene family were determined by analyzing gene structure, conserved motifs, chromosomal distribution, phylogenetic relationships, and expression patterns. We determined that there are at least nine SOD genes in tomato, including four Cu/ZnSODs, three FeSODs, and one MnSOD, and they are unevenly distributed on 12 chromosomes. Phylogenetic analyses of SOD genes from tomato and other plant species were separated into two groups with a high bootstrap value, indicating that these SOD genes were present before the monocot-dicot split. Additionally, many cis-elements that respond to different stresses were found in the promoters of nine SlSOD genes. Gene expression analysis based on RNA-seq data showed that most genes were expressed in all tested tissues, with the exception of SlSOD6 and SlSOD8, which were only expressed in young fruits. Microarray data analysis showed that most members of the SlSOD gene family were altered under salt- and drought-stress conditions. This genome-wide analysis of SlSOD genes helps to clarify the function of SlSOD genes under different stress conditions and provides information to aid in further understanding the evolutionary relationships of SOD genes in plants.

Entities:  

Keywords:  SOD gene family; abiotic stress; gene expression; promoter; superoxide dismutase; tomato

Year:  2016        PMID: 27625661      PMCID: PMC5003820          DOI: 10.3389/fpls.2016.01279

Source DB:  PubMed          Journal:  Front Plant Sci        ISSN: 1664-462X            Impact factor:   5.753


Introduction

It is well known that toxic free radicals caused by environmental stresses such as cold, drought, and water-logging are great challenges for crop production (Mittler and Blumwald, 2010). Among them are reactive oxygen species (ROS), toxic free radicals produced in plant cells in response to stress, which can damage membranes, oxidize proteins, and cause DNA lesions (Sun et al., 2007; Wang and Prabakaran, 2011; Feng et al., 2015). However, in the process of evolution, plants have developed defense mechanisms to alleviate the damage caused by adverse environmental conditions. For example, some well-known ROS-scavenging enzymes can defend plants against environmental stress by controlling the expression of enzyme responsive family genes, including superoxide dismutase (SOD), peroxidase (POD), catalase (CAT), glutathione peroxidase (GPX), and peroxiredoxin (PrxR) (Mittler et al., 2004; Filiz and Tombuloğlu, 2014). Superoxide dismutases, a group of metalloenzymes, were first found in bovine erythrocytes in Mann and Keilin (1938). Subsequently, they were also described in bacteria, higher plants, and vertebrates (Rabinowitch and Sklan, 1980; Tepperman and Dunsmuir, 1990; Kim et al., 1996; Zelko et al., 2002). McCord and Fridovich (1969), researchers found that SODs can catalyze the dismutation of the superoxide to O2 and H2O2 (Tepperman and Dunsmuir, 1990). In plants, SODs have been detected in roots, leaves, fruits, and seeds (Giannopolitis and Ries, 1977; Tepperman and Dunsmuir, 1990), where they provide basic protection to cells against oxidative stress. Based on their metal cofactors, protein folds, and subcellular distribution, SODs are mainly categorized as Cu/ZnSODs, FeSODs, and MnSODs (Alscher and Erturk, 2002; Molina-Rueda et al., 2013; Filiz and Tombuloğlu, 2014; Feng et al., 2015). Cu/ZnSODs can be found in prokaryotic and eukaryotic organisms, were first isolated from Photobacterium leiognathi in Puget and Michelson (1974; Deshazer et al., 1994), and are present in the cytoplasm, chloroplasts, and/or the extracellular space in plant cells (Pilon et al., 2011). In mammalian cells, the molecular weight of Cu/ZnSODs is about 32 kDa, and they can be found in cytoplasm, nuclear compartments, and lysosomes (Chang et al., 1988; Keller et al., 1991; Crapo et al., 1992; Liou et al., 1993). FeSODs have been found in plant chloroplasts and cytoplasm (Moran et al., 2003; Miller, 2012). MnSODs, widely present in all major kingdoms, have been observed in eukaryotic mitochondria (Lynch and Kuramitsu, 2000) and can protect mitochondria by scavenging ROS (Moller, 2001). MnSODs also play an important role in promoting cellular differentiation (Wispé et al., 1992; Clair et al., 1994). In addition, a new type of SOD, NiSOD, has been reported in Streptomyces (Youn et al., 1996). However, no evidence for NiSOD has been found in plants (Felisa et al., 2005). In recent years, some studies have reported that SODs can protect plants against abiotic and biotic stresses, such as heat, cold, drought, salinity, abscisic acid and ethylene (Wang et al., 2004; Pilon et al., 2011; Asensio et al., 2012; Feng et al., 2015). Under various environmental stress conditions, researchers have found that different types of SOD genes have different expression patterns. For example, under drought stress, expression patterns of banana genes MaMSD1A and MaCSD1B were completely opposite to one another (Feng et al., 2015). Moreover, SODs with the same metal cofactor did not always play the same role in different species. For example, while we found that expression of MnSODs was not altered under oxidative stress conditions in Arabidopsis, researchers found that MnSOD expressions were changed significantly under salt stress in pea and cold and drought stresses in wheat (Gómez et al., 1999; Wu et al., 1999; Baek and Skinner, 2003). These results show that different SOD genes have different expression patterns in plants in response to diverse environmental stresses. Additionally, researchers have also found that alternative splicing and miRNAs may participate in the regulation of SOD expression (Srivastava et al., 2009; Lu et al., 2011). To date, the SOD gene family has been described in many plant species, including Arabidopsis thaliana, Musa acuminata, Sorghum bicolor, and Populus trichocarpa (Kliebenstein and Last, 1998; Molina-Rueda et al., 2013; Filiz and Tombuloğlu, 2014; Feng et al., 2015). Tomato is not only an important staple and economic crop, but also plays a vital role as an experimental model plant (Mueller et al., 2005). In previous studies, two SOD-coding cDNA sequences isolated from tomato leaves were identified as Cu/ZnSOD genes and were found to be distributed on different chromosomes (Perl-Treves et al., 1990, 1988). Subsequently, the expression levels of two Cu/ZnSOD genes in tomato organs during leaf growth and fruit ripening were reported (Perl-Treves and Galun, 1991). Further, Perl et al. (1993) found that over-expression of Cu/ZnSODs in potato showed that transgenic plants exhibited increased tolerance to oxidative stress. Recently, great efforts have been made to explore the roles of SOD genes in improving tomato tolerance to various environmental stresses, such as heat, salt, drought, cold, and bacteria (Mazorra et al., 2002; Li, 2009; Sasidharan et al., 2013; Soydam et al., 2013; Aydin et al., 2014). In addition, several recent studies have indicated that SOD played an important role of hormone and insecticide stresses. For example, Bernal et al. (2009) detected that the expression level of cytosolic Cu/Zn-SOD was increased after 1 day of auxin treatment for tomato. Chahid et al. (2015) studied the activity of SOD in tomato in response to xenobiotics stresses such as alpha-cypermethrin, chlorpyriphos, and pirimicarb. As described above, SOD gene families have been widely implicated in responses to abiotic and biotic stresses in tomato. However, these studies have mainly concentrated on the expression of a single form of SOD enzyme and on changes in the enzymatic antioxidant system under various environmental stresses, and little has been reported on the SOD gene family in tomato. To comprehensively understand the putative roles of SOD genes in tomato, a systematic analysis of the SOD gene family was necessary at the whole-genome level. Recently, the whole-genome sequence of tomato was made available, which provided opportunities for analyzing the expression patterns and regulation mechanisms of the tomato SOD (SlSOD) gene family in response to environment stresses. Hence, the objectives of this study were (i) to identify the SOD gene family in tomato; (ii) to analyze gene structure, duplication and expression patterns in different tomato tissues; (iii) to illustrate chromosomal locations and phylogenetic relationships with SODs from other plants; and (iv) to reveal the regulating mechanisms of the SlSOD gene family under abiotic (salt and drought) stress by using real-time fluorescence quantitative PCR (qRT-PCR).

Materials and Methods

Identification of SOD Genes in Tomato and Other Plant Species

In this study, two methods were used to identify potential SOD genes in tomato. First, the whole tomato genome was downloaded from Sol Genomics Network (SGN[1]) and a local database was constructed using the software Bioedit 7.0 (Pan and Jiang, 2014). Four SOD amino acid sequences from Solanum lycopersicum (AF527880-CuSOD), S. tuberosum (EU545469-FeSOD), Arabidopsis thaliana (AAM62550.1-MnSOD) and Musa acuminata AAA Group (AEZ56248.2-FeSOD) were used as a query against the local tomato amino acid database. Second, Hidden Markov Model (HMM) profiles of Cu/ZnSOD (PF00080), Fe-MnSOD (PF00081, PF02777) were downloaded from Pfam[2]. A BlastP search was performed to retrieve candidate tomato SOD genes. For BlastP, e-value was set at 1e-5. All redundant putative SOD sequences were excluded. The remaining SOD sequences were examined for copper/zinc and iron/manganese SOD domains by the Pfam server2. Physicochemical characteristics of SOD amino acid sequences were predicted by the Protparam tool[3], including molecular weight (MW), and theoretical isoelectric point (pI) (Gasteiger et al., 2005). In addition, to reveal the evolutionary relationships between SOD genes in different plant species, potential SOD genes from eight plant species were selected for phylogenetic analysis. Among them, SOD genes from four plant species (Vitis vinifera, Solanum tuberosum, Zea mays, and Panicum miliaceum) were identified using the same method above. The SOD genes of the remaining plant species (Poplar, Arabidopsis thaliana, Oryza sativa, Sorghum bicolor) were derived from previously published studies (Kliebenstein and Last, 1998; Dehury et al., 2012; Molina-Rueda et al., 2013; Filiz and Tombuloğlu, 2014).

Subcellular Localization, Conserved Motifs, and Gene Structure Analysis of SlSOD Proteins

Subcellular localization of SOD proteins from different plant species was obtained from the ProtComp9.0 server[4] (Feng et al., 2015). Conserved motif analysis of SlSOD genes was performed by the Multiple Em for Motif Elicitation (MEME Suite 4.11.1) server[5] (Bailey et al., 2009). We used the method described by Feng et al. (2015), except that the number of motifs was set to 8. Intron/exon configurations of SlSOD genes were determined via the Gene Structure Display Server[6], for both coding sequences and genomic sequences (Hu et al., 2015).

Chromosomal Location and Gene Duplication

Information about chromosomal location of SlSOD genes was obtained from the SGN database and gene duplications were identified by the Plant Genome Duplication Database (PGDD)[7] (Singh and Jain, 2015). Tandemly duplicated SlSOD genes were identified according to methods reported by previous researchers (Yang and Tuskan, 2008; Tuskan et al., 2006). Chromosomal locations of the SlSOD genes were performed with the MapDraw V2.1 tool based on information from the SGN database (Huang et al., 2012). Sequence similarity of SODs was calculated using the program DNAMAN.

Phylogenetic Tree Construction of SODs

To investigate the phylogenetic relationships of SlSOD genes, a total of 108 SOD protein sequences were identified from nine plant species. Among them, 24 SOD protein sequences were excluded owing to the SOD domains being incomplete. Multiple sequence alignments of the remaining 84 SOD amino acid sequences were performed with ClustalW (Higgins et al., 1996) using default parameters. A phylogenetic tree was constructed using the software MEGA5.04 via neighbor-joining method (Tamura et al., 2011). In the phylogenetic tree, the degree of support for a particular grouping pattern was evaluated using bootstrap (1000 replicates) value (Filiz et al., 2014). The tree was viewed with FigTree (v1.3.1).

Promoter Sequence Analysis

Regions 1,000 bp upstream from the start codons of each SlSOD gene were downloaded from SGN. Then, cis-elements in promoters of each SlSOD gene were predicted using the PlantCARE server (Postel et al., 2002).

Expression Patterns of SlSOD Genes Based on RNA-seq and Microarray Data

For RNA-seq analysis, transcription data of the genome-wide gene expression of the tomato cultivar Helnz were downloaded from the tomato functional genomics database (TFGD)[8] (Fei et al., 2011). Ten different tissues were selected: root, leaf, bud, flower, 1-cm fruit, 2-cm fruit, 3-cm fruit, mature green fruit (MG), fruit at the fruit breaking stage (B), and fruit 10 days after the fruit breaking stage (B10). RPKM (Reads Per Kilo bases per Million mapped Reads) values of SlSOD genes were log2-transformed (Wei et al., 2012). Heat maps of SlSOD genes in different tissues were generated using MeV4.9 software (Singh and Jain, 2015). In addition, microarray data for salt and drought stresses were downloaded from the TOM2 cDNA array and Affymetrix Tomato Genome Array platform from TFGD (Fei et al., 2011). Probe sets corresponding to SlSOD genes were identified using the Probe Match Tool in NetAffx Analysis Center[9] (Altschul et al., 1997). A BlastN search was performed based on sequence alignment between probe sequences and SlSOD sequences. Expression patterns of SlSOD genes under salt and drought stresses were viewed using MeV4.9 software (Singh and Jain, 2015).

Plant Materials and Stress Treatment

Seeds of a tomato breeding strain, Zhe fen 202, were germinated on water-saturated filter paper. Before germinating, a 10% hypochlorous acid solution was used to sterilize seeds for 5 min. Then, seeds were washed three times with distilled water. Seedlings were grown on Hoagland nutrient solution, in a controlled chamber (25°C/20°C, day/night, 16 h/12 h light/dark cycle). Upon development of the fourth true leaf, seedlings were cultivated in Hoagland nutrient solution with 150 mM sodium chloride (NaCl) and 18% polyethylene glycol (PEG) for treatment (3 and 12 h), respectively. Leaves were collected and frozen in liquid nitrogen immediately and stored at -80°C. Three biological replications were carried out.

RNA Extraction and qRT-PCR Data Analysis

RNA extraction was performed using the RNAsimple Total RNA Kit (TIANGEN, Beijing, China) according to manufacturer instructions. Before reverse transcription, the quality of RNA samples was checked by agarose gel electrophoresis. All RNAs were reverse transcribed into cDNA using the FastQuant RT Kit with gDNase (TIANGEN, Beijing, China) according to manufacturer instructions. Specific primers for qRT-PCR analysis were designed using the GenScript server[10] (Supplementary Table S1) and were synthesized by Sangon Biotech (Shanghai). The GAPDH gene was used as an internal control (Expósito-Rodríguez et al., 2008). An ABI StepOne real time fluorescence quantitative PCR instrument (Applied Biosystems, American) was used for qRT-PCR analysis. The quality and specificity of primers was determined by the melt curve (Feng et al., 2015). Three independent technical replicates were performed for each of the SlSOD genes. The PCR program consisted of an initial denaturation at 95°C for 15 min, followed by 40 cycles of 95°C for 10 s, 55°C for 20 s, and 72°C for 30 s. The relative expression levels were calculated using the 2-ΔΔCt method, and were presented by histogram (Livak and Schmittgen, 2001).

Results

Genome-Wide Identification of SOD Genes Family in Tomato

A total of nine SOD genes, classified into two major groups (Cu/ZnSODs and Fe-MnSODs), were identified in tomato. The former group included four members with a copper-zinc domain (SlSOD1, 2, 3, and 4); the latter was composed of five members with an iron/manganese SOD alpha-hairpin domain and an iron/manganese SOD, C-terminal domain (SlSOD5, 6, 7, 8 and 9) (Table ). The physicochemical analysis showed that the length of amino acid sequences, MW, and pI values varied among these SlSOD proteins. The length ranged from 152 to 311AA, MW ranged from 15.3 to 34.6 kDa, and pI ranged from 5.38 to 7.13 (Table ). No significant difference in the acid-base properties of SlSOD proteins was observed, except for SlSOD9, which was slightly basic. Using the ProtComp9.0 program, subcellular localizations of SlSOD proteins were determined. Among them, two Cu/ZnSODs (SlSOD1 and 2) and one Fe-MnSOD (SlSOD8) were predicted to localize in the cytoplasm. One Fe-MnSOD (SlSOD9) was localized in mitochondrion. The remaining members were localized in the chloroplast. The characteristics of SOD genes from Solanum lycopersicum.

Conserved Motif Analysis of SlSOD Proteins

Four motifs in SlSOD proteins (motif 1 to motif 4) were identified by MEME. Among them, three motifs (motifs 1, 3, and 4) were related to iron/manganese SOD domains, while motif 2 was related to copper/zinc SOD domains (Table ). As shown in Figure , motif 2 was located in Cu/ZnSODs (SlSOD1, 2 and 3), except SlSOD4; motif 1 and motif 3 were shared in Fe-MnSODs (SlSOD5, 6, 7, 8, and 9). Motif 4 was widely present in Fe-MnSODs, except for SlSOD8. Eight different motifs commonly observed in tomato protein sequences by MEME server. Conserved motif analysis of SlSOD proteins. Different color boxes represent different types of motifs.

Chromosomal Distribution and Intron/Exon Configurations of SlSOD Genes

The chromosomal distributions of nine SlSOD genes were determined. As shown in Figure , six out of the twelve chromosomes harbored SlSOD genes. Chromosome 6 and 3 possessed three and two SlSOD genes, respectively, while each of the remaining four chromosomes (chromosome 1, 2, 8, and 11) contained only one SlSOD gene. Notably, chromosome 6 had one gene cluster (SlSOD5 and 8), which was identified as tandem duplication event. Segmental duplication was identified between SlSOD5 (chromosome 6) and SlSOD6 (chromosome 3) by PGDD database. However, despite the sequence similarity between SlSOD5 and SlSOD6, no tandem-duplicated paralogous genes were found in the region surrounding SlSOD6. Chromosomal locations of 9 Red lines represent the position of SlSOD genes on chromosomes. The chromosome numbers are indicated at the top of chromosomes. The segment duplication event occurred between SlSOD5 (chromosome 6) and SlSOD6 (chromosome 3) and one cluster including tandemly duplicated genes (SlSOD5 and SlSOD8) on chromosome 6. Intron/exon configurations of SlSOD genes were constructed using the Gene Structure Display Server (GSDS 2.0[11]) by aligning the cDNA sequences with the corresponding genomic DNA sequences (Figure ). We found that intron numbers among these SlSOD genes ranged from 4 to 8. Two SlSOD genes (SlSOD5 and 6) exhibited the highest intron number (8), whereas SlSOD8 only had four introns (Table ). In addition, two groups of SlSOD genes (SlSOD1 and 2, SlSOD5 and 6) exhibited similar intron/exon organization patterns, respectively. The rest of the SlSOD genes exhibited diverse intron/exon organization patterns. Intron/exon configurations of Exons and introns are shown as yellow boxes and thin lines, respectively. UTRs are shown with blue boxes. 0 = intron phase 0; 1 = intron phase 1; 2 = intron phase 2.

Phylogenetic Analysis of SOD Genes in Plants

To investigate the phylogenetic relationships of SOD proteins between tomato and other plant species, a total of 108 SOD proteins were identified from S. lycopersicum, Populus trichocarpa, Arabidopsis thaliana, Vitis vinifera, S. tuberosum, O. sativa, Zea mays, Sorghum bicolor, and Panicum miliaceum. Among them, 24 SOD proteins were excluded due to incomplete SOD domains. An unrooted phylogenetic tree was constructed based on the remaining 84 SOD proteins using the program MEGA5.04 (Tamura et al., 2011). As shown in Figure , the SOD proteins from different plant species were divided into two major groups, Cu/ZnSODs and Fe-MnSODs. The former group was subdivided into three subgroups (a, b, and c), and the latter was separated into two subgroups (d and e), which was strongly supported by high bootstrap values. Phylogenetic tree of 84 SOD proteins from tomato and other plants including Two groups (Cu/ZnSODs and Fe-MnSOD) were identified and the tree was divided into five groups (a, b, c, d and e) based on high bootstrap values. SlSOD proteins are marked in red. Three colors (coral, light blue and light green) represent the subcellular locations of SOD proteins: coral represents proteins localized in the cytoplasm, light blue represents proteins localized in chloroplasts, and light green represents proteins localized in mitochondria. In our study, phylogenetic analysis showed that SlSOD1 grouped with OsSOD1 (Loc-Os03g22810), OsSOD2 (Loc-Os07g46990) and other plants’ cytosolic Cu/ZnSODs clustered in subgroup a. SlSOD4 grouped with OsSOD3 and other plants’ chloroplastic Cu/ZnSODs clustered in subgroup c, while two SlSOD genes (SlSOD2 and SlSOD3) were clustered with other plants’ cytosolic Cu/ZnSODs and chloroplastic Cu/ZnSODs in subgroup b, respectively. These results indicated that diversity in the Cu/ZnSODs gene family occurred before the splitting of mono- and dicot plants. Interestingly, Cu/ZnSODs genes in subgroup a were separated into mono- and dicot-specific branches, which suggested that they evolved independently after the splitting of mono- and dicot plants. In addition, FeSODs and MnSODs from different plant species were separated by a high bootstrap value (95%). Four genes (SlSOD5, 6, 7, and 8) were clustered with other plants’ chloroplastic FeSODs in subgroup d and SlSOD9 was clustered with other plants’ mitochondrial MnSODs in subgroup e.

Analysis of Cis-Elements in Putative SlSOD Gene Promoters

To further understand gene function and regulation patterns, cis-elements in SlSOD gene promoter sequences were researched. Regions of 1,000 bp upstream from the start codons of each SlSOD gene were determined using PlantCARE. The results showed that the cis-elements could be divided into three major classes: stress-responsive, hormone-responsive, and light-responsive. Six stress-responsive cis-elements were identified, including HSE, MBS, LTR, TC-rich, ARE and Box-W1, which reflected plant responses to heat, drought, low-temperature, defense stresses, anaerobic induction and fungal elicitors, respectively. Ten kinds of hormone-responsive cis-elements were identified (e.g., salicylic acid-SA, methyl jasmonate-MeJA, gibberellins-GA, auxin-IAA, and ethylene) (Figure ). A relatively large number of light-responsive cis-elements in SlSOD promoters was observed (Supplementary Table S2). Different cis-elements with the same or similar functions are present with the same color.

Expression Analysis of SlSOD Genes in Different Tissues

To explore the expression patterns of SOD genes during tomato growth and development, expression profiles were analyzed for 10 different tissues (root, leaf, bud, flower, 1-cm fruit, 2-cm fruit, 3-cm fruit, MG, B, and B10) of the tomato cultivar Helnz using the RNA-seq atlas. As shown in Figure , five SlSOD genes (SlSOD1, 2, 3, 4 and 9) had similar expression patterns in all the tested tissues, while two genes (SlSOD6 and 8) displayed distinct tissue-specific expression patterns. Interestingly, SlSOD1 demonstrated a consistently high expression in all ten tissues, whereas SlSOD6 and 8 were mainly expressed in young fruit. In addition, SlSOD7 was expressed strongly in young fruit, weakly in root and moderately in the other tissues. Expression profiles of The expression patterns of SlSOD genes in different tissues. The tested tissues are: root, leaf, bud, flower, 1 cm- fruit, 2 cm- fruit, 3 cm-fruit, mature green fruit (MG), fruit breaking (B), 10 days after fruit breaking (B10). (B) Expression profiles of SlSOD genes under salt stress. (C) Expression profiles of SlSOD genes under drought stress.

Expression Patterns of SlSOD Genes in Response to Abiotic Treatments

To gain further insight into the role of SlSOD genes under abiotic stress, we analyzed the expression profiles of SlSOD genes in response to salt and drought stresses using microarray data. A total of 17 independent tomato microarray probes were identified by means of a BlastN search. As shown in Figure , expression of SlSOD genes was significantly altered under different abiotic stress treatments. For the salt treatment, eight probes corresponding to SlSOD genes were found, with the exception being SlSOD7. Expression of four SlSOD genes (SlSOD2, 5, 6, and 8) were down-regulated, and expression of three SlSOD genes (SlSOD3, 4, and 9) remained constant. Notably, SlSOD1 was significantly up-regulated. For the drought treatment, microarray probes for each SlSOD gene were identified. Four SlSOD genes (SlSOD2, 5, 6, and 8) were up-regulated and three (SlSOD3, 4, and 9) were down-regulated (Figure ). Notably, SlSOD6 expression increased twofold. SlSOD1 and SlSOD7 were unchanged. We found that the expression levels of most of the SlSOD genes changed significantly under salt and drought stresses.

Verification of SlSOD Gene Expression Patterns with qRT-PCR

To further verify the expression profiles of SlSOD genes determined by microarray data analysis, qRT-PCR was used to analyze expression patterns of the nine SlSOD genes under salt and drought stresses. As shown in Figure , most of the SlSOD gene results were consistent with the microarray patterns. In response to salt treatment, expression levels of most SlSOD genes were down-regulated, in accordance with the microarray profiles. However, expression patterns of three SlSOD genes (SlSOD1, 6 and 9) determined by qRT-PCR analysis were different than those determined using the microarray profiles. We found that in response to salt treatment, there was enhanced expression of SlSOD6 and SlSOD9 and a decreased transcript level of SlSOD1. In response to drought treatment, expression levels of five SlSOD genes (SlSOD1, 3, 4, 6, and 7), were consistent with the microarray data. However, in contrast to our microarray results, qRT-PCR analysis showed down-regulation of three SlSOD genes (SlSOD2, 5, and 8) and up-regulation of SlSOD9. Gene expression profiles of Expression patterns of SlSOD genes under salt stress conditions. (B) Expression patterns of SlSOD genes under drought stress condition. Error bars represent standard deviations from three independent technical replicates.

Discussion

Environmental stresses pose considerable challenges for crop production. Gene expression and SOD enzyme activities are influenced by environmental stresses such as high salinity, drought and metal toxicity (Schützendübel and Polle, 2002; Atkinson et al., 2013). However, plants have evolved defense mechanisms to alleviate the damage caused by adverse environmental conditions. Tomato, an important staple and economic crop, is affected by various abiotic stresses (Mueller et al., 2005). SODs are key enzymes in many oxidation processes, and provide basic protection against ROS in plants (Alscher and Erturk, 2002). Therefore, a systematic analysis of the SlSOD gene family was performed and gene expression patterns were determined for plants under various abiotic stresses. In this study, nine SlSOD genes (four Cu/ZnSODs, four FeSODs, and one MnSOD) were identified in the tomato genome, including all three major types of plant SOD genes. Chromosome location analysis revealed that SlSOD5 and SlSOD8 formed a gene cluster on chromosome 6 and identified as tandem duplicated event. Segmental duplication was identified between SlSOD5 (chromosome 6) and SlSOD6 (chromosome 3) by PGDD. Although SlSOD5 and SlSOD6 have similar sequence, no tandem duplicated events were occurred in the region surrounding SlSOD6. Considering the lower sequence similarity of SlSOD5 to SlSOD6 than that of SlSOD5 to SlSOD8, it appears that segmental duplication events predate the tandem duplication in the SlSOD5 and SlSOD8 gene cluster (Supplementary Table S3). Therefore, we concluded that segmental duplication and tandem duplication played key roles in the expansion of SOD genes in the tomato genome. Gene structure analysis revealed that the intron number of SlSOD genes ranges from 4 to 8. Previous researchers reported that intron patterns of plant SOD genes were highly conserved, and that all cytosolic and chloroplastic SOD genes included seven introns except for one member (Fink and Scandalios, 2002; Filiz and Tombuloğlu, 2014). However, in this study, we observed that the intron numbers of six out of eight SlSOD genes (excepting SlSOD9) were varied, and only two SlSOD genes (SlSOD3, chloroplastic Cu/ZnSOD and SlSOD7, chloroplastic FeSOD) included seven introns. Thus, our data did not support the previous reports of plant SOD gene intron patterns. Variation in exon-intron structures was accomplished by three main mechanisms (exon/intron gain/loss, exonization/pseudoexonization and insertion/deletion), each of which contributed to structural divergence (Xu et al., 2012; Filiz and Tombuloğlu, 2014). Moreover, two groups of SlSOD genes (SlSOD1 and 2, SlSOD5 and 6) exhibited similar intron/exon organization patterns, respectively, which suggested high conservation in the evolutionary process. Phylogenetic analysis showed that FeSODs and MnSOD from different plant species were separated by a high bootstrap value (95%). This result was in agreement with previous report (Fink and Scandalios, 2002). In plants, MnSODs had 70% homology but were different from FeSODs, which suggested that they originated from different ancestral genes (Miller, 2012). These data were well support our results that FeSODs and MnSOD of tomato were diverged with 95% bootstrap value. To better understand the role of SlSOD genes under various environmental stresses, cis-elements in the promoter sequences were predicted by PlantCARE server. The results showed that three major classes of cis-elements were identified, including stress-responsive, hormone-responsive, and light-responsive. Many identified cis-elements in the promotes of SlSOD genes were related to heat, drought, low-temperature, defense stresses, anaerobic induction, fungal elicitors, SA, MeJA, GA, IAA and ethylene. As previously stated, cis-elements play an important role in plant stress responses; cis-elements such as ABRE, DRE, CRT, SARE and SURE respond to abscisic acid (ABA), dehydration, cold, SA, and sulfur, respectively (Sakuma et al., 2002; Maruyama-Nakashita et al., 2005; Shi et al., 2010; Osakabe et al., 2014). Thus, these results will contribute to further understand the various function role of SlSOD genes under complex abiotic stress conditions. To further clarify the potential functions of SlSOD genes, expression profiles of all the SlSOD genes in different tissues were analyzed. Based on RNA-seq, nine SlSOD genes exhibited two disparate expression patterns: constitutive and tissue-specific expression patterns of SlSOD genes. During tomato growth and development, two genes (SlSOD1 and 9) sustained high expression in all the tested tissues. Two genes (SlSOD6 and 8) demonstrated a tissue-specific expression pattern, being mainly expressed in young fruits. SlSOD7 was expressed strongly in young fruit tissue, weakly in root tissue, and moderately in the rest of the tissues tested. Under various natural conditions, plant growth and development are frequently affected by high salinity, drought, cold, bacteria, and insecticides (Xia et al., 2012). Previous researchers reported that three types of SODs (Cu/ZnSODs, FeSODs and MnSODs) have been exploited to eliminate ROS caused by abiotic stress (Kliebenstein and Last, 1998; Wu et al., 1999). To further clarify the putative roles of SOD genes in tomato response to abiotic stresses, we examined the expression patterns of nine SlSOD genes under salt and drought treatment conditions using microarray and qRT-PCR. The results showed that the expression patterns of most SlSOD genes obtained by qRT-PCR were in conformity with those obtained from the microarray analysis. Expression analysis revealed that most SlSOD gene expression levels were changed in response to two abiotic stresses (salt and drought). For salt treatment, SlSOD1 was the only gene that showed significant up-regulation among the nine SlSOD genes, demonstrating that the function of SlSOD1 relates to salt stress. Compared to the other SlSOD genes, a greater variety and quantity of cis-elements were found in the promoter for SlSOD1, including two TC-rich motifs, an HSEs motif, and an MBS motif, which had been demonstrated to responsible for abiotic stress in banana (Feng et al., 2015). This could explain why SlSOD1 expression changed significantly under salt treatment. Moreover, although many cis-elements related to abiotic stresses were also found in the SlSOD8 promoter, SlSOD8 expression was significantly down-regulated under salt treatment. This suggested that some unidentified cis-element could play a vital role in regulating the expression of the SOD gene family in tomato under abiotic stress. Similar results have also been found in other plant species (Singh and Jain, 2015). Additionally, we observed different expression patterns of SlSOD genes under salt and drought stress conditions (Figure ). For example, the expression of four SlSOD genes (SlSOD2, 5, 6, and 8) decreased during the salt treatment, while increased expression levels were observed for these four genes in response to drought treatment. This suggested that different SOD genes in tomato could play different roles in eliminating ROS caused by different environment stresses. Taken together, the data we obtained provides more information about the SOD gene family in tomato including sequence information, gene duplications, conserved motifs, gene structures, and phylogenetic relationships. Promoter analysis and complex regulation patterns of the SlSOD genes under abiotic stress contribute to our understanding of the expression patterns of SOD genes in plants and provide clues for further studies of the roles of SOD genes under different stress conditions.

Author Contributions

Conceived and designed the experiments: HW, QZ, and KF. Performed the experiments: KF, JY, YC, MR, RW, QY, GZ, ZY, and YY. Analyzed the data: KF, JY, and ZL. Wrote the paper: KF and HW. All authors have read and approved the manuscript.

Conflict of Interest Statement

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Table 1

The characteristics of SOD genes from Solanum lycopersicum.

Gene nameSequence IDChromosomeORF Length (bp)Intron numberLength (aa)MW (KDA)pIPredicted Pfam domainSubcellular prediction by PC
SlSOD1Solyc01g067740.201459615215.35.47CZCytoplasm
SlSOD2Solyc03g062890.203471615615.96.53CZCytoplasm
SlSOD3Solyc11g066390.111654721722.36.01CZChloroplast
SlSOD4Solyc08g079830.208936531132.96.45HMA,CZChloroplast
SlSOD5Solyc06g048410.206750824927.96.6IMA,IMCChloroplast
SlSOD6Solyc03g095180.203912830334.65.38IMA,IMCChloroplast
SlSOD7Solyc02g021140.202759725229.16.65IMA,IMCChloroplast
SlSOD8Solyc06g048420.106483416017.96.41IMA,IMCCytoplasm
SlSOD9Solyc06g049080.206687522825.37.13IMA,IMCMitochondrion
Table 2

Eight different motifs commonly observed in tomato protein sequences by MEME server.

Motif numberWidthProtein sequencesPfam domain
165ESMKPGGGGEPSGELLQLINRDFGSYDTFVKEFKAAAATQFGSGWAWLAYKPEDKRLAIVKTPNAIMC (shorten)
KAVAVLNGNDNVQGTIQFTQDDDGPTTVNGRITGLAPGLHGFHIHALGDTTNGCMSTGPHCZ (SODC)
2149FNPNKKDHGAPMDEVRHAGDLGNIVAGPDGVAEITITDMQIPLTGPHSIIGRAVVVHADPDDLGKGGHE
LSKTTGNAGGRIACGVIGLQ
328WEHAYYLDFQNRRPDYISIFMEKLVSWEIMC (shorten)
442KFDLPPPPYPMDALEPHMSRRTFEFHWGKHHRAYVDNLNKQIIMA (shorten)
528IILVTYNNGNPLPPFNNAAQAWNHQFFW
622FLPPQGFNESCRSLQWRTQKKQ
723CCCQRCVSAVKSDLWRQFGIPNV
820METHSIFHQTSSDNGFVYPE
  64 in total

1.  The tomato Cu,Zn superoxide dismutase genes are developmentally regulated and respond to light and stress.

Authors:  R Perl-Treves; E Galun
Journal:  Plant Mol Biol       Date:  1991-10       Impact factor: 4.076

2.  Using CLUSTAL for multiple sequence alignments.

Authors:  D G Higgins; J D Thompson; T J Gibson
Journal:  Methods Enzymol       Date:  1996       Impact factor: 1.600

3.  Isolation of a new copper-containing superoxide dismutase bacteriocuprein.

Authors:  K Puget; A M Michelson
Journal:  Biochem Biophys Res Commun       Date:  1974-06-04       Impact factor: 3.575

4.  Characterization of the gene encoding superoxide dismutase of Bordetella pertussis and construction of a SOD-deficient mutant.

Authors:  D DeShazer; J D Bannan; M J Moran; R L Friedman
Journal:  Gene       Date:  1994-05-03       Impact factor: 3.688

5.  Genetic mapping of tomato cDNA clones encoding the chloroplastic and the cytosolic isozymes of superoxide dismutase.

Authors:  R Perl-Treves; M Abu-Abied; N Magal; E Galun; D Zamir
Journal:  Biochem Genet       Date:  1990-10       Impact factor: 1.890

Review 6.  Plant responses to abiotic stresses: heavy metal-induced oxidative stress and protection by mycorrhization.

Authors:  Andres Schützendübel; Andrea Polle
Journal:  J Exp Bot       Date:  2002-05       Impact factor: 6.992

7.  2,4-dichlorophenoxyacetic acid-induced leaf senescence in mung bean (Vigna radiata L. Wilczek) and senescence inhibition by co-treatment with silver nanoparticles.

Authors:  Thirupathi Karuppanapandian; Hong Wei Wang; Natarajan Prabakaran; Kandhavelu Jeyalakshmi; Mi Kwon; Kumariah Manoharan; Wook Kim
Journal:  Plant Physiol Biochem       Date:  2010-11-19       Impact factor: 4.270

8.  Expression of manganese superoxide dismutase promotes cellular differentiation.

Authors:  D K St Clair; T D Oberley; K E Muse; W H St Clair
Journal:  Free Radic Biol Med       Date:  1994-02       Impact factor: 7.376

9.  Genome-wide analysis of WRKY transcription factors in Solanum lycopersicum.

Authors:  Shengxiong Huang; Yongfeng Gao; Jikai Liu; Xiaoli Peng; Xiangli Niu; Zhangjun Fei; Shuqing Cao; Yongsheng Liu
Journal:  Mol Genet Genomics       Date:  2012-05-09       Impact factor: 3.291

10.  Molecular phylogenetic and expression analysis of the complete WRKY transcription factor family in maize.

Authors:  Kai-Fa Wei; Juan Chen; Yan-Feng Chen; Ling-Juan Wu; Dao-Xin Xie
Journal:  DNA Res       Date:  2012-01-24       Impact factor: 4.458

View more
  29 in total

1.  The physiological and metabolic changes in sugar beet seedlings under different levels of salt stress.

Authors:  Yuguang Wang; Piergiorgio Stevanato; Lihua Yu; Huijie Zhao; Xuewei Sun; Fei Sun; Jing Li; Gui Geng
Journal:  J Plant Res       Date:  2017-07-15       Impact factor: 2.629

2.  Genome-wide identification, characterization, and expression analysis of superoxide dismutase (SOD) genes in foxtail millet (Setaria italica L.).

Authors:  Tao Wang; Hui Song; Baohong Zhang; Quanwei Lu; Zhen Liu; Shulin Zhang; Ruilin Guo; Cong Wang; Zilin Zhao; Jinrong Liu; Renhai Peng
Journal:  3 Biotech       Date:  2018-11-16       Impact factor: 2.406

3.  Superoxide dismutase (SOD) family in durum wheat: promising candidates for improving crop resilience.

Authors:  Sana Tounsi; Sonia Jemli; Kaouthar Feki; Faiçal Brini; Mohamed Najib Saïdi
Journal:  Protoplasma       Date:  2022-04-29       Impact factor: 3.356

4.  Identification and relative expression analysis of CaFRK gene family in pepper.

Authors:  Shufang Zhao; Bingdiao Gou; Yongfu Wang; Nan Yang; Panpan Duan; Min Wei; Gaoyuan Zhang; Bingqiang Wei
Journal:  3 Biotech       Date:  2022-05-24       Impact factor: 2.893

5.  Genome-Wide Characterization of Superoxide Dismutase (SOD) Genes in Daucus carota: Novel Insights Into Structure, Expression, and Binding Interaction With Hydrogen Peroxide (H2O2) Under Abiotic Stress Condition.

Authors:  Roshan Zameer; Kinza Fatima; Farrukh Azeem; Hussah I M ALgwaiz; Muhammad Sadaqat; Asima Rasheed; Riffat Batool; Adnan Noor Shah; Madiha Zaynab; Anis Ali Shah; Kotb A Attia; Muneera D F AlKahtani; Sajid Fiaz
Journal:  Front Plant Sci       Date:  2022-06-08       Impact factor: 6.627

6.  Molecular Evolution and Functional Divergence of Stress-Responsive Cu/Zn Superoxide Dismutases in Plants.

Authors:  Guozhi Zhou; Chaochao Liu; Yuan Cheng; Meiying Ruan; Qingjing Ye; Rongqing Wang; Zhuping Yao; Hongjian Wan
Journal:  Int J Mol Sci       Date:  2022-06-25       Impact factor: 6.208

7.  In silico identification and expression analysis of superoxide dismutase (SOD) gene family in Medicago truncatula.

Authors:  Jianbo Song; Liming Zeng; Rongrong Chen; Yihua Wang; Yong Zhou
Journal:  3 Biotech       Date:  2018-07-30       Impact factor: 2.406

8.  Genome-wide identification of superoxide dismutase gene families and their expression patterns under low-temperature, salt and osmotic stresses in watermelon and melon.

Authors:  Gaoyuan Zhang; Qian Ding; Bingqiang Wei
Journal:  3 Biotech       Date:  2021-03-26       Impact factor: 2.406

9.  Genome-wide identification, characterization and expression profile analysis of expansins gene family in sugarcane (Saccharum spp.).

Authors:  Thaís R Santiago; Valquiria M Pereira; Wagner R de Souza; Andrei S Steindorff; Bárbara A D B Cunha; Marília Gaspar; Léia C L Fávaro; Eduardo F Formighieri; Adilson K Kobayashi; Hugo B C Molinari
Journal:  PLoS One       Date:  2018-01-11       Impact factor: 3.240

10.  Dissecting the proteome dynamics of the salt stress induced changes in the leaf of diploid and autotetraploid Paulownia fortunei.

Authors:  Minjie Deng; Yanpeng Dong; Zhenli Zhao; Yongsheng Li; Guoqiang Fan
Journal:  PLoS One       Date:  2017-07-27       Impact factor: 3.240

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.