Repetitive proteins are thought to have arisen through the amplification of subdomain-sized peptides. Many of these originated in a non-repetitive context as cofactors of RNA-based replication and catalysis, and required the RNA to assume their active conformation. In search of the origins of one of the most widespread repeat protein families, the tetratricopeptide repeat (TPR), we identified several potential homologs of its repeated helical hairpin in non-repetitive proteins, including the putatively ancient ribosomal protein S20 (RPS20), which only becomes structured in the context of the ribosome. We evaluated the ability of the RPS20 hairpin to form a TPR fold by amplification and obtained structures identical to natural TPRs for variants with 2-5 point mutations per repeat. The mutations were neutral in the parent organism, suggesting that they could have been sampled in the course of evolution. TPRs could thus have plausibly arisen by amplification from an ancestral helical hairpin.
Repetitive proteins are thought to have arisen through the amplification of subdomain-sized peptides. Many of these originated in a non-repetitive context as cofactors of RNA-based replication and catalysis, and required the RNA to assume their active conformation. In search of the origins of one of the most widespread repeat protein families, the tetratricopeptide repeat (TPR), we identified several potential homologs of its repeated helical hairpin in non-repetitive proteins, including the putatively ancient ribosomal protein S20 (RPS20), which only becomes structured in the context of the ribosome. We evaluated the ability of the RPS20 hairpin to form a TPR fold by amplification and obtained structures identical to natural TPRs for variants with 2-5 point mutations per repeat. The mutations were neutral in the parent organism, suggesting that they could have been sampled in the course of evolution. TPRs could thus have plausibly arisen by amplification from an ancestral helical hairpin.
Entities:
Keywords:
TPR; amplification; ancient peptides; computational biology; protein evolution; protein folding; ribosomal protein; systems biology
Most present-day proteins arose through the combinatorial shuffling and differentiation of a set of domain prototypes. In many cases, these prototypes can be traced back to the root of cellular life and have since acted as the primary unit of protein evolution (Anantharaman et al., 2001; Apic et al., 2001; Koonin, 2003; Kyrpides et al., 1999; Orengo and Thornton, 2005; Ponting and Russell, 2002; Ranea et al., 2006). The mechanisms by which they themselves arose are however still poorly understood. We have proposed that the first folded domains emerged through the repetition, fusion, recombination, and accretion of an ancestral set of peptides, which supported RNA-based replication and catalysis (the RNA world Bernhardt, 2012; Gilbert, 1986) (Alva et al., 2015; Lupas et al., 2001; Söding and Lupas, 2003). Repetition would have been a particularly prominent mechanism by which these peptides yielded folds; six of the ten most populated folds in the Structural Classification of Proteins (SCOP) (Murzin et al., 1995) – including the five most frequent ones – have repetitive structures. In all cases, their amplification from subdomain-sized fragments can also be retraced at the sequence level in at least some of their members.One of these highly populated repetitive folds is the αα-solenoid (SCOP a.118), whose most widespread superfamily is the tetratricopeptide repeat (TPR; a.118.8). This was originally identified as a repeating 34 amino-acid motif in Cdc23p of Saccharomyces cerevisiae (Sikorski et al., 1990) – hence its name. Since then, TPR-containing proteins have been discovered in all kingdoms of life, where they mediate protein-protein interactions in a broad range of biological processes, such as cell cycle control, transcription, protein translocation, protein folding, signal transduction and innate immunity (Cortajarena and Regan, 2006; Dunin-Horkawicz et al., 2014; Katibah et al., 2014; Keiski et al., 2010; Kyrpides and Woese, 1998; Lamb et al., 1995; Sikorski et al., 1990). The first crystal structure of a TPR domain (Das et al., 1998) showed that the repeat units are helical hairpins, stacked into a continuous, right-handed superhelical architecture with an inner groove that mediates the interaction with target proteins (Forrer et al., 2004). The hairpins interact via a specific geometry involving knobs-into-holes packing (Crick, 1953) and burying about 40% of their surface between repeat units. This tightly packed, superhelical arrangement of a repeating structural unit is typical of all αα-solenoid proteins (Di Domenico et al., 2014; Kajava, 2012; Kobe and Kajava, 2000).Comparison of TPRs from a variety of proteins reveals a high degree of sequence diversity, with conservation observed mainly in the size of the repeating unit and the hydrophobicity of a few key residues (D'Andrea and Regan, 2003; Magliery and Regan, 2004). Nevertheless, almost all known TPR-containing proteins can be detected using a single sequence profile (Karpenahalli et al., 2007), underscoring their homologous origin. As their name implies, TPR proteins generally contain at least two unit hairpins in a repeated fashion. The few that have only one hairpin, notably the mitochondrial import protein Tom20 (Abe et al., 2000), are clearly not ancestral based on their phylogenetic distribution and functionality, implying that the ancestor of the superfamily already had a repeated structure. In searching for the origin of TPRs, we hypothesized that the hairpin at the root of the fold might either have been part of a different, non-repetitive fold or have given rise to both repetitive and non-repetitive folds at the origin of folded domains. Either way we hoped that we might find α-hairpins in non-repetitive proteins that are similar in both sequence and structure to the TPR unit, suggesting a common origin. Here we show that such hairpins are detectable and that one of them, from the ribosomal protein RPS20 (Schluenzen et al., 2000), can be customized to yield a TPR fold by repetition, with only a small number of point mutations that are neutral for the parent organism. Ribosomal proteins most likely constitute some of the oldest proteins observable today and are still intimately involved in an RNA-driven process: translation (Fox, 2010; Hsiao et al., 2009). They are mostly incapable of assuming their folds outside the ribosomal context (Peng et al., 2014) and thus belong to a class of intrinsically disordered proteins that become structured upon binding to a macromolecular scaffold (Dyson and Wright, 2005; Habchi et al., 2014; Oldfield and Dunker, 2014; Peng et al., 2014; Varadi et al., 2014). This hairpin therefore plausibly retains today many of the properties likely to have been present in the ancestral peptide that gave rise to the TPR fold.
Results and discussion
Recently amplified TPR arrays in present-day proteins
Repetitive folds with variable numbers of repeats, such as HEAT, LRR, TPR or β-propellers, usually have some members with a high level of sequence identity between their repeat units (Dunin-Horkawicz et al., 2014). In these proteins, the units are more similar to each other than to any other unit in the protein sequence database, showing that they were recently amplified. In a detailed study of β-propellers (Chaudhuri et al., 2008), we found that this process of amplification and differentiation has been ongoing since the origin of the fold. TPR proteins show a similar evolutionary history. In some proteins, most of the repeats can be seen to have been amplified separately and to a different extent in each ortholog, pointing to their recent origin (Figure 1a); in others, the amplification must have occurred much earlier, as their ancestor already had fully differentiated repeats (Figure 1b). In recently amplified proteins, such as the ones shown in Figure 1a, within which repeats frequently have >80% pairwise sequence identity, tracking the probable α-hairpin at the root of the amplification is a fairly straightforward proposition. We wondered, however, whether it might be possible to go much further back in time and track the original α-hairpin from which the first TPR protein was amplified. We therefore searched for TPR-like α-hairpins in non-repetitive proteins as present-day descendants of the original hairpin.
Figure 1.
Two evolutionary scenarios for TPRs, illustrated by neighbor-joining phylogenetic trees.
(a) Amplification from single helical hairpin, as seen in TPR proteins from Cyanobacteria. (b) Divergent evolution of a TPR with multiple repeat units, as seen in the TPR domains of Serine/threonine-protein phosphatase 5 (Ara: Arabidopsis thaliana, Dan: Danio rerio, Hom: Homo sapiens, Mus: Musca domestica, Sac: Saccharomyces cerevisiae, The: Theileria annulata, Xen: Xenopus (Silurana) tropicalis). Since evolutionary reconstructions are subject to Occam’s razor and reflect the hypothesis with the fewest assumptions, we have postulated here one amplification event from one precursor hairpin. Our findings would however also be fully compatible with the precursor hairpin yielding a population of homologous variants, some of which were independently amplified to TPR-like folds; one or more survivors among these would have become the ancestor(s) of today’s TPR proteins. In this more complex scenario, the homology of TPR proteins, which we trace through the comparison of individual hairpins, is still given, but the TPR fold could have arisen from several independent amplifications, and not just a single one.
DOI:
http://dx.doi.org/10.7554/eLife.16761.003
(a) Alignments of the TPR units used for the phylogeny in Figure 1a. Residues different from the most common one in each column are shown in bold face and highlighted in yellow. Abbreviations: Ana: Anabaena sp. 90 (gi: 752818954, accession: WP_041458168.1); Cal: Calothrix sp. 336/3 (gi: 821031795, accession: WP_046815017.1); Cya: Cyanothece sp. PCC 8801 (gi: 501590504, accession: WP_012594639.1); fil: filamentous cyanobacterium ESFC-1 (gi: 740500649, accession: WP_038331513.1); Mic: Microcystis aeruginosa SPC777 (gi: 513477764, accession: EPF24195.1). (b) The corresponding alignment of the DNA sequences for the most recently amplified TPR units, Cal4-Cal18, of which the central repeats, Cal9-Cal16, are fully identical. Synonymous mutations (highlighted in gray) are found at less than 1% of the nucleotides, illustrating the recent time point of the amplification. Non-synonymous mutations (highlighted in yellow) are about 2.5 times as frequent as synonymous ones.
DOI:
http://dx.doi.org/10.7554/eLife.16761.004
Columns with identify ≥80% are highlighted in black and marked by vertical bars (|); column with identify <80% but ≥50% are highlighted in gray and marked by dots (.). Abbreviations: Ara: Arabidopsis thaliana (gi: 18406066, accession: NP_565985.1); Dan: Danio rerio (gi: 126158897, accession: NP_001014372.2); Hom: Homo sapiens (gi: 5453958, accession: NP_006238.1); Mus: Musca domestica (gi: 557765703, accession: XP_005182549.1); Sac: Saccharomyces cerevisiae S288c (gi: 398365781, accession: NP_011639.3); The: Theileria annulata strain Ankara (gi: 84994100, accession: XP_951772.1); Xen: Xenopus tropicalis (gi: 56118654, accession: NP_001007891.1).
DOI:
http://dx.doi.org/10.7554/eLife.16761.005
Two evolutionary scenarios for TPRs, illustrated by neighbor-joining phylogenetic trees.
(a) Amplification from single helical hairpin, as seen in TPR proteins from Cyanobacteria. (b) Divergent evolution of a TPR with multiple repeat units, as seen in the TPR domains of Serine/threonine-protein phosphatase 5 (Ara: Arabidopsis thaliana, Dan: Danio rerio, Hom: Homo sapiens, Mus: Musca domestica, Sac: Saccharomyces cerevisiae, The: Theileria annulata, Xen: Xenopus (Silurana) tropicalis). Since evolutionary reconstructions are subject to Occam’s razor and reflect the hypothesis with the fewest assumptions, we have postulated here one amplification event from one precursor hairpin. Our findings would however also be fully compatible with the precursor hairpin yielding a population of homologous variants, some of which were independently amplified to TPR-like folds; one or more survivors among these would have become the ancestor(s) of today’s TPR proteins. In this more complex scenario, the homology of TPR proteins, which we trace through the comparison of individual hairpins, is still given, but the TPR fold could have arisen from several independent amplifications, and not just a single one.DOI:
http://dx.doi.org/10.7554/eLife.16761.003
Multiple sequence alignments of recently amplified TPR repeat units.
(a) Alignments of the TPR units used for the phylogeny in Figure 1a. Residues different from the most common one in each column are shown in bold face and highlighted in yellow. Abbreviations: Ana: Anabaena sp. 90 (gi: 752818954, accession: WP_041458168.1); Cal: Calothrix sp. 336/3 (gi: 821031795, accession: WP_046815017.1); Cya: Cyanothece sp. PCC 8801 (gi: 501590504, accession: WP_012594639.1); fil: filamentous cyanobacterium ESFC-1 (gi: 740500649, accession: WP_038331513.1); Mic: Microcystis aeruginosa SPC777 (gi: 513477764, accession: EPF24195.1). (b) The corresponding alignment of the DNA sequences for the most recently amplified TPR units, Cal4-Cal18, of which the central repeats, Cal9-Cal16, are fully identical. Synonymous mutations (highlighted in gray) are found at less than 1% of the nucleotides, illustrating the recent time point of the amplification. Non-synonymous mutations (highlighted in yellow) are about 2.5 times as frequent as synonymous ones.DOI:
http://dx.doi.org/10.7554/eLife.16761.004
Multiple sequence alignments of the three TPR repeat units in serine/threonine-protein phosphatase 5 from seven taxa.
Columns with identify ≥80% are highlighted in black and marked by vertical bars (|); column with identify <80% but ≥50% are highlighted in gray and marked by dots (.). Abbreviations: Ara: Arabidopsis thaliana (gi: 18406066, accession: NP_565985.1); Dan: Danio rerio (gi: 126158897, accession: NP_001014372.2); Hom: Homo sapiens (gi: 5453958, accession: NP_006238.1); Mus: Musca domestica (gi: 557765703, accession: XP_005182549.1); Sac: Saccharomyces cerevisiae S288c (gi: 398365781, accession: NP_011639.3); The: Theileria annulata strain Ankara (gi: 84994100, accession: XP_951772.1); Xen: Xenopus tropicalis (gi: 56118654, accession: NP_001007891.1).DOI:
http://dx.doi.org/10.7554/eLife.16761.005
Identification of helical hairpins resembling the TPR unit
We had previously developed a profile-based method, named TPRpred, specially designed for the detection of TPRs and related repeat proteins with high sensitivity from sequence data (Karpenahalli et al., 2007). Here, in a first step, we used TPRpred to scan protein sequences in the Protein Data Bank (PDB) (Berman et al., 2000) for peptides that share statistically significant similarity to the TPR sequence profile and yet have not been annotated as TPR in Pfam (Finn et al., 2014); we used a p-value cutoff = 1.0e−4, which leads to an estimated false discovery rate of 1.0%, see Materials and methods. We ignored tandem repeats in the hit list and focused only on the singleton cases. Subsequently, we compared the structures of these helical hairpin singletons to the average TPR hairpin and removed non-hairpin-like structures. This yielded 31 helical hairpins that are similar to the TPR unit with respect to both sequence and structure. Among them, 22 are part of solenoid-like structures and were discarded. The remaining nine hits belong to three families: (I) mitochondrial import receptor subunit Tom20; (II) microtubule interacting and transport (MIT) domain including katanin (Iwaya et al., 2010); and (III) 30S ribosomal protein S20 (RPS20) (Figure 2).
Figure 2.
TPR-like hairpins found in non-repetitive proteins in the PDB.
(a) Structure gallery of non-repetitive helical hairpins in the PDB that share both sequence and structure similarity to TPR unit hairpin. Only the 34 amino-acid helical hairpins are shown. The helical hairpins in 30S ribosomal protein s20 (RPS20), mitochondrial import receptor subunit (Tom20), and microtubule interacting and transport domain (MIT) are depicted in cyan, green, and yellow, respectively. The structure of a TPR with a consensus sequence, CTPR3, is shown in the center with the middle TPR unit highlighted in red. PDB IDs and chain names of the proteins are given in parentheses. In the superposition, all helical hairpins are superimposed onto the middle TPR unit of CTPR3. (b) Multiple sequence alignment of the helical hairpin sequences listed in (a). The eight TPR signature positions are marked by dots in CTPR3. Columns with sequence identity ≥ 80% are in black, and columns with sequence identity ≥ 50% are in gray.
DOI:
http://dx.doi.org/10.7554/eLife.16761.006
TPR-like hairpins found in non-repetitive proteins in the PDB.
(a) Structure gallery of non-repetitive helical hairpins in the PDB that share both sequence and structure similarity to TPR unit hairpin. Only the 34 amino-acid helical hairpins are shown. The helical hairpins in 30S ribosomal protein s20 (RPS20), mitochondrial import receptor subunit (Tom20), and microtubule interacting and transport domain (MIT) are depicted in cyan, green, and yellow, respectively. The structure of a TPR with a consensus sequence, CTPR3, is shown in the center with the middle TPR unit highlighted in red. PDB IDs and chain names of the proteins are given in parentheses. In the superposition, all helical hairpins are superimposed onto the middle TPR unit of CTPR3. (b) Multiple sequence alignment of the helical hairpin sequences listed in (a). The eight TPR signature positions are marked by dots in CTPR3. Columns with sequence identity ≥ 80% are in black, and columns with sequence identity ≥ 50% are in gray.DOI:
http://dx.doi.org/10.7554/eLife.16761.006The similarity of Tom20 and MIT domains to TPR proteins has been noted before (Abe et al., 2000; Iwaya et al., 2010; Scott et al., 2005), but the similarity of RPS20 was surprising and drew our attention particularly due to the ancestrality attributed to ribosomal proteins. To further explore the similarity between the helical hairpin in RPS20 (in short, RPS20-hh) and TPR, we used TPRpred to rank the RPS20 sequences in Pfam (Finn et al., 2014). The top-scoring hit was RPS20-hh from Thermus aquaticus (NCBI accession number = WP_003044315.1, UniProt id = B7A5L8_THEAQ), which matches the TPR unit sequence profile at a p-value of 5.4e−07, almost an order of magnitude better than the second hit (see Supplementary file 1D). Furthermore, we examined the surface residues of RPS20-hh fragments to assess their suitability to occur in a tandem repeat mode, as in TPRs. To this end, we first defined five interface positions on the TPR helical hairpin and transferred the definition to RPS20-hh according to their structure alignment (positions 3, 7, 10, 21 and 28 using TPR unit numbering). Then, we searched for RPS20-hhs with as many hydrophobic residues as possible at these interface positions. We found 42 RPS20-hhs that contain at least three hydrophobic residues out of the five interface positions. Among them, the only RPS20-hh predicted to match the TPR unit profile above a p-value of 1.0e−4 was again the RPS20 from T. aquaticus, in which three of the five interface residues are hydrophobic (L10, I21 and V28). We therefore chose this helical hairpin (RPS20-hhta) to construct a TPR-like solenoid by amplification (Figure 3).
Figure 3.
The design of TPR using RPS20.
RPS20-hh is identified by TPRpred to match the sequence profile of TPR units. Their structures are also very similar (helices are shown as cylinders), except for the last four residues (colored in light and dark magenta). We designed a TPR protein using a RPS20-hh with up to five mutations (yellow strips) in each repeat unit. The C-terminal loop in the TPR unit (dark magenta loop) is used to replace the corresponding C-terminus (light magenta cylinder) of RPS20-hh to connect adjacent repeats. The C-terminal helix in RPS20 (white cylinder) was used as the stop helix in the design.
DOI:
http://dx.doi.org/10.7554/eLife.16761.007
The design of TPR using RPS20.
RPS20-hh is identified by TPRpred to match the sequence profile of TPR units. Their structures are also very similar (helices are shown as cylinders), except for the last four residues (colored in light and dark magenta). We designed a TPR protein using a RPS20-hh with up to five mutations (yellow strips) in each repeat unit. The C-terminal loop in the TPR unit (dark magenta loop) is used to replace the corresponding C-terminus (light magenta cylinder) of RPS20-hh to connect adjacent repeats. The C-terminal helix in RPS20 (white cylinder) was used as the stop helix in the design.DOI:
http://dx.doi.org/10.7554/eLife.16761.007
Design of a TPR array from a RPS20
We focused on the construction of three-repeat TPRs, which represent the most common form of this fold (D'Andrea and Regan, 2003; Sawyer et al., 2013). For instance, 18 of the 54 non-identical TPR domains in the extended Structural Classification of Proteins database (SCOPe v2.05) (Fox et al., 2014) have three repeats. A previously designed three-repeat TPR protein, CTPR3, was also demonstrated to be highly stable, even more so than natural three-repeat TPR proteins (Main et al., 2003b). We concatenated three copies of RPS20-hhta as an initial construct, connected by the TPR consensus loop sequence (DPNN). We annotate the two helices in each repeat unit as helix Ai and Bi, where i is the index of the repeat unit (i = 1, 2 or 3) (Figure 3). Under the hypothesis of common descent between TPR and RPS20 from the same ancestral peptide and retention of ancestral features in RPS20, this basic construct would fold as a TPR solenoid with a minimal number of mutations, ideally none.When we experimentally made a construct containing no mutations (M0, Table 1), it was soluble but remained unfolded under all conditions tested (see Section 2.4). We therefore introduced point mutations into the sequence of RPS20-hhta, aimed at favoring the target structure. Here, we followed the principle of consensus design (Forrer et al., 2004; Main et al., 2003a), which requires the mutation positions to be occupied by the most commonly observed residues in homologous proteins (Forrer et al., 2004). Consensus design methods have been successful in engineering several different repeat proteins with solenoid folds, including ankyrin repeats (Binz et al., 2003; Kohl et al., 2003; Mosavi et al., 2002), TPRs (Doyle et al., 2015; Kajander et al., 2007; Main et al., 2003b), pentatricopeptide repeats (PPRs) (Coquille et al., 2014; Shen et al., 2016) and leucine rich repeats (Rämisch et al., 2014; Stumpp et al., 2003). Following these principles, four different sites of mutation (L4W, K7L/R, V9N, I23D/Y, see Figure 4) were considered to improve interface hydrophobicity or preserve coevolved positions observed in TPRs (Sawyer et al., 2013) (see Materials and methods). Furthermore, as natural TPR proteins tend to exhibit zero net charge (Magliery and Regan, 2004), four positively charged residues were also targeted (K2E, K6N, K22E, R25Q/E, see Figure 4). This resulted in a set of eight candidate mutation sites. In order to preserve the character of the RPS20-hhta sequence, we restricted the number of mutations in any repeat unit to be at most five.
Table 1.
The primary structures of the six designed proteins using RPS20-hhta tested in vitro. Point mutations introduced into RPS20-hhta are shown in bold and underlined. The C-terminal four residues in RPS20-hhta were replaced by the consensus loop sequence DPNN in TPRs (underlined). The sequence of the stop helix is italicized. M4NΔC is M4N without stop helix.
DOI:
http://dx.doi.org/10.7554/eLife.16761.008
Name
Mutations
Sequence
M0
-
NS
IKTLSKKAVLLAQEGKAEEAIKIMRKAVSLDPNN
IKTLSKKAVLLAQEGKAEEAIKIMRKAVSLDPNN
IKTLSKKAVLLAQEGKAEEAIKIMRKAVSLIDKA
AKGSTLHKNAAARRKSRLMRKVQKL
M2
K7L, I23Y
NS
IKTLSKLAVLLAQEGKAEEAIKYMRKAVSLDPNN
IKTLSKLAVLLAQEGKAEEAIKYMRKAVSLDPNN
IKTLSKLAVLLAQEGKAEEAIKYMRKAVSLIDKA
AKGSTLHKNAAARRKSRLMRKVQKL
M4E
K2E, K7L, V9N, I23Y
NS
IETLSKLANLLAQEGKAEEAIKYMRKAVSLDPNN
IETLSKLANLLAQEGKAEEAIKYMRKAVSLDPNN
IETLSKLAVLLAQEGKAEEAIKYMRKAVSLIDKA
AKGSTLHKNAAARRKSRLMRKVQKL
M4N
K6N, K7L, V9N, I23Y
NS
IKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNN
IKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNN
IKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKA
AKGSTLHKNAAARRKSRLMRKVQKL
M4RD
K2E, K7R, V9N, I23D
NS
IETLSKRANLLAQEGKAEEAIKDMRKAVSLDPNN
IETLSKRANLLAQEGKAEEAIKDMRKAVSLDPNN
IETLSKRAVLLAQEGKAEEAIKDMRKAVSLIDKA
AKGSTLHKNAAARRKSRLMRKVQKL
M5
K2E, L4W, K7L, V9N, I23Y
NS
IETLSKLANLLAQEGKAEEAIKYMRKAVSLDPNN
IETWSKLANLLAQEGKAEEAIKYMRKAVSLDPNN
IETWSKLAVLLAQEGKAEEAIKYMRKAVSLIDKA
AKGSTLHKNAAARRKSRLMRKVQKL
M4NΔC
K6N, K7L, V9N, I23Y
NS
IKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNN
IKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNN
IKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKA
AK
Figure 4.
Sequence positions considered for optimizing the designed proteins.
(a) Sequence logo of the TPR motif. A TPR consensus sequence (Main et al., 2003b) (PDB: 1na0, chain A) and its secondary structure determined by DSSP (Kabsch and Sander, 1983) are aligned below the sequence logo. The eight TPR signature positions are underscored in the consensus sequence. The five interface positions are highlighted in yellow. (b) Sequence logo of RPS20-hh. The RPS20-hhta sequence and its predicted secondary structure using Quick2D (Biegert et al., 2006) is aligned below the sequence logo. The derived interface positions are highlighted in yellow. The four residues subjected to mutations are colored in red. The four positively charged residues selected for mutation to lower the surface charge are in blue. (c) The locations of the interface positions displayed on a TPR (left) and a RPS20 structure (right). In both structures, the interface positions are labeled and highlighted as yellow spheres. The TPR structure is CTPR3 (PDB: 1na0, chain A), which is shown as a cartoon and is colored using the same scheme as the secondary structure representation in (a). The stop helix is in gray. The RPS20 structure is from T. thermophilus (PDB: 4gkj, chain T), in which the RPS20-hh fragment is colored using the same scheme as the secondary structure representation in (b). The sequence logos were generated using WebLogo (Crooks et al., 2004). Sequences from representative proteome 75% (Chen et al., 2011) downloaded from Pfam families TPR_1 and Ribosomal_S20p were used as input to WebLogo (9338 and 972 sequences, respectively). The structures were rendered using PyMOL (Schrödinger, 2010).
DOI:
http://dx.doi.org/10.7554/eLife.16761.009
The subfigures (a) and (c) were generated using the seed alignment sequences from Pfam family TPR_1 (558 sequences. Sequence Q29585_PIG/28–61 was removed as it contains unknown residue X). The largest mutual information value is observed between position 7 and 23. The subfigures (b) and (d) were generated using the multiple alignment of representative proteomes rp75 sequences from Pfam family TPR_1 (9338 sequences). The largest non-local mutual information value was observed between position 24 and 47, corresponding to position 7 and 23 using TPR repeat numbering. Alignments were taken from Pfam 27.0. Subfigures (a) and (b) were generated using MatrixPlot. Subfigures (c) and (d) were generated using DCA Workbench (http://dca.rice.edu/portal/dca/workbench).
DOI:
http://dx.doi.org/10.7554/eLife.16761.010
The scores for the designs are shown in two groups: the group to the left are combinations involving only primary mutations (see Supplementary file 1E). The group to the right are designs involving both primary and secondary mutations (Supplementary file 1E). The design variants are sorted by the average of the lowest 10% scores. The designs tested in the lab are marked by red arrows (M2, M4E, M5, M4N, M4RD). The in silico simulation was performed using Rosetta 3.4.
DOI:
http://dx.doi.org/10.7554/eLife.16761.011
DOI:
http://dx.doi.org/10.7554/eLife.16761.012
The primary structures of the six designed proteins using RPS20-hhta tested in vitro. Point mutations introduced into RPS20-hhta are shown in bold and underlined. The C-terminal four residues in RPS20-hhta were replaced by the consensus loop sequence DPNN in TPRs (underlined). The sequence of the stop helix is italicized. M4NΔC is M4N without stop helix.DOI:
http://dx.doi.org/10.7554/eLife.16761.008NSIKTLSKKAVLLAQEGKAEEAIKIMRKAVSLIKTLSKKAVLLAQEGKAEEAIKIMRKAVSLIKTLSKKAVLLAQEGKAEEAIKIMRKAVSLIDKANSIKTLSKIKTLSKIKTLSKNSIIINSIKTLSIKTLSIKTLSNSIIINSIIINSIKTLSIKTLSIKTLS
Sequence positions considered for optimizing the designed proteins.
(a) Sequence logo of the TPR motif. A TPR consensus sequence (Main et al., 2003b) (PDB: 1na0, chain A) and its secondary structure determined by DSSP (Kabsch and Sander, 1983) are aligned below the sequence logo. The eight TPR signature positions are underscored in the consensus sequence. The five interface positions are highlighted in yellow. (b) Sequence logo of RPS20-hh. The RPS20-hhta sequence and its predicted secondary structure using Quick2D (Biegert et al., 2006) is aligned below the sequence logo. The derived interface positions are highlighted in yellow. The four residues subjected to mutations are colored in red. The four positively charged residues selected for mutation to lower the surface charge are in blue. (c) The locations of the interface positions displayed on a TPR (left) and a RPS20 structure (right). In both structures, the interface positions are labeled and highlighted as yellow spheres. The TPR structure is CTPR3 (PDB: 1na0, chain A), which is shown as a cartoon and is colored using the same scheme as the secondary structure representation in (a). The stop helix is in gray. The RPS20 structure is from T. thermophilus (PDB: 4gkj, chain T), in which the RPS20-hh fragment is colored using the same scheme as the secondary structure representation in (b). The sequence logos were generated using WebLogo (Crooks et al., 2004). Sequences from representative proteome 75% (Chen et al., 2011) downloaded from Pfam families TPR_1 and Ribosomal_S20p were used as input to WebLogo (9338 and 972 sequences, respectively). The structures were rendered using PyMOL (Schrödinger, 2010).DOI:
http://dx.doi.org/10.7554/eLife.16761.009
Mutual information plot (a and b) and direct coupling analysis plot (c and d) for TPR repeat sequences.
The subfigures (a) and (c) were generated using the seed alignment sequences from Pfam family TPR_1 (558 sequences. Sequence Q29585_PIG/28–61 was removed as it contains unknown residue X). The largest mutual information value is observed between position 7 and 23. The subfigures (b) and (d) were generated using the multiple alignment of representative proteomes rp75 sequences from Pfam family TPR_1 (9338 sequences). The largest non-local mutual information value was observed between position 24 and 47, corresponding to position 7 and 23 using TPR repeat numbering. Alignments were taken from Pfam 27.0. Subfigures (a) and (b) were generated using MatrixPlot. Subfigures (c) and (d) were generated using DCA Workbench (http://dca.rice.edu/portal/dca/workbench).DOI:
http://dx.doi.org/10.7554/eLife.16761.010
Rosetta energy scores (fixbb+relax) for TPR designs based on RPS20-hhta sequence and various sets of mutations.
The scores for the designs are shown in two groups: the group to the left are combinations involving only primary mutations (see Supplementary file 1E). The group to the right are designs involving both primary and secondary mutations (Supplementary file 1E). The design variants are sorted by the average of the lowest 10% scores. The designs tested in the lab are marked by red arrows (M2, M4E, M5, M4N, M4RD). The in silico simulation was performed using Rosetta 3.4.DOI:
http://dx.doi.org/10.7554/eLife.16761.011
Prediction of intrinsically disordered regions in RPS20 of Thermus aquaticus (NCBI gi: 489134531, accession: WP_003044315.1) using a) IUPred (http://iupred.enzim.hu/); b) DisEMBL (http://dis.embl.de/) and c) PONDR (http://www.pondr.com/).
DOI:
http://dx.doi.org/10.7554/eLife.16761.012In most TPR proteins, there is an α-helix at the C-terminus, which interacts with the last TPR unit by covering the hydrophobic surface. This so-called C-terminal 'stop helix' had been observed in all known TPR structures and was considered essential for the solubility of natural TPR proteins (D'Andrea and Regan, 2003; Das et al., 1998; Main et al., 2003b). Most other designed TPRs employ purpose-designed stop helix sequences. Here, we chose to use the RPS20 C-terminal helix to become a natural stop helix, since it is already known to interact favorably with RPS20-hhta (Figure 3). Further, we inserted two residues (Asn-Ser) before the first TPR unit as an N-terminal cap to the first helix (Aurora and Rose, 1998; Kumar and Bansal, 1998), in analogy to a previously designed idealized TPR protein, CTPR3 (Main et al., 2003b).To model the structure of the designed proteins in silico, we fused two structures to create a hybrid template: We used CTPR3 (PDB id: 1na0 chain A) as the structural template for the three RPS20-hhta fragments, and the best-resolved RPS20 structure (PDB id: 2vqe chain T; 2.5 Å) for helix B3 and the stop helix. We built structural models on this hybrid template and tested a variety of mutants using the Rosetta programs fixbb and relax, which perform fixed-backbone design and structural refinement (Das and Baker, 2008; Doyle et al., 2015; Park et al., 2015; Parmeggiani et al., 2015). The Rosetta energy score of the models calculated for all mutants is depicted in a boxplot (Figure 4—figure supplement 2). Among them, five were selected for further testing in vitro (see Materials and methods). These five tested mutants are termed M2, M4E, M4N, M4RD and M5. Their primary structures are listed in Table 1.
Figure 4—figure supplement 2.
Rosetta energy scores (fixbb+relax) for TPR designs based on RPS20-hhta sequence and various sets of mutations.
The scores for the designs are shown in two groups: the group to the left are combinations involving only primary mutations (see Supplementary file 1E). The group to the right are designs involving both primary and secondary mutations (Supplementary file 1E). The design variants are sorted by the average of the lowest 10% scores. The designs tested in the lab are marked by red arrows (M2, M4E, M5, M4N, M4RD). The in silico simulation was performed using Rosetta 3.4.
DOI:
http://dx.doi.org/10.7554/eLife.16761.011
Biophysical characterization of designed TPRs and RPS20
We cloned the five TPR designs plus the unmutated construct M0 into pET vectors for expression in Escherichia coli. Three proteins (M0, M4RD and M5) could be purified from soluble extracts; the other constructs were insoluble and were refolded from inclusion bodies. In far UV circular dichroism (CD) spectra, all proteins displayed a strong alpha-helical pattern, except M0 and M4RD, which appeared to be unfolded, but not prone to aggregation and precipitation, even at high concentrations. When we studied the melting curves, M4N showed cooperative unfolding with a Tm of 77°C (Supplementary file 1F), while the unfolding of M2, M4E and M5 did not conform to a classical two-state transition, consistent with an unstable molten globule-like state. On the other hand, non-cooperative unfolding processes have been demonstrated for perfectly stable TPR repeats and suggested to be common for various types of repeat proteins (Cortajarena and Regan, 2006; Kajander et al., 2007; Stumpp et al., 2003). To clarify this point, urea-induced unfolding transitions were monitored by CD. Like M4N, the three variants M2, M4E and M5 yielded typical cooperative denaturation curves, indicative of folded polypeptides (Figure 5—figure supplement 2). The ∆GU-FH2O values agree well with those reported for other designed TPRs (Supplementary file 1F) (Main et al., 2005). In line with these findings, M5, the only protein containing tryptophan residues, had a λmax of 336 nm in fluorescence emission spectra, as expected for partially shielded aromatic residues. We conclude that four of the five designed TPR variants, M2, M4E, M4N and M5, result in well-folded repeat proteins. To determine the oligomeric state of our folded proteins, we performed static light scattering experiments. Surprisingly, all four constructs were exclusively dimers (Supplementary file 1F).
Figure 5—figure supplement 2.
Urea denaturation of designed TPR repeats.
Urea-induced equilibrium unfolding at 23°C was monitored by circular dichroism at 222 nm. Data were converted to the fraction of unfolded protein f and fitted to a two-state model. The protein concentration was 15 µM. See Supplement file 1F for obtained parameters.
DOI:
http://dx.doi.org/10.7554/eLife.16761.015
We also examined the ribosomal parent protein RPS20. Within the ribosome, RPS20 is partially embedded in the 16S rRNA, making many nucleic acid contacts. Like many other ribosomal proteins, it is not expected to adopt a stable structure in isolation. Indeed, it has a biased amino acid composition and is predicted to be largely unstructured by many prediction programs (Figure 4—figure supplement 1, see also Supplementary file 1J). It had been shown previously that isolated RPS20 exhibits only one third helical content by CD (Paterakis et al., 1983). For ThermusRPS20 specifically, simulations predict a flexible conformation in solution (Burton et al., 2012). We cloned RPS20 from T. aquaticus and its close relative T. thermophilus. Upon expression, both proteins were insoluble and had to be refolded. In static light scattering measurements, both proteins behaved as monomers (Supplementary file 1F). Based on CD spectra, which showed a high proportion of random structure, and the absence of defined melting and urea-denaturation curves (Supplementary file 1F), we conclude that RPS20 indeed exhibits considerable conformational variation in solution.
Figure 4—figure supplement 1.
Mutual information plot (a and b) and direct coupling analysis plot (c and d) for TPR repeat sequences.
The subfigures (a) and (c) were generated using the seed alignment sequences from Pfam family TPR_1 (558 sequences. Sequence Q29585_PIG/28–61 was removed as it contains unknown residue X). The largest mutual information value is observed between position 7 and 23. The subfigures (b) and (d) were generated using the multiple alignment of representative proteomes rp75 sequences from Pfam family TPR_1 (9338 sequences). The largest non-local mutual information value was observed between position 24 and 47, corresponding to position 7 and 23 using TPR repeat numbering. Alignments were taken from Pfam 27.0. Subfigures (a) and (b) were generated using MatrixPlot. Subfigures (c) and (d) were generated using DCA Workbench (http://dca.rice.edu/portal/dca/workbench).
DOI:
http://dx.doi.org/10.7554/eLife.16761.010
Structure of a designed TPR
To obtain high-resolution structural information on our designed proteins, we set up crystallization trials for all four folded constructs. We obtained crystals and solved the structure of M4N to a resolution of 2.2 Å (Figure 5a). The asymmetric unit (ASU) contains three polypeptide chains of almost identical structure (all pairwise Cα RMSD values below 1.4 Å). Notably, all three chains exhibit the desired TPR architecture with three repetitive hairpins, which interact via knobs-into-holes packing between helices Ai and B(i-1), as is characteristic of TPR hairpins. A superposition to the CTPR3 structure yields Cα RMSD values below 2.6 Å (supplementary file 1I). An unexpected difference to the canonical TPR structure is that the stop helix of M4N is not resolved in any of the three chains. However, this missing helix is compensated for by a specific dimerization mode of two M4N protomers. Therein, the C-terminal TPR units of the two protomers form a tight interface, in which the B3 helix of each chain substitutes for the stop helix of the other, mimicking the capping effect of the stop helix (Figure 6). A superposition of this mimicry to the last TPR unit and stop helix of CTPR3 yields Cα RMSD values as low as 1.2 Å over 44 residues. The third chain of the ASU, however, was found as a monomer, capping its C-terminal TPR unit in a more unspecific manner by packing it orthogonally against the two A1 helices of the dimer (Figure 5a).
Figure 5.
The X-ray structure of M4N.
(a) The three chains A, B and C in the asymmetric unit are colored green, blue and yellow, respectively. Chains A and B form a dimer. (b) Superposition of the three chains. Only Cα traces are shown for clarity. (c) Superposition of M4N (chain A, green) and the designed consensus TPR CTPR3 (PDB: 1na0, chain A, gray).
DOI:
http://dx.doi.org/10.7554/eLife.16761.013
(a) Five adjacent ASUs are depicted. Chain A (green) and B (blue) form a dimer, while chain C (yellow) packs its C-terminus to the N-termini of chains A and B. (b) Top view. (c) An additional ASU (top-left) is shown to demonstrate the packing of N-termini of chains C.
DOI:
http://dx.doi.org/10.7554/eLife.16761.014
Urea-induced equilibrium unfolding at 23°C was monitored by circular dichroism at 222 nm. Data were converted to the fraction of unfolded protein f and fitted to a two-state model. The protein concentration was 15 µM. See Supplement file 1F for obtained parameters.
DOI:
http://dx.doi.org/10.7554/eLife.16761.015
The M4N fragment with a mass of 12733.533 Da in MS is underlined and highlighted in blue (theoretical mass 12733.77 Da). The C-terminus of M4N as observed in the crystal structure is marked by a red arrow.
DOI:
http://dx.doi.org/10.7554/eLife.16761.016
Figure 6.
Mimicry of the stop helix in the M4N dimer.
The C-terminal TPR unit in chain A (green) and the C-terminal helix B3 in chain B (blue) are superposed to the last TPR unit plus the stop helix in CTPR3 (gray).
DOI:
http://dx.doi.org/10.7554/eLife.16761.017
The X-ray structure of M4N.
(a) The three chains A, B and C in the asymmetric unit are colored green, blue and yellow, respectively. Chains A and B form a dimer. (b) Superposition of the three chains. Only Cα traces are shown for clarity. (c) Superposition of M4N (chain A, green) and the designed consensus TPR CTPR3 (PDB: 1na0, chain A, gray).DOI:
http://dx.doi.org/10.7554/eLife.16761.013
The interaction of M4N molecules in the crystal.
(a) Five adjacent ASUs are depicted. Chain A (green) and B (blue) form a dimer, while chain C (yellow) packs its C-terminus to the N-termini of chains A and B. (b) Top view. (c) An additional ASU (top-left) is shown to demonstrate the packing of N-termini of chains C.DOI:
http://dx.doi.org/10.7554/eLife.16761.014
Urea denaturation of designed TPR repeats.
Urea-induced equilibrium unfolding at 23°C was monitored by circular dichroism at 222 nm. Data were converted to the fraction of unfolded protein f and fitted to a two-state model. The protein concentration was 15 µM. See Supplement file 1F for obtained parameters.DOI:
http://dx.doi.org/10.7554/eLife.16761.015
Mass spectrometry (MS) analysis of M4N.
The M4N fragment with a mass of 12733.533 Da in MS is underlined and highlighted in blue (theoretical mass 12733.77 Da). The C-terminus of M4N as observed in the crystal structure is marked by a red arrow.DOI:
http://dx.doi.org/10.7554/eLife.16761.016
Mimicry of the stop helix in the M4N dimer.
The C-terminal TPR unit in chain A (green) and the C-terminal helix B3 in chain B (blue) are superposed to the last TPR unit plus the stop helix in CTPR3 (gray).DOI:
http://dx.doi.org/10.7554/eLife.16761.017Analysis by mass spectrometry revealed that the M4N stop helix had been partially proteolyzed upon expression of the protein (Figure 5—figure supplement 3). Although we did not observe proteolysis in the other folded constructs (M2, M4E and M5), which were also all dimeric, we analyzed whether proteolysis might have favored the dimerization of M4N. Extending the stop helix with a C-terminal His6-tag prevented proteolysis, but did not affect stability or dimerization (M4N-His; Supplementary file 1F). We conclude that in the amplified constructs, the observed interactions are more favorable than the interaction with the native stop helix, releasing it and rendering it prone to degradation. This led us to ask whether this helix is in fact dispensable. Indeed, an M4NΔC construct, which terminates with the B3 helix, showed the same stability and dimerization as M4N. We obtained two structures for M4NΔC from different crystal forms at 2.0 Å and 1.7 Å resolution, respectively, the first (CF I) with two dimers in the ASU and the second (CF II) with a single chain in the ASU, for which we constructed the dimer by crystallographic symmetry. All three dimers superimpose to the M4N dimer with Cα RMSD below 1.9 Å (Figure 7, Supplementary file 1I). We conclude that the stop helix is dispensable for folding, dimerization and the stability of our designed constructs.
Figure 5—figure supplement 3.
Mass spectrometry (MS) analysis of M4N.
The M4N fragment with a mass of 12733.533 Da in MS is underlined and highlighted in blue (theoretical mass 12733.77 Da). The C-terminus of M4N as observed in the crystal structure is marked by a red arrow.
DOI:
http://dx.doi.org/10.7554/eLife.16761.016
Figure 7.
M4NΔC structures of two different crystal forms and their comparison to the M4N dimer.
(a) Two dimers in the ASU of M4NΔC CF I. (b) Dimer constructed by applying the crystallographic symmetry to the single chain in the ASU of M4NΔC CF II. (c) Superposition of all the four M4N and M4NΔC dimers. The M4N dimer is in green and blue. The three M4NΔC dimers are in different shades of gray as in (a) and (b). (d) Superposition of all the chains in the M4N and M4NΔC dimers (eight chains in total). Only Cα traces of proteins are shown for clarity.
DOI:
http://dx.doi.org/10.7554/eLife.16761.018
M4NΔC structures of two different crystal forms and their comparison to the M4N dimer.
(a) Two dimers in the ASU of M4NΔC CF I. (b) Dimer constructed by applying the crystallographic symmetry to the single chain in the ASU of M4NΔC CF II. (c) Superposition of all the four M4N and M4NΔC dimers. The M4N dimer is in green and blue. The three M4NΔC dimers are in different shades of gray as in (a) and (b). (d) Superposition of all the chains in the M4N and M4NΔC dimers (eight chains in total). Only Cα traces of proteins are shown for clarity.DOI:
http://dx.doi.org/10.7554/eLife.16761.018The geometry of dimerization in M4N has not been observed in TPR structures before. Although there have been reports on the self-association of TPR-containing proteins involved in various regulatory biological processes (Bansal et al., 2009a, 2009b; Ramarao et al., 2001; Serasinghe and Yoon, 2008), only a small number of oligomeric TPR structures have been determined to date (Krachler et al., 2010; Lunelli et al., 2009; Zeytuni et al., 2012, 2015; Zhang et al., 2010). None of these resemble the ring-shaped dimer of M4N.
Mutations introduced into RPS20-hhta are neutral to Thermus
The results shown above suggest that the mutations we made to RPS20-hhta were crucial for obtaining the TPR fold. If RPS20 and TPR proteins indeed share a common ancestor, such mutations may have been sampled in the course of evolution. Since we cannot reconstruct the ancestor and do not know what its function was beyond a general expectation of RNA binding, we decided to test whether the mutations we introduced impaired the interaction between RPS20 and its cognate RNA, as an indication of their compatibility with RNA interaction. Each mutation in M2 and M4N occurs in natural RPS20 sequences (see Supplementary file 1A), but no RPS20 sequence has all four mutations simultaneously and we therefore tested if they can be tolerated in vivo. As genetic engineering in T. aquaticus turned out to be unfeasible, we performed these tests in T. thermophilus HB8, which is a well-established model organism. The RPS20 helical hairpins in T. aquaticus and T. thermophilus differ only at four positions, of which two are highly conservative substitutions (Figure 8a).
Figure 8.
RPS20 variants M2 and M4N are functional proteins.
(a) The 34 amino-acid long RPS20-hh fragments in T. aquaticus and T. thermophilus differ only at four positions, including two conservative mutations (V9I and I21L). (b) Scheme of the rpsT region before (upper) and after (lower) substitution of rpsT with the kanamycin resistance cassette (kat). Base pair (bp) values indicate the PCR products that can be amplified. Regions depicted with the same pattern are identical. Regions in solid black and gray also contain genes which are not marked for clarity. (c) PCR to detect substitution of rps20 by the kat gene and (d) PCR to detect the presence of chromosomal rpsT in T. thermophilus strains (WT: T. thermophilus HB8; KM4:T. thermophilus KM4) carrying various plasmids (TT: pJJSpro-rpsTTt; E: pJJSpro; TA: pJJSpro-rpsTTa; TA2: pJJSpro-rpsTTaM2; TA4: pJJSpro-rpsTTaM4N; -: No plasmid) after sequential grow under different selective pressures (1: 30 µg/ml kanamycin; 2: 120 µg/ml kanamycin; 3: 0 µg/ml kanamycin). (e) Corresponding growth curves of the host bacteria with various substitutions and plasmids.
DOI:
http://dx.doi.org/10.7554/eLife.16761.019
RPS20 variants M2 and M4N are functional proteins.
(a) The 34 amino-acid long RPS20-hh fragments in T. aquaticus and T. thermophilus differ only at four positions, including two conservative mutations (V9I and I21L). (b) Scheme of the rpsT region before (upper) and after (lower) substitution of rpsT with the kanamycin resistance cassette (kat). Base pair (bp) values indicate the PCR products that can be amplified. Regions depicted with the same pattern are identical. Regions in solid black and gray also contain genes which are not marked for clarity. (c) PCR to detect substitution of rps20 by the kat gene and (d) PCR to detect the presence of chromosomal rpsT in T. thermophilus strains (WT: T. thermophilus HB8; KM4:T. thermophilus KM4) carrying various plasmids (TT: pJJSpro-rpsTTt; E: pJJSpro; TA: pJJSpro-rpsTTa; TA2: pJJSpro-rpsTTaM2; TA4: pJJSpro-rpsTTaM4N; -: No plasmid) after sequential grow under different selective pressures (1: 30 µg/ml kanamycin; 2: 120 µg/ml kanamycin; 3: 0 µg/ml kanamycin). (e) Corresponding growth curves of the host bacteria with various substitutions and plasmids.DOI:
http://dx.doi.org/10.7554/eLife.16761.019We first attempted to substitute the chromosomal RPS20-encoding gene, rpsT, with a kanamycin resistance cassette, to obtain T. thermophilus strain KM4 (Figure 8b). For complementation we introduced plasmids bearing wild type rpsT from T. thermophilus (TT) or T. aquaticus (TA), rpsT from T. aquaticus carrying the mutations from M2 (TA2) or M4N (TA4), or merely empty plasmids as negative control (E). We monitored the substitution of rpsT by a PCR screening protocol, which will amplify a 1500 bp region if WT rpsT is substituted and an 800 bp region otherwise (Figure 8b). Under selection pressure from kanamycin, only the 1500 bp product was obtained in all cases where plasmid-borne rpsT was introduced, whether in wild-type or mutated form (Figure 8c panels 1 and 2, lanes TT, TA, TA2 and TA4), showing that the chromosomal gene had been fully substituted. In contrast, PCR screening of strain KM4 complemented with an empty plasmid produced both 800 bp and 1500 bp fragments (Figure 8c panels 1 and 2, lane E). Since T. thermophilus HB8 is a polyploid organism (minimally tetraploid [Ohtani et al., 2010]), this result shows that rpsT can be reduced in copy number, but not fully eliminated, suggesting that the gene is essential.To assess the level of substitution achieved with the various plasmids, we designed a second PCR screening protocol to specifically detect chromosomal rpsT via a 300 bp product. At low kanamycin concentrations this protocol always generated a product (Figure 8d panel 1), but at increased kanamycin concentration we did not obtain product for any rpsT allele (Figure 8d panel 2, lanes TT, TA, TA2 and TA4). This demonstrates that plasmid-borne rpsT and its mutants were able to complement the chromosomal rpsT and that the latter was displaced from the population to a level that left it undetectable by PCR. In contrast, we could never completely suppress chromosomal rpsT in strain KM4 complemented with an empty plasmid, even under high kanamycin conditions (120 µg/ml).In E. coli and Salmonella enterica, rpsT has been reported to be non-essential, but its deletion significantly lowers growth rates (Bubunenko et al., 2007; Tobin et al., 2010). We found that rpsT is essential in T. thermophilus, but that its loss could be complemented by wild-type and mutant T. aquaticusrpsT, and that this complementation restored wild-type levels of growth (Figure 8e). Moreover, when the selection pressure from kanamycin was removed, no reversal in the PCR products was detected for any strain (Figure 8c and d, panel 3), which confirms that chromosomal rpsT was substantially displaced during kanamycin treatment. We conclude that rpsT from T. aquaticus and its two mutated alleles are neutral with respect to survival and growth for T. thermophilus. This demonstrates that the mutations we introduced do not affect negatively the interaction between RPS20 and its cognate RNA, and that therefore such mutations could have been sampled multiply and in a cumulative fashion by neutral drift during the course of evolution.
Implications for the emergence of folded proteins
Proteins are the most complex macromolecules synthesized in nature and by and large need to assume defined structures for their activity. This folding process is complicated and easily disrupted, witness the elaborate systems for protein folding, quality control and degradation universal to all living beings. Despite the widespread problems to reach and maintain the folded state, natural proteins nevertheless form a best-case group, since the overwhelming majority of random polypeptides do not appear to have a folded structure (Keefe and Szostak, 2001; Wei et al., 2003). It thus seems impossible that, at the origin of life, the prototypes for the folded proteins we see today could have arisen by random concatenation of amino acids. We have proposed that folding resulted from the increasing complexity of peptides that supported RNA replication and catalysis, and that these peptides assumed their structure through the interaction with the RNA scaffold (Lupas et al., 2001; Söding and Lupas, 2003). In this view, protein folding was an emergent property of RNA-peptide coevolution. We have recently described 40 such peptides whose conservation in diverse folds suggests that they predated folded proteins (Alva et al., 2015). These peptides are enriched for nucleic-acid binders, particularly in the context of the ribosome.Due to its extremely slow rate of change, the ribosome essentially represents a living fossil, providing the possibility to study the chronology of ancient events in molecular evolution (Hsiao et al., 2009). Thus, core ribosomal proteins offer a window into the time when proteins were acquiring the ability to fold. Those close to the catalytic center almost entirely lack secondary structure. Further away from the center, their secondary structure content gradually increases and at the periphery, these secondary structure elements become arranged into topologies that parallel those seen in cytosolic proteins (Hsiao et al., 2009). Collectively, the structures of ribosomal proteins chart a path of progressive emancipation from the RNA scaffold. Even the peripheral proteins, however, still mostly assume their structure only in the context of the ribosomal RNA, as exemplified by RPS20 in our study (Supplementary file 1F, see also Paterakis et al., 1983).The simplest mechanism to achieve an increase in complexity is the repetition of building blocks and nature provides many examples for this, at all levels of organization. The dominant role of repetition in the genesis of protein folds has been documented in many publications since the 1960s (Alva et al., 2007; Blundell et al., 1979; Broom et al., 2012; Eck and Dayhoff, 1966; Kopec and Lupas, 2013; Lee and Blaber, 2011; McLachlan, 1972, 1987; Remmert et al., 2010; Söding et al., 2006). As a test of this mechanism, we explored whether a peptide originating from a ribosomal protein that is disordered outside the context of the ribosome, could form a folded protein through an increase in complexity afforded by repetition. For this, we chose a present-day representative of one of the 40 fragments we reconstructed (Alva et al., 2015); this fragment is naturally found in a single copy in several different folds, including that of ribosomal protein RPS20, and repetitively in one fold, TPR. Simple repetition was not sufficient in our case, but the repeat protein was so close to a folded structure that only two point mutations per repeat were necessary to allow it to fold reliably. The mutations needed for this transition did not appear to affect negatively the interaction with the RNA scaffold, raising the possibility that they could have been among the variants sampled multiply in the course of evolution.Our experiments recapitulate a scenario for the emergence of a protein fold by a widespread and well-documented mechanism, and show that this could have proceeded in a straightforward way. These experiments represent a proof of concept, starting with a modern peptide likely to still retain many features of an ancestral αα-hairpin that gave rise to a number of folds, including TPR. Rather than proposing proto-RPS20 as the parent of TPR domains, we see it as one of many proteins emerging from this ancestral hairpin. Given the ease with which repetition of the RPS20 hairpin yielded a TPR-like fold, we consider it likely that the hairpins belonging to the ancestral group were amplified many times during the emergence of folded proteins to yield a range of TPR-like offspring, of which only one may have survived to this day (but see also the figure legend to Figure 1). The reason for this limited survival may lie in the fact that a structure is a prerequisite for protein function, but it is the function that is under biological selection. It could be that the newly emerged TPR-like folds required many additional changes to achieve a useful activity and that therefore only very few – possibly just one – survived. We consider a different scenario more probable, however. All present-day TPR domains whose function has been characterized mediate protein-protein interactions by binding to linear sequence motifs in unstructured polypeptide segments (D'Andrea and Regan, 2003; Zeytuni and Zarivach, 2012). This activity would have been particularly relevant at a time of transition from peptides dependent on RNA scaffolds for their structure, to autonomously folded polypeptides. Functions relevant in this context would have been to prevent aggregation and increase the solubility of newly emerging (poly)peptides, to promote autonomous folding, to serve as assembling factors for RNA-protein and protein-protein complexes, and to recognize targeting sequences in the emerging cellular networks. It therefore seems likely to us that many of the newly evolved TPR-like folds became established in one or the other of these activities, only to be subsequently displaced by folding becoming a general property of cellular polypeptides and by more advanced, energy-dependent folding factors, which offered much better regulation. Exploring the extent to which our new TPR protein could fulfill such functions represents the next frontier in our studies.
Materials and methods
Phylogeny for recently amplified TPR arrays
All sequence similarity searches in this work were performed using the Web BLAST (RRID:SCR_004870) from the National Institute for Biotechnology Information (NCBI; http://blast.ncbi.nlm.nih.gov; Boratyn et al., 2013) and in the MPI Bioinformatics Toolkit (RRID:SCR_010277, https://toolkit.tuebingen.mpg.de/; Alva et al., 2016). Examples of recently amplified repeat units in TPR were taken from a previous investigation (Dunin-Horkawicz et al., 2014). The TPR domain in serine/threonine-protein phosphatase 5 was chosen as a representative three-repeat TPR, the most common TPR form in natural proteins (D'Andrea and Regan, 2003; Sawyer et al., 2013), to study divergent evolution of TPR. We ran BLAST on the non-redundant protein sequence database (nr) with an E-value threshold of 0.05 using the TPR domain of serine/threonine-protein phosphatase 5 from Homo sapiens as query (Das et al., 1998). From the results, we chose seven taxa to cover a diverse range of life.TPRpred program (Karpenahalli et al., 2007) was used to help identify tandem repeats of TPR units. The construction of multiple sequence alignments (MSAs) for TPR units was straightforward as all TPR units are of the same size (34 aa) and no indels were allowed in the MSAs. We used Clustal X 2.1 (Larkin et al., 2007) to build phylogenetic trees using the neighbor-joining clustering algorithm and 1000 bootstrap trials (Bootstrap N-J Tree). SplitsTree4 (Huson and Bryant, 2006) was used to render the phylogenetic trees.To find proteins homologous to the TPR unit, we first employed the TPRpred program (Karpenahalli et al., 2007) to identify proteins that share significant sequence similarity to the TPR sequence profile, then filtered them by comparing to the TPR structures.First, TPRpred program with TPR profile tpr2.8 was used to identify TPR unit like sequences from all protein sequences of known structures in the Protein Data Bank (PDB, RRID:SCR_012820) (Berman et al., 2000). Protein sequences from the SEQRES record in PDB files were downloaded from the PDB. We only considered sequences with at least 34 residues, which is the length of the TPR unit. Redundancy was removed by keeping only non-identical sequences. In total, 68,197 sequences were scanned by using TPRpred with default parameters. Only fragments predicted to be TPR with a p-value lower than 1.0e−4 were retained (646 hits). We estimated the false discovery rate (FDR) (Noble, 2009) associated with this p-value cutoff using a simulated sequence dataset generated by using the amino-acid composition derived from the PDB sequences. The dataset contains the same number of sequences of the same length distribution as the PDB sequences. The FDR was estimated to be the ratio of the number of hits in the simulated dataset to the number of detected hits in the PDB sequences (Noble, 2009). We repeated the simulation 100 times and the FDR was estimated to be 1.0 ± 0.4%.Within the 646 hits, we kept only TPR unit singletons, which are TPR units that have no other TPR units close to them within a distance of 10 residues in the same sequence. TPR units of identical sequences are considered only once. Subsequently, these TPR unit singletons were filtered by removing those annotated to belong to clan TPR (CL0020) in Pfam 27.0 (RRID:SCR_004726).The structures of the predicted TPR units obtained from the previous step were then compared to an average TPR unit structure. A predicted TPR unit was discarded if the Cα RMSD of the 34 residues is greater than 2.0 Å after superposition. The average TPR unit structure was generated by considering all proteins belonging to family tetratricopeptide repeat (TPR) (a.118.8.1) in SCOP 1.75 (RRID:SCR_007039) (Murzin et al., 1995). TPR repeats in these proteins were again detected using TPRpred and a per-repeat p-value cutoff of 1.0e−4 was used. In total, 50 non-redundant TPR repeat fragments were identified and superposed using a multiple structure alignment tool MultiProt (Shatsky et al., 2004). The average Cα positions were calculated from the 50 structures after superposition. We obtained 31 fragments after the structure filtering step (Supplementary file 1C). We then inspected the protein structures using PyMOL (RRID:SCR_000305) (Schrödinger, 2010). Among them, 22 were observed to be involved in the formation of solenoid or tandem repeat structures and were thus not further considered.
Identification of TPR homologs in RPS20
We applied TPRpred to scan all RPS20 sequences belonging to Pfam 27.0 family Ribosomal S20p (PF01649), including sequences from both datasets 'full' and 'ncbi'. There are 4402 and 2284 sequences in the two sets. We merged the two sets and removed identical sequences to create a dataset of 3742 RPS20 sequences. TPRpred was used to detect TPR unit homologs in them. We obtained 24 hits in these RPS20 sequences predicted by TPRpred to match TPR unit profile with a p-value smaller than 1.0e−4 (see Supplementary file 1D).We defined 'interface positions' in the TPR unit and then transferred the definition to RPS20-hh according to their structure superposition. We considered the residues on the outer side of the two helices facing neighboring TPR units. Both helix A and helix B in the TPR unit are α-helices, which have on average 3.6 residues per turn. Thus, every third or fourth residue always appears on the same side of the helix. They are positions 3, 7 and 10 in helix A and positions 17, 21, 24 and 28 in helix B. According to the TPR sequence profile compiled by Main et al. (Main et al., 2003b), the most common residues at these positions are hydrophobic except for positions 17 and 24, where the most common residues are both Tyr (see also Figure 4a). Therefore, positions 17 and 24 were not included in the definition of interface positions. Furthermore, the residue at position equivalent to position 24 in RPS20 structure faces its C-terminal helix and is already an interface residue (Figure 4c). Thus, it was not considered as an interface position to be checked in the study. In the end, only positions 3, 7, 10, 21 and 28 in RPS20-hh were defined to be interface positions to be examined, because they are exposed to the solvent or interact with the RNA molecules in the ribosome, but would interact with neighboring repeats in the TPR fold.We searched all RPS20 sequences in Pfam 27.0 family Ribosomal_S20p (PF01649), including both datasets 'full' and 'ncbi', for candidates in which the interface positions are occupied by as many hydrophobic residues as possible. In the MSA provided by Pfam, we extracted the 34 columns that correspond to the sequence fragment of RPS20-hh from Thermus aquaticus, which was found by TPRpred to be the hit with the best p-value and was thus used as the reference RPS20-hh. We obtained 1370 sequence fragments that do not contain any indels, in which the interface positions were examined for hydrophobicity. Here, Ala, Ile, Leu, Met, Phe, Val were considered as hydrophobic residues. Trp was not included as its side chain may be too large to be accommodated at the interface.We employed several low-complexity / intrinsically disordered region prediction methods (SEG [Wootton, 1994], PONDR [Romero et al., 2001], DisEMBL [Linding et al., 2003], IUPred [Dosztányi et al., 2005a, 2005b]) to investigate putative intrinsically disordered regions in the RPS20 of Thermus aquaticus. We ran SEG with three sets of recommended parameters (Wootton and Federhen, 1996) and the other approaches with default parameters.
Optimization of RPS20-hh in the designed TPRs
We considered eight positions (2, 4, 6, 7, 9, 22, 23 and 25) in RPS20-hhta for optimization apart from the four residues at the C-terminus.Main et al. (Main et al., 2003b) discovered a set of eight 'TPR signature residues' in the consensus design: W4, L7, G8, Y11, A20, Y24, A27 and P32. Six of them are missing in RPS20-hhta except A20 and A27. Following the principle of consensus design, we introduced L4W and K7L into RPS20-hhta. K7 is also one of the interface positions that ought to be mutated to hydrophobic residue for better packing at interfaces. A8 and L11 were not optimized because they are the second and third most common residues at positions 8 and 11 in the TPR profile, respectively. M24 was also retained because it seems long hydrophobic side chains are favored at position 24 though Met is not one of the three most common residues (YFL). P32 was introduced to replace D32 in RPS20-hhta as part of the C-terminal consensus loop (DPNN) between repeats.Co-evolution is commonly observed between physically interacting residues (de Juan et al., 2013). We investigated if any positions we optimized are involved in a co-evolution relationship so that we can preserve such correlations. We performed a direct coupling analysis (Morcos et al., 2011) and computed the mutual information using MatrixPlot (Gorodkin et al., 1999) between all positions in TPR repeat sequences. The results of both approaches revealed that the highest correlation occurs between positions 7 and 23 (Figure 4—figure supplement 1), with the most commonly observed combinations being R7-D23 and L7-Y23. Therefore, we always mutated I23 to the most commonly observed residue tyrosine (I23Y) in the TPR consensus sequence together with aforementioned mutation K7L. In addition, we considered combination K7R and I23D together. Combination K7-I23D was also tested because of highly similar physicochemical properties between Lys and Arg side chains.The hydrophobic side chain of valine at position 9 in RPS20-hhta is buried between helices in RPS20, but would be exposed on the surface of the designed protein except in the last repeat, in which V9 interacts with the stop helix. Therefore, it is considered to be mutated to the most common residue asparagine (V9N) in the TPR repeat consensus except in the last repeat (Figure 4c).RPS20-hhta sequence and surface is enriched with positively charged residues (Figure 4b). This would lead to the exceedingly high theoretical iso-electric point (pI) of the designed proteins. Natural TPR proteins tend to exhibit zero net charge (Magliery and Regan, 2004). Hence, we decided to randomly mutate the positively charged residues (Lys and Arg) in the two helices of RPS20-hhta to the corresponding most common residues in TPR sequence profile (K2E, K6N, K22E, R25Q/E). K26 was not mutated as Lys is already the most common residue in the TPR profile.At the C-terminus of the designed TPR, the last four residue of RPS20-hhta (IDKA) were replaced with the TPR consensus loop sequence (DPNN) between repeat units. The reason is as follows. The secondary structure of the TPR unit is helix (13 aa) – loop (3aa) – helix (14 aa) – loop (4aa), while the secondary structure of the RPS20-hhta identified to be homologous to TPR unit is helix (13 aa) – loop (3 aa) – helix (18 aa) (Figures 2 and 4). The last four residues may have been included in the prediction by TPRpred merely to fulfill the size requirement of TPR repeat (34 aa). Indeed, when we scanned RPS20-hhta sequence using the hidden Markov model constructed for Pfam family TPR_1, only positions 2–28 were found to be similar to the TPR_1 profile using HMMER 3.0 (RRID:SCR_005305) (Eddy, 2009), even if all filters were switched off. So the four very C-terminal residues in RPS20-hhta were not used in the designed TPR between repeat units. They were not replaced in the last repeat unit (Figure 3).
Structure modeling and refinement in silico
CTPR3 structure of an idealized TPR repeat (Main et al., 2003b) (PDB id: 1na0, chain A) was taken as the main template to build an initial TPR structure model using RPS20-hhta. Helix B3 and the stop helix in our designed protein are different from natural TPRs, but more similar to natural RPS20s. So we also used a RPS20 protein as the structure template for the last repeat and the stop helix. The structure of RPS20 from Thermus thermophilus HB8 (PDB id: 2vqe, chain T) was used because it was the structure with the best resolution (2.5 Å). The C-terminal loop in 2vqeT was discarded. The two structures 1na0A and 2vqeT were merged into a hybrid template based on the superposition of their homologous helical hairpins: the third TPR unit in 1na0A and the RPS20-hh in 2vqeT (the very C-terminal four residues were not used). We then modeled the designed TPR sequences using RPS20-hhta onto the hybrid structure template using Rosetta programs fixbb and relax (Das and Baker, 2008). The Rosetta fixed backbone design application fixbb was used to make the initial model. Subsequently, these models were relaxed using the Rosetta structure refinement application relax. The two steps were iterated three times. See the Supplementary file 1E for the command lines. Rosetta 3.4 was used in the work.We selected five constructs for further testing in vitro (Table 1). They are among the best-scoring constructs according to the in silico simulation (Figure 4—figure supplement 2). If two constructs have comparable scores (they are adjacent in the score ranking), the one with fewer mutations was preferred. The selected constructs all differ at least at two positions in their sequences. When we searched these optimized RPS20-hhta fragments in the NCBI nr database using BLAST (Camacho et al., 2009), the top hits were still RPS20s.
Cloning, protein expression and purification
DNA sequences coding for the designed TPR repeats were gene-synthesized in codon-optimized form (Eurofins) and cloned into vector pET-28b (Novagen) using NcoI/HindIII restriction sites, and into pETHis_1a to generate proteins with an N-terminal cleavable His6-tag. RPS20T. aquaticus and T. thermophilus genes were amplified from genomic DNA and cloned likewise. Recombinant plasmids were transformed into E. coli strain BL21-Gold (DE3) grown on LB agar plates containing 50 µg/ml kanamycin. For expression, cells were cultured at 25°C and induced with 1 mM isopropyl-D-thiogalactopyranoside (IPTG) at an OD600 of 0.6 for continued growth overnight.Bacterial cell pellets were resuspended in buffer A (50 mM Tris pH 8, 150 mM NaCl), supplemented with 5 mM MgCl2, DNaseI (Applichem) and protease inhibitor cocktail (cOmplete, Roche). After breaking the cells in a French Press, the suspension was centrifuged twice at 37,000 g. Soluble His6-tagged proteins were purified by binding proteins to Ni-NTA columns (GE Healthcare) in buffer A (50 mM Tris pH 8.0, 300 mM NaCl) and elution with increasing concentrations of imidazole up to 0.6 M. Eluted proteins were dialyzed against buffer A for cleavage by His6-TEV-protease (50 U/mg protein). Cleavage leaves two additional residues (Gly-Ala) as N-terminal extension to all proteins produced in this manner. After incubation overnight, cleaved proteins were re-run on Ni-NTA columns and collected in the flow-through. They were finally purified by gel size exclusion chromatography (Superdex G75, GE Healthcare) in buffer A containing 0.5 mM EDTA. Insoluble proteins were dissolved in 6 M guanidinium chloride and refolded by dialysis overnight against buffer A. Refolded proteins were further purified by sequential anion-exchange (Q Sepharose HP) and cation-exchange (SP Sepharose HP) chromatography using 0–500 mM NaCl salt gradients in buffer D (20 mM Tris pH 8, 1 mM EDTA), and by gel size exclusion chromatography (Superdex G75) in buffer A.
Biophysical characterization
To determine the native molecular mass of designed TPR repeats, static light scattering experiment was performed by applying samples onto a superdex S200 gel size exclusion column to which a miniDAWN Tristar Laser photometer (Wyatt) and an RI 2031 differential refractometer (JASCO) were coupled. Runs were performed in buffer A. Data analysis and molecular mass calculations were carried out with ASTRA V software (Wyatt). Tryptophan fluorescence spectra were recorded on a Jasco FP-6500 spectrofluorometer at 23°C; excitation was at 280 nm, emission spectra were collected from 300–400 nm. Circular dichroism (CD) spectra from 200–250 nm were recorded with a Jasco J-810 spectropolarimeter at 23°C in buffer E (30 mM MOPS pH 7.2, 150 mM NaCl). Cuvettes of 1 mm path length were used in all measurements. For melting curves and determination of Tm, CD measurements were recorded at 222 nm from 20–95°C, the temperature change was set to 1°C per minute, using a Peltier-controlled sample holder unit. For equilibrium-unfolding experiments performed at 23°C, native protein was mixed with different concentrations of urea in buffer A. After equilibration, circular dichroism was monitored at 222 nm. The fraction of unfolded protein f was determined based on f, where y and y are the values of y typical of the folded and unfolded states. Data were fitted to a two-state model with the software ProFit (6.1) as described (Grimsley et al., 2013), assuming a linear urea [D] dependence of ∆G: ∆G = ∆G – m[D], where ∆G is the free energy change at a given denaturant concentration, ∆G the free energy change in the absence of denaturant, and m the sensitivity of the transition to denaturant. Fragment sizes of M4N were determined by ESI-micrOTOF mass spectrometry (Bruker Daltonics, Max Planck Institute core facility Martinsried), followed by bioinformatic analysis using the Find-Pept tool (ExPASy).
Crystallization, structure solution and refinement
For crystallization, the M4N and M4NΔC protein solutions were concentrated to 70 and 30 mg/ml, respectively, in buffer A. The buffer for M4NΔC additionally contained 0.5 mM EDTA. Crystallization trials were performed at 295 K in 96-well sitting-drop vapor-diffusion plates with 50 µl of reservoir solution and drops consisting of 300 nl protein solution and 300 nl reservoir solution in the case of M4N, and 400 nl protein solution and 200 nl reservoir solution in the case of M4NΔC. Crystallization conditions for the crystals used in the diffraction experiments are listed in Supplementary file 1H together with the solutions used for cryo-protection. Single crystals were transferred into a droplet of cryo-protectant before loop-mounting and flash-cooling in liquid nitrogen. For experimental phasing, crystals of M4N were soaked overnight in a droplet containing reservoir solution supplemented with 5 mM K2PtCl4 prior to cryo-protection and flash-cooling. All data were collected at beamline X10SA (PXII) at the Swiss Light Source (Paul Scherrer Institute, Villigen, Switzerland) at 100 K using a PILATUS 6M detector (DECTRIS) at the wavelengths indicated in Supplementary file 1H. Diffraction images were processed and scaled using the XDS program suite (Kabsch, 1993). Using SHELXD (Sheldrick, 2008), three strong Pt-sites were identified in the M4N derivative dataset. After density modification with SHELXE, the resulting electron density map could be traced by Buccaneer (Cowtan, 2006) to large extents, and revealed three chains of M4N in the asymmetric unit (ASU), organized as one dimer and one monomer. Refinement was continued using the native dataset. The two different crystal forms of M4NΔC, CF I and CF II, were solved by molecular replacement on the basis of the refined M4N coordinates. Using MOLREP (Vagin and Teplyakov, 2000), two copies of the dimeric assembly of the M4N structure were located in the ASU of CF I, and one monomer in the ASU of CF II. All models were completed by cyclic manual modeling with Coot (Emsley and Cowtan, 2004) and refinement with PHENIX (RRID:SCR_014224) (Adams et al., 2010). Analysis with PROCHECK (Laskowski et al., 1993) showed excellent geometries for all structures. Data collection and refinement statistics are summarized in Supplementary file 1H. The three structures are deposited in the PDB (Berman et al., 2000) with accession codes: 5FZQ (M4N), 5FZR (M4NΔC CF I), 5FZS (M4NΔC CF II).
Testing mutations in T. thermophilus
T. thermophilus HB8 and T. aquaticus YT-1 were obtained from the German Collection of Microorganisms and Cell Cultures (DSMZ). Growth in liquid medium was performed under mild stirring (160 rpm) in long necked flasks at 68°C with DSMZ Medium 74 for T. thermophilus and DSMZ Medium 878 for T. aquaticus. Agar (1.6% w/v) was added to the medium for growth on plates. When required, kanamycin (30 µg/ml) and bleocin (10 µg/ml) were added to the media. For purification experiments 25 ml cultures were grown to an optic density of 0.7 OD600 (~12 hr) and then re-inoculated in the same volume to an optical density of 0.035 OD600. The process was repeated serially three times and two 5 ml samples were taken in each step for glycerolstocks and DNA purification. Transformation of T. thermophilus was performed as described previously (Nguyen and Silberg, 2010). Genomic and plasmid DNA from Thermus were purified from 5 ml cultures using the QIAamp DNA Mini Kit and the QIAprep Spin Miniprep Kit, respectively.T. thermophilus KM4 strain was generated by gene replacement as follows: two PCR products comprising each one 1 Kb of DNA upstream and downstream of rpsT were amplified from T. thermophilus HB8 genomic DNA and then fused by overlapping PCR. The resulting fragment, in which rpsT is substituted by a PstI site, was cloned in the KpnI/XbaI sites of plasmid pBlueScript II SK (+). Next, a fragment from plasmid pKT1 (Biotools, Spain), which contains the thermostable kanamycin resistance Kat gene under the control of the constitutive PslpA promoter, was inserted into the new PstI site. Direction of the Kat cassette insertion was selected, so transcription from the PslpA promoter continues through thx, a gene that is located downstream and is predicted to form an operon with rpsT. The 3 Kb final construct cloned in pBluescript was subsequently amplified by PCR and the linear product was purified and transformed by electroporation in T. thermophilus HB8. Integration of the Kat cassette was selected by growth in kanamycin.For the complementation in trans of rpsT from T. thermophilus, a PCR product of rpsT was amplified from genomic DNA and cloned in the SpeI/PstI sites of plasmid pJJSpro (Nguyen and Silberg, 2010) generating plasmid pJJSpro-rpsTTt. The same approach was followed for rpsT in T. aquaticus (pJJSpro-rpsTTa) and in T. aquaticusrpsT alleles with two (pJJSpro-rpsTTaM2) and four (pJJSpro-rpsTTaM4N) amino-acid substitutions. The PCR product for the two later constructs was amplified using the plasmids in which the synthesized genes were delivered as a template.In the interests of transparency, eLife includes the editorial decision letter and accompanying author responses. A lightly edited version of the letter sent to the authors after peer review is shown, indicating the most substantive concerns; minor comments are not usually included.Thank you for submitting your article "Origin of a folded repeat protein from an intrinsically unfolded ancestor" for consideration by eLife. Your article has been favorably evaluated by John Kuriyan as the Senior Editor and three reviewers, including Dan S. Tawfik (Reviewer #3) and Nir Ben-Tal (Reviewer #1), who is a member of our Board of Reviewing Editors.The reviewers have discussed the reviews with one another and the Reviewing Editor has drafted this decision to help you prepare a revised submission.Summary:The lead author, Lupas, has suggested back in 2001 a model for the emergence of proteins in our evolutionary history. According to his model, short amino acid fragments that were capable of RNA binding emerged. Of these, some improved RNA function, and survived. Eventually, some of these became foldable (and functional) on their own. Proteins emerged by duplications of these ancestral fragments. In an eLife publication last year, the Lupas lab conducted bioinformatics analysis and detected a gallery of 40 commonly found protein fragments. That they are popular, and found also in ancient proteins, makes them candidates as ancestral fragments. Here, Lupas and colleagues examine one of these: an α helical hairpin with about 35-residues long sequence motif, known as tetratricopeptide. Sequence analysis showed that it appears also in the ribosomal protein RPS20, but it is not stable on its own, detached from the ribosome. Using a triplet of this motif as a seed, the authors managed to design variants that are foldable autonomously. Because they are distant only 2-5 mutations (per motif) from the original, the authors suggest that this is a viable evolutionary scenario.This work is new and interesting in three respects. Firstly, there have been several demonstrations of the general principle of peptides leading to globular proteins via duplication and fusion, but not of the fold addressed here (TPRs). Secondly, the peptide's origin was identified here, and assigned to an omnipresent, ancient protein (a ribosomal protein) – in previous works, the ancestral peptide has been reconstructed, but its origins remain unknown. Thirdly, the ancestral peptide has no structure on its own, and assumes the TPR fold upon duplication and fusion (in previous demonstrations, the peptide precursors oligomerized to give a globular protein that resembles the modern, monomeric repeat protein). The work also provides a further, and interesting, demonstration of the principle that mutations that are neutral in one context can pave the road to new trait, or structures in this case. Comments for further improvements are provided below.Essential revisions:1) The title and emphasis on "intrinsically unfolded" is misleading and may be misinterpreted by causal readers. The authors are not proposing that globular proteins originated from low complexity stretches of protein sequence. Although a single α-hairpin is indeed unfolded without RNA because it is simply too short, it does have a good α-helical content, and indeed is an α-hairpin rather than low complexity intrinsically unfolded protein.2) The constructed protein had been shown to adopt the TPR fold, but has no biochemical function, and as we know, structure in itself does is not 'visible' by natural selection. Presumably identifying potential function(s) for these designed TPRs is not a trivial task. However, the authors should explicitly acknowledge this and discuss what might be the function(s) which this protein could perform.3) A related issue: The likelihood of an evolutionary step that involves 2-5 mutations should be discussed further. Reassuringly, none of the mutations harm the parent organism (Thermus has been used here), but would such mutants survive without providing evolutionary value? Or would they provide some merit even alone? Perhaps still bound to RNA? What is the evolutionary scenario here?Summary:The lead author, Lupas, has suggested back in 2001 a model for the emergence of proteins in our evolutionary history. According to his model, short amino acid fragments that were capable of RNA binding emerged. Of these, some improved RNA function, and survived. Eventually, some of these became foldable (and functional) on their own. Proteins emerged by duplications of these ancestral fragments. In an eLife publication last year, the Lupas lab conducted bioinformatics analysis and detected a gallery of 40 commonly found protein fragments. That they are popular, and found also in ancient proteins, makes them candidates as ancestral fragments. Here, Lupas and colleagues examine one of these: an α helical hairpin with about 35-residues long sequence motif, known as tetratricopeptide. Sequence analysis showed that it appears also in the ribosomal protein RPS20, but it is not stable on its own, detached from the ribosome. Using a triplet of this motif as a seed, the authors managed to design variants that are foldable autonomously. Because they are distant only 2-5 mutations (per motif) from the original, the authors suggest that this is a viable evolutionary scenario.This work is new and interesting in three respects. Firstly, there have been several demonstrations of the general principle of peptides leading to globular proteins via duplication and fusion, but not of the fold addressed here (TPRs). Secondly, the peptide's origin was identified here, and assigned to an omnipresent, ancient protein (a ribosomal protein) – in previous works, the ancestral peptide has been reconstructed, but its origins remain unknown. Thirdly, the ancestral peptide has no structure on its own, and assumes the TPR fold upon duplication and fusion (in previous demonstrations, the peptide precursors oligomerized to give a globular protein that resembles the modern, monomeric repeat protein). The work also provides a further, and interesting, demonstration of the principle that mutations that are neutral in one context can pave the road to new trait, or structures in this case. Comments for further improvements are provided below.We now realize, based on the summary and the reviewer comments below, that we had not formulated the basis of our study with sufficient clarity, and have therefore made multiple changes throughout the manuscript in revision. We did not wish to imply a scenario where RPS20 was the ancestor of the TPR fold, but rather one of common descent of RPS20 and TPR from an ancestral hairpin, which also gave rise to a number of other folds. For our study, we used RPS20 because we consider it the oldest still surviving descendant of this ancestral hairpin and, due to its slow rate of evolution, also the one most likely to reflect ancestral properties. In the process, we hoped to find that repetition is a sufficiently powerful mechanism to allow the emergence of a folded protein from an unstructured parent (note that the entire RPS20 is unstructured in the absence of ribosomal RNA, not just the isolated helix hairpin).Essential revisions:1) The title and emphasis on "intrinsically unfolded" is misleading and may be misinterpreted by causal readers. The authors are not proposing that globular proteins originated from low complexity stretches of protein sequence. Although a single α-hairpin is indeed unfolded without RNA because it is simply too short, it does have a good α-helical content, and indeed is an α-hairpin rather than low complexity intrinsically unfolded protein.We agree that the term will be misunderstood by readers who consider that only proteins unstructured under all conditions are in fact intrinsically disordered. However, it has become widely accepted that unstructured proteins that become partly or fully structured upon binding to small molecules or macromolecular ligands are also usefully included among the intrinsically disordered proteins. We have changed the title to use the term “disordered”, which is the generally used term (rather than “unfolded”, which we had used before as a contrast to the “folded” repeat protein) and have added a sentence to the Introduction to explain why we refer to ribosomal proteins as intrinsically disordered, also providing references to recent high-profile reviews that can further illuminate this point. We have further added material to section 2.4 and the Methods in order to substantiate that the sequence of RPS20 is in fact similar to that of intrinsically disordered proteins as judged by many disorder predictors, and with a biased residue distribution seen as low-complexity by the program SEG.With respect to the single α-hairpin being unfolded, we agree that its lack of structure in solution would not be surprising, but that was not the point we were trying to make. Our point was that the parent protein is unstructured in solution. For this reason, we deleted “intrinsically unfolded” from the description of the helical hairpin in the last sentence of the Abstract.2) The constructed protein had been shown to adopt the TPR fold, but has no biochemical function, and as we know, structure in itself does is not 'visible' by natural selection. Presumably identifying potential function(s) for these designed TPRs is not a trivial task. However, the authors should explicitly acknowledge this and discuss what might be the function(s) which this protein could perform.We fully agree with this point and have expanded the last section of the paper to explicitly address it. Structure is a prerequisite for function, but it is the function that is under selection. Although the goal of our study was to explore the origin of structure from an unstructured precursor, we had been aware all along that the survival of this newly emerged structure would be dependent on the benefits it confers.Thus, we started experiments on this point as soon as we had obtained the M4N structure. Following the reviewers’ comments, we decided to extend these in revision, but have not succeeded in obtaining conclusive results so far.Guided by the observation that TPR domains, where of known activity, mediate protein-protein interactions, we started screens to identify potential binders to our new protein. Specifically, we performed pulldowns with soluble cell extracts from T. aquaticus, T. thermophilus and E. coli using M4NΔC and M5ΔC, but were unable to discover interactors of even moderate affinity. Since TPR domains typically recognize linear sequence motifs in unstructured segments, we also screened a peptide library against M4NΔC and M5ΔC, using phage display with the Ph.D.-12 Library (NEB) containing ca. 109 12-mers, but again, so far, no peptides could be identified (these experiments are still ongoing). This inability to identify protein or peptide ligands binding to our TPR domains may well be due to the dimerization of the protein, which obstructs the ligand-binding face common to TPR proteins. We are therefore now exploring whether we can disrupt dimerization by single mutations in the C-terminal helices before resuming these screens.In parallel, however, we are also trying to exploit the central crevice formed in the dimer to find small- molecule ligands that could open an entirely new set of functionalities not seen in TPR proteins today.Finally, we are exploring to what extent our new proteins still retain the ability of the RPS20 parent to interact with RNA. Preliminary experiments show that the folded dimers have no affinity for heterologous RNA molecules, but experiments remain to be done with Thermus ribosomal RNA and with the yet to be obtained monomeric variants.3) A related issue: The likelihood of an evolutionary step that involves 2-5 mutations should be discussed further. Reassuringly, none of the mutations harm the parent organism (Thermus has been used here), but would such mutants survive without providing evolutionary value? Or would they provide some merit even alone? Perhaps still bound to RNA? What is the evolutionary scenario here?We agree that the evolutionary scenario did not become clear enough from the manuscript and we therefore made multiple changes to clarify it. We did not wish to imply that TPR proteins arose from a proto-RPS20 in a fully formed cell (such as Thermus is today); rather, we think that they arose from a precursor form that, like RPS20, interacted with RNA, but in a much more primitive cell-like environment. The reason for the in vivoexperiments was to establish that the mutations necessary for folding are neutral with respect to RNA interaction in our model system. We take this finding to suggest that these (and other fold-promoting) mutations could have been sampled by neutral drift also in the ancestral hairpin. Indeed, it is reasonable to expect that in a more primitive, less networked and less integrated setting, many more mutations would have been (largely) neutral than in the Thermus cytosol. A further corollary of the evolutionary steps happening in a pre-cellular environment is that, in the absence of performant control and repair mechanisms, the frequency of all kinds of genetic mutations would have been much higher.
Authors: H M Berman; J Westbrook; Z Feng; G Gilliland; T N Bhat; H Weissig; I N Shindyalov; P E Bourne Journal: Nucleic Acids Res Date: 2000-01-01 Impact factor: 16.971
Authors: Andreas Kohl; H Kaspar Binz; Patrik Forrer; Michael T Stumpp; Andreas Plückthun; Markus G Grütter Journal: Proc Natl Acad Sci U S A Date: 2003-02-03 Impact factor: 11.205
Authors: Carrie-Lynn Keiski; Michael Harwich; Sumita Jain; Ana Mirela Neculai; Patrick Yip; Howard Robinson; John C Whitney; Laura Riley; Lori L Burrows; Dennis E Ohman; P Lynne Howell Journal: Structure Date: 2010-02-10 Impact factor: 5.006
Authors: Dixie Bungard; Jacob S Copple; Jing Yan; Jimmy J Chhun; Vlad K Kumirov; Scott G Foy; Joanna Masel; Vicki H Wysocki; Matthew H J Cordes Journal: Structure Date: 2017-10-12 Impact factor: 5.006
Authors: Rocío Espada; R Gonzalo Parra; Thierry Mora; Aleksandra M Walczak; Diego U Ferreiro Journal: PLoS Comput Biol Date: 2017-06-15 Impact factor: 4.475