Michelle M Leger1, Laura Eme1, Laura A Hug1, Andrew J Roger2. 1. Department of Biochemistry and Molecular Biology, Dalhousie University, Halifax, NS, Canada. 2. Department of Biochemistry and Molecular Biology, Dalhousie University, Halifax, NS, Canada andrew.roger@dal.ca.
Abstract
Mitochondrion-related organelles (MROs) have arisen independently in a wide range of anaerobic protist lineages. Only a few of these organelles and their functions have been investigated in detail, and most of what is known about MROs comes from studies of parasitic organisms such as the parabasalid Trichomonas vaginalis Here, we describe the MRO of a free-living anaerobic jakobid excavate, Stygiella incarcerata We report an RNAseq-based reconstruction of S. incarcerata's MRO proteome, with an associated biochemical map of the pathways predicted to be present in this organelle. The pyruvate metabolism and oxidative stress response pathways are strikingly similar to those found in the MROs of other anaerobic protists, such as Pygsuia and Trichomonas This elegant example of convergent evolution is suggestive of an anaerobic biochemical 'module' of prokaryotic origins that has been laterally transferred among eukaryotes, enabling them to adapt rapidly to anaerobiosis. We also identified genes corresponding to a variety of mitochondrial processes not found in Trichomonas, including intermembrane space components of the mitochondrial protein import apparatus, and enzymes involved in amino acid metabolism and cardiolipin biosynthesis. In this respect, the MROs of S. incarcerata more closely resemble those of the much more distantly related free-living organisms Pygsuia biforma and Cantina marsupialis, likely reflecting these organisms' shared lifestyle as free-living anaerobes.
Mitochondrion-related organelles (MROs) have arisen independently in a wide range of anaerobic protist lineages. Only a few of these organelles and their functions have been investigated in detail, and most of what is known about MROs comes from studies of parasitic organisms such as the parabasalid Trichomonas vaginalis Here, we describe the MRO of a free-living anaerobic jakobid excavate, Stygiella incarcerata We report an RNAseq-based reconstruction of S. incarcerata's MRO proteome, with an associated biochemical map of the pathways predicted to be present in this organelle. The pyruvate metabolism and oxidative stress response pathways are strikingly similar to those found in the MROs of other anaerobic protists, such as Pygsuia and Trichomonas This elegant example of convergent evolution is suggestive of an anaerobic biochemical 'module' of prokaryotic origins that has been laterally transferred among eukaryotes, enabling them to adapt rapidly to anaerobiosis. We also identified genes corresponding to a variety of mitochondrial processes not found in Trichomonas, including intermembrane space components of the mitochondrial protein import apparatus, and enzymes involved in amino acid metabolism and cardiolipin biosynthesis. In this respect, the MROs of S. incarcerata more closely resemble those of the much more distantly related free-living organisms Pygsuia biforma and Cantina marsupialis, likely reflecting these organisms' shared lifestyle as free-living anaerobes.
All known extant eukaryote lineages contain, or once contained, a mitochondrion of some description, originating from an alphaproteobacterial endosymbiont (Stairs et al. 2015). Highly derived mitochondrion-related organelles (MROs) are found in diverse anaerobic protist lineages (reviewed in Stairs et al. 2015; Makiuchi and Nozaki 2014), and these have been classified primarily based on their roles in ATP generation. Traditionally, MROs that produce energy anaerobically have been classified as hydrogenosomes (Lindmark and Muller 1973; Bui and Johnson 1996; Dyall et al. 2004; Hrdý et al. 2004), while more reduced organelles that lack a role in energy metabolism have been classified as mitosomes (Tovar et al. 1999; Jedelsky et al. 2011). However, a more recent classification scheme aims to encompass the broader spectrum of energy functions since discovered in MROs (Müller et al. 2012). In this scheme the first three classes have retained an electron transport chain. Class 1 mitochondria, typical mitochondria, are only capable of generating ATP through oxidative phosphorylation. Class 2 mitochondria are additionally capable of functioning anaerobically using alternative electron acceptors, such as fumarate, while class 3 mitochondria possess both an electron transport chain and a bacterial-like anaerobic ATP-generation pathway. Class 4 mitochondria, also known as hydrogenosomes, possess the anaerobic ATP-generation pathway, but have lost most components of the electron transport chain, such that they are no longer able to generate ATP through aerobic phosphorylation. The more highly reduced class 5 mitochondria, also known as mitosomes, lack any role in ATP generation and any of the associated enzymes. Based on the distribution of MROs within eukaryotic phyla (many of which contain predominantly aerobic mitochondriate taxa), it has been proposed that this adaptation to anaerobic conditions has occurred multiple times, including at least four independent events within ciliates alone (Embley et al. 1995). Nevertheless, striking biochemical similarities are apparent between these taxa in the form of enzymes shared between distantly-related anaerobic and microaerophilic eukaryotes (Andersson et al. 2003, 2006; Stairs et al. 2011; Müller et al. 2012; Tsaousis, Leger, et al. 2012; Noguchi et al. 2015).Hydrogenosomes (class 4 mitochondria) were first described in trichomonads (Lindmark and Muller 1973), and have since been described in many anaerobic protistan lineages, including the excavates Sawyeria marylandensis (Barberà et al. 2010), Psalteriomonas lanterna (de Graaf et al. 2009), and Spironucleus salmonicida (Jerlstrom-Hultqvist et al. 2013); chytridiomycete fungi such as Neocallimastix spp. (Bowman et al. 1992); and some anaerobic ciliates (Yarlett et al. 1981; Akhmanova et al. 1998). They contain a characteristic anaerobic ATP-generating pathway (Dyall et al. 2004; Hrdý et al. 2004, 2008; Tsaousis, Leger, et al. 2012), which relies on the presence of two key proteins rarely found within classical aerobic mitochondria: pyruvate:ferredoxin oxidoreductase (PFO) and [FeFe]-hydrogenase. PFO decarboxylates pyruvate, producing acetyl-CoA and carbon dioxide. In some anaerobic eukaryotes, such as Blastocystis sp., Mastigamoeba balamuthi or Cryptosporidium parvum, pyruvate to acetyl-CoA conversion is carried out by a pyruvate:NADP oxidoreductase (PNO) or a pyruvate:formate lyase (PFL) (Ctrnacta et al. 2006; Lantsman et al. 2008; Stairs et al. 2011). Coenzyme A is subsequently transferred from acetyl-CoA to succinate by an acetate:succinate CoA transferase (ASCT; Tielens et al. 2010), generating acetate and succinyl-CoA. The subsequent regeneration of succinate, catalyzed by the tricarboxylic acid cycle enzyme succinate thiokinase (STK), generates ATP through substrate-level phosphorylation. The electrons generated in the decarboxylation of pyruvate are transferred from PFO, via ferredoxin, to [FeFe]-hydrogenase, which catalyses the reductive formation of hydrogen gas from free protons. Three maturases, HydE, HydF, and HydG, are involved in the insertion of an iron sulfur (FeS) cluster into the active site of [FeFe]-hydrogenase (Posewitz et al. 2004; McGlynn et al. 2008; Pilet et al. 2009; Mulder et al. 2010). The 51- and 24-kDa subunits of mitochondrial electron transport chain Complex I are commonly found in anaerobic eukaryotes in the absence of other Complex I subunits, and are capable of transferring electrons to ferredoxin (Hrdý et al. 2004). The origin(s) of PFO and [FeFe]-hydrogenase and its maturases in diverse anaerobic eukaryotes are currently under debate. Phylogenetic analyses have provided some evidence for lateral transfers of these protein genes from either anaerobic bacteria or between eukaryotes, but these analyses suffer from lack of resolution (Vignais et al. 2001; Davidson et al. 2002; Horner et al. 2002; Hug et al. 2010; Leger et al. 2013; Stairs et al. 2014). Conversely, there is currently no strong phylogenetic link between eukaryotic homologs of these enzymes and alphaproteobacterial orthologs that would be suggestive of a mitochondrial origin.With the advent of high-throughput sequencing, the proteomes of MROs from an increasing number of anaerobic lineages have been predicted, clarifying the totality of the functions of the organelles and expanding beyond energy metabolism. These studies have revealed a diversity of ancestrally mitochondrial and newly acquired biochemical pathways in MROs (Akhmanova et al. 1998; van Hoek et al. 2000; Boxma et al. 2005; Lantsman et al. 2008; Stechmann et al. 2008; Denoeud et al. 2011; Tsaousis et al. 2011; Nyvltova et al. 2013; Stairs et al. 2014; Nyvltova et al. 2015).Here, we examine the MRO of the anaerobic protist Stygiella incarcerata. S. incarcerata (Panek et al. 2015) (originally Jakoba incarcerata; Bernard et al. 2000; then Andalucia incarcerata; Lara et al. 2006) is a member of the Jakobida (Lara et al. 2006), a group of flagellated protists with typical aerobic mitochondria. Jakobids are unique in having the most gene rich, bacterial-like mitochondrial genomes found to date (Lang et al. 1997; Burger et al. 2013; Kamikawa et al. 2014), bacterial-like RNA polymerases, and Shine–Dalgarno-like motifs upstream of translation sites (Lang et al. 1997). Stygiellidae represent a secondary derivation of the anaerobic lifestyle within the otherwise aerobic jakobids (Panek et al. 2015). The original identification by electron microscopy described uniformly-staining MROs lacking cristae (Simpson and Patterson 2001); however, the biochemical nature of the MROs has not been studied until now.Stygiella incarcerata presents an opportunity to compare mitochondrial remodeling in a free-living organism with similar remodeling in the better-studied parasite lineages (Loftus et al. 2005; Aguilera et al. 2008; Jedelsky et al. 2011; Schneider et al. 2011; Jerlstrom-Hultqvist et al. 2013), specifically from a lineage containing mitochondria with particularly bacterial-like features.Here, we reconstruct the MRO proteome of S. incarcerata based on RNASeq data, and we verify our predictions using immunolocalization of key enzymes.
Results and Discussion
Structural Characterization of the Organelle in S. incarcerata
Electron microscopy was used to examine the morphology of the organelle in greater detail than had previously been assessed. The organelle is uniform in staining density, with greater density than the surrounding cytosol, and lacking visible ribosomes (fig. 1). As previously described (Simpson and Patterson 2001), it is generally located close to the nucleus, anterior in the cell. It is roughly ovoid in shape, and 0.75–1 μm in length (fig. 1). Examination of the organelle at a higher magnification confirmed the presence of a double membrane, consistent with its earlier designation as an endosymbiont-derived mitochondrion-like organelle (Simpson and Patterson 2001) (fig. 1).
Fig. 1.
Transmission electron micrographs of S. incarcerata, showing the MRO. (A) Whole S. incarcerata cell; the inset area shown in (B) is indicated with a dashed outline. (B) The MRO of S. incarcerata. White arrows indicate the double membrane.
Transmission electron micrographs of S. incarcerata, showing the MRO. (A) Whole S. incarcerata cell; the inset area shown in (B) is indicated with a dashed outline. (B) The MRO of S. incarcerata. White arrows indicate the double membrane.
Stygiella incarcerata MROs Likely Lack an Organellar Genome
To determine the degree of completeness of the transcriptome, we queried the transcripts using sequences present in a 159-protein dataset of conserved eukaryotic proteins (Brown et al. 2013). We identified S.
incarcerata homologs of all but one of these proteins (nsf1-E; supplementary table 1, Supplementary Material online). This complement is comparable with the most complete complement present in Brown et al.’s dataset, that of Homo sapiens. We then searched for homologs of mitochondrially encoded genes of S. incarcerata’s close relative, Andalucia godoyi (Burger et al. 2013). Although A. godoyi has one of the largest mitochondrial gene complements known (72 protein-coding genes and 34 structural RNA genes; listed in supplementary table 2, Supplementary Material online), no S. incarcerata orthologs of any of these genes could be recovered from the transcriptome.Approximately Unbiased Tests of Alternate Topologies.aRejected with P-value <0.05.bRejected with P-value <0.01.We made attempts at visualizing an organellar genome, if present, using pulsed-field gel electrophoresis. We observed only one candidate band, a transiently present band of ∼9 kb that could not be cloned for sequencing, and that was not recognized by a 16S mitochondrial rDNA probe from the sister taxon A.
godoyi on Southern blots (data not shown). Attempts were also made to isolate mitochondrial 16S ribosomal DNA sequences from S. incarcerata DNA extracts using PCR with eukaryote mitochondrial-specific primers. Only sequences with >95% identity to bacterial ribosomal DNAs in the GenBank nr database were retrieved. Positive controls using A. godoyi DNA successfully amplified mitochondrial 16S ribosomal DNA (data not shown). These findings are consistent with the apparent absence of mitochondrial genes, or any sequences encoding mitochondrial transcriptional or translational apparatus components. It therefore seems likely that S. incarcerata MROs, like those of Trichomonas, lack an organellar genome.
Identification of Organellar Proteins In Silico
CBOrg (see Materials and Methods) and comparative BLAST analyses identified 142 proteins of putative mitochondrial or hydrogenosomal origin. Of these, 89 sequences contain N-terminal targeting peptides as predicted by TargetP (supplementary table S3, Supplementary Material online). Given the identification of both α and β-subunits of the mitochondrial processing peptidase (MPP), it seems likely that typical targeting pathways are active within the organelle, and thus identification of N-terminal targeting peptides can be interpreted as further evidence for the localization of these proteins. Most of the proteins predicted to be localized to the MROs have N-terminal extensions relative to bacterial homologs; these extensions are generally predicted to be N-terminal targeting peptides by TargetP and Mitoprot. Exceptions are homologs of known membrane proteins, such as carrier proteins and some components of the mitochondrial protein import system, many of which are known to lack N-terminal targeting peptides (Becker et al. 2012). It is also reasonable to expect that a significant portion of the proteins actually targeted to the organelle contain cryptic internal targeting signals (Neupert and Herrmann 2007) and as such will not have been identified in this survey. Figure 2 shows a biochemical map of selected pathways predicted to be present in the MRO.
Fig. 2.
A hypothetical biochemical map of selected pathways in the MRO of S. incarcerata. All proteins depicted are based on analyses of the EST and RNA-Seq data intended to identify mitochondrion or hydrogenosome-localized proteins. Circles enclosed by a solid outline indicate the protein contains a predicted N-terminal targeting peptide. Circles enclosed by a dashed outline indicate genes with an incomplete coding region at the 5′ end, and thus the presence/absence of a targeting peptide could not be evaluated. Circles with no outline indicate proteins with no predicted N-terminal targeting peptide. Grey circles indicate components of pathways or solute carriers which were not represented in the EST survey, but which are anticipated to be present in the organelle based on the presence of other components within complexes and pathways. Pathways and associated abbreviations of their enzyme components are depicted as follows: General: OM: outer mitochondrial membrane; IM: inner mitochondrial membrane; AMP: adenosine monophosphate; ADP: adenosine diphosphate; ATP: adenosine triphosphate; NAD: nicotinamide adenine dinucleotide; NADP: nicotinamide adenine dinucleotide phosphate; AcAc: acetoacetate; Ace-CoA: acetyl-CoA; AcAce-CoA: acetoacetyl-CoA; CoASH: Coenzyme A; MMSA: (S)-methylmalonate-semialdehyde; Suc: succinate; Suc-CoA: succinyl-CoA; Ala: alanine; Asp: aspartate; Glu: glutamate; Glx: glyoxylate; Gly: glycine; Ile: isoleucine; Leu: leucine; Lys: lysine; Ser: serine; Val: valine; Lac: lactate; Lip: lipoate; Oaa: oxaloacetate; Pyr: pyruvate; Q: quinone; THF: tetrahydrofolate. Yellow circles: sulphur moiety of FeS clusters; red circles: iron moiety of FeS clusters; contiguous white circles: imported protein; contiguous black circles: mitochondrial targeting peptide of imported protein. Solid black arrows indicate biochemical pathways; dashed black arrows indicate poorly understood or unclear pathways; solid grey arrows indicate electron transfer. Pyruvate metabolism (pink): 24 kDa: 24 kDa subunit of Electron Transport Chain Complex I; 51 kDa: 51 kDa subunit of Electron Transport Chain Complex I; AAC: ADP/ATP translocator; ASCTB: acetate:succinate CoA-transferase, subtype 1B; E, F, G: [FeFe]-hydrogenase maturases HydE, HydF and HydG, respectively; FERO: oxidized electron transport ferredoxin; HYD: FERR: reduced electron transport ferredoxin; HYD: [FeFe]-hydrogenase; PFO: pyruvate:ferredoxin oxidoreductase; SCS: succinyl-CoA synthetase. Carriers (lilac): Aral: Aralar solute carrier; MCF: Mitochondrial Carrier Family protein. Ketone body degradation (light green): ACAT: acetyl-CoA C-acetyltransferase; SCOT: succinate:3-oxoacid CoA-transferase. ROS and oxygen stress (dark green): FDP: flavodiiron protein; SOD: superoxide dismutase; TRX: thioredoxin; TRXP: thioredoxin peroxidase. Mitochondrial protein import and folding (yellow): BCS: ubiquinol-Cytochrome c reductase Synthesis; CPN: Chaperonin; HSP: Heat Shock Protein; MET: Metaxin; MGE: Mitochondrial GrpE; MIA: Mitochondrial intermembrane space Import and Assembly; MPP: Mitochondrial Processing Peptidase; PHB: Prohibitin; SAM: Sorting and Assembly Machinery; TIM: Translocator of the Inner Membrane; TOM: Translocator of the Outer Membrane; 8, 9, 10, 13: Translocator of the Inner Membrane proteins Tim8, Tim9, Tim10, Tim13, respectively. Iron–sulfur cluster assembly (orange): ATM: ABC transporter, Mitochondrial; FRX: Frataxin; GRX: Glutaredoxin; IND: iron-sulfur protein required for NADH dehydrogenase; ISC: Iron-Sulfur Cluster; ISD: Iron-Sulfur protein biogenesis, Desulfurase-interacting; JAC: J-type Accessory Chaperone; NFU: NifU-like; SSQ: Stress Seventy subfamily Q; YAH: Yeast Adrenodoxin Homolog. Amino acid metabolism (light blue): AGT: alanine–glyoxylate aminotransferase; ALT: alanine aminotransferase; AST: aspartate aminotransferase; DLDH: d-lactate dehydrogenase; GCS: Glycine Cleavage System; H, L, P, T: H-, L-, P- and T-protein components of the glycine cleavage system, respectively; SHMT: serine hydroxymethyltransferase; ACAD: branched-chain acyl-CoA dehydrogenase; BαKDH: branched-chain α-ketoglutarate dehydrogenase complex; BCAAT: branched-chain amino acid aminotransferase; ECH: enoyl-CoA hydratase; MCE: methylmalonyl-CoA epimerase; MCM: methylmalonyl-CoA mutase; MSDH: methylmalonyl semialdehyde dehydrogenase; PCC: propionyl-CoA carboxylase. Electron transport (dark blue): AOX: alternative oxidase; ETF: electron transport flavoprotein; ETFDH: electron transport flavoprotein dehydrogenase; G3PD: glycerol-3-phosphate dehydrogenase. Other (white): CDP-DAG: cytidine diphosphate diacylglcerol; CMP: cytidine monophosphate; CL: cardiolipin; CLS: cardiolipin synthase; LPLA: lipoate protein ligase; PA: phosphatidic acid; PNT: pyridine nucleotide transhydrogenase; TAM: translocator assembly and maintenance.
A hypothetical biochemical map of selected pathways in the MRO of S. incarcerata. All proteins depicted are based on analyses of the EST and RNA-Seq data intended to identify mitochondrion or hydrogenosome-localized proteins. Circles enclosed by a solid outline indicate the protein contains a predicted N-terminal targeting peptide. Circles enclosed by a dashed outline indicate genes with an incomplete coding region at the 5′ end, and thus the presence/absence of a targeting peptide could not be evaluated. Circles with no outline indicate proteins with no predicted N-terminal targeting peptide. Grey circles indicate components of pathways or solute carriers which were not represented in the EST survey, but which are anticipated to be present in the organelle based on the presence of other components within complexes and pathways. Pathways and associated abbreviations of their enzyme components are depicted as follows: General: OM: outer mitochondrial membrane; IM: inner mitochondrial membrane; AMP: adenosine monophosphate; ADP: adenosine diphosphate; ATP: adenosine triphosphate; NAD: nicotinamide adenine dinucleotide; NADP: nicotinamide adenine dinucleotide phosphate; AcAc: acetoacetate; Ace-CoA: acetyl-CoA; AcAce-CoA: acetoacetyl-CoA; CoASH: Coenzyme A; MMSA: (S)-methylmalonate-semialdehyde; Suc: succinate; Suc-CoA: succinyl-CoA; Ala: alanine; Asp: aspartate; Glu: glutamate; Glx: glyoxylate; Gly: glycine; Ile: isoleucine; Leu: leucine; Lys: lysine; Ser: serine; Val: valine; Lac: lactate; Lip: lipoate; Oaa: oxaloacetate; Pyr: pyruvate; Q: quinone; THF: tetrahydrofolate. Yellow circles: sulphur moiety of FeS clusters; red circles: iron moiety of FeS clusters; contiguous white circles: imported protein; contiguous black circles: mitochondrial targeting peptide of imported protein. Solid black arrows indicate biochemical pathways; dashed black arrows indicate poorly understood or unclear pathways; solid grey arrows indicate electron transfer. Pyruvate metabolism (pink): 24 kDa: 24 kDa subunit of Electron Transport Chain Complex I; 51 kDa: 51 kDa subunit of Electron Transport Chain Complex I; AAC: ADP/ATP translocator; ASCTB: acetate:succinate CoA-transferase, subtype 1B; E, F, G: [FeFe]-hydrogenase maturases HydE, HydF and HydG, respectively; FERO: oxidized electron transport ferredoxin; HYD: FERR: reduced electron transport ferredoxin; HYD: [FeFe]-hydrogenase; PFO: pyruvate:ferredoxin oxidoreductase; SCS: succinyl-CoA synthetase. Carriers (lilac): Aral: Aralar solute carrier; MCF: Mitochondrial Carrier Family protein. Ketone body degradation (light green): ACAT: acetyl-CoA C-acetyltransferase; SCOT: succinate:3-oxoacid CoA-transferase. ROS and oxygen stress (dark green): FDP: flavodiiron protein; SOD: superoxide dismutase; TRX: thioredoxin; TRXP: thioredoxin peroxidase. Mitochondrial protein import and folding (yellow): BCS: ubiquinol-Cytochrome c reductase Synthesis; CPN: Chaperonin; HSP: Heat Shock Protein; MET: Metaxin; MGE: Mitochondrial GrpE; MIA: Mitochondrial intermembrane space Import and Assembly; MPP: Mitochondrial Processing Peptidase; PHB: Prohibitin; SAM: Sorting and Assembly Machinery; TIM: Translocator of the Inner Membrane; TOM: Translocator of the Outer Membrane; 8, 9, 10, 13: Translocator of the Inner Membrane proteins Tim8, Tim9, Tim10, Tim13, respectively. Iron–sulfur cluster assembly (orange): ATM: ABC transporter, Mitochondrial; FRX: Frataxin; GRX: Glutaredoxin; IND: iron-sulfur protein required for NADH dehydrogenase; ISC: Iron-Sulfur Cluster; ISD: Iron-Sulfur protein biogenesis, Desulfurase-interacting; JAC: J-type Accessory Chaperone; NFU: NifU-like; SSQ: Stress Seventy subfamily Q; YAH: Yeast Adrenodoxin Homolog. Amino acid metabolism (light blue): AGT: alanine–glyoxylate aminotransferase; ALT: alanine aminotransferase; AST: aspartate aminotransferase; DLDH: d-lactate dehydrogenase; GCS: Glycine Cleavage System; H, L, P, T: H-, L-, P- and T-protein components of the glycine cleavage system, respectively; SHMT: serine hydroxymethyltransferase; ACAD: branched-chain acyl-CoA dehydrogenase; BαKDH: branched-chain α-ketoglutarate dehydrogenase complex; BCAAT: branched-chain amino acid aminotransferase; ECH: enoyl-CoA hydratase; MCE: methylmalonyl-CoA epimerase; MCM: methylmalonyl-CoA mutase; MSDH: methylmalonyl semialdehyde dehydrogenase; PCC: propionyl-CoA carboxylase. Electron transport (dark blue): AOX: alternative oxidase; ETF: electron transport flavoprotein; ETFDH: electron transport flavoprotein dehydrogenase; G3PD: glycerol-3-phosphate dehydrogenase. Other (white): CDP-DAG: cytidine diphosphate diacylglcerol; CMP: cytidine monophosphate; CL: cardiolipin; CLS: cardiolipin synthase; LPLA: lipoate protein ligase; PA: phosphatidic acid; PNT: pyridine nucleotide transhydrogenase; TAM: translocator assembly and maintenance.
ATP Generation
Most enzymes and protein complexes typically present in, and associated with aerobic ATP generation in, classic mitochondria are all conspicuously absent from the transcriptome. These include subunits of complex I other than the 51 and 24 kDa subunits; components of the electron transport chain downstream of complex I [including Complex II subunits retained in the MROs of Blastocystis spp., M.
balamuthi, Pygsuia biforma, and Cantina marsupialis (Gill et al. 2007; Lantsman et al. 2008; Stechmann et al. 2008; Stairs et al. 2014; Noguchi et al. 2015; Nyvltova et al. 2015)]; and subunits of the pyruvate dehydrogenase complex. In contrast, PFO, [FeFe]-hydrogenase and its maturases, ferredoxin, ASCT, STK, and the two complex I subunits were identified; these constitute the bulk of the typical hydrogenosomal ATP generation pathway described in Trichomonas
vaginalis (Dyall et al. 2004; Hrdý et al. 2004, 2008; Carlton et al. 2007). Like T. vaginalis, S. incarcerata possesses multiple MRO-targeted homologs of both PFO and [FeFe]-hydrogenase; but both of its copies of ASCT belong to the subtype 1B family, which is distinct from the subtype 1C enzyme found in T. vaginalis (Tielens et al. 2010). The S. incarcerata transcriptome also encodes PFL and PNO, although these enzymes lack targeting peptides and are not predicted to localize to the MROs.In addition to the two MRO-targeted [FeFe]-hydrogenase homologs, the transcriptome encodes two further [FeFe]-hydrogenases that lack predicted N-terminal mitochondrial targeting peptides. Each of these is fused to a C-terminal CysJ similar to those PNOs and NADPH cytochrome p450 reductases. This type of [FeFe]-hydrogenase has previously been described in T. vaginalis (Carlton et al. 2007), and in the breviate P.
biforma (Stairs et al. 2014); in both of these organisms, the CysJ-fused [FeF]-hydrogenases are also predicted to be cytosolic. We confirmed [FeFe]-hydrogenase localization within the MROs using immunogold labeling (fig. 3) with a heterologous polyclonal rat primary antibody raised against Mastigamoeba [FeFe]-hydrogenase peptide. Probing labeled cells with a secondary antibody conjugated to gold particles yielded a 7-fold higher density of gold particles in the MROs compared with the cytosol. We also observed cross-reaction of the antibody with engulfed bacteria, and with the nucleus (although staining in the nucleus was significantly lower than that in the MROs). The former likely results from cross-reaction with bacterial homologs, while the latter might be attributed to the presence of a transcript encoding Nuclear prelamin A Recognition Factor (NARF) protein, a distant homolog of [FeFe]-hydrogenase. While the antibody used recognizes all four [FeFe]-hydrogenases expressed in S. incarcerata—including the two that are predicted not to localize to the MROs (supplementary fig. S1, Supplementary Material online)—the significantly higher degree of staining within the MROs suggests that the bulk of [FeFe]-hydrogenases is present there, confirming a likely role of this organelle in ATP production.
Fig. 3.
Immunogold localization of IscS and [FeFe]-hydrogenase in S. incarcerata cells. (A) A representative whole cell fixed for immunogold staining; scale bar, 500 nm; this image has been cropped in order to show only the whole cell from which the insets shown were derived. (B) Magnified section from the cell pictured in (A), showing gold particles corresponding to anti-Giardia IscS localization; scale bar, 500 nm. (C) Mean density of immunogold labeling in engulfed bacteria, the cytosol, the nucleus, and MROs (seven cells), ± standard error of the mean. (D) Representative whole cell fixed for immunogold staining; scale bar, 500 nm; this image has been cropped in order to show only the whole cell from which the insets shown were derived. (E, F) Magnified sections from the cell pictured in (A), showing gold particles corresponding to anti-Mastigamoeba [FeFe]-hydrogenase localization; scale bar, 500 nm. (G) Mean density of immunogold labeling in engulfed bacteria, the cytosol, the nucleus, and MROs (13 cells), ± standard error of the mean. Brightness and contrast have been adjusted in each image to enhance visibility of the mitochondria and gold particles.
Immunogold localization of IscS and [FeFe]-hydrogenase in S. incarcerata cells. (A) A representative whole cell fixed for immunogold staining; scale bar, 500 nm; this image has been cropped in order to show only the whole cell from which the insets shown were derived. (B) Magnified section from the cell pictured in (A), showing gold particles corresponding to anti-Giardia IscS localization; scale bar, 500 nm. (C) Mean density of immunogold labeling in engulfed bacteria, the cytosol, the nucleus, and MROs (seven cells), ± standard error of the mean. (D) Representative whole cell fixed for immunogold staining; scale bar, 500 nm; this image has been cropped in order to show only the whole cell from which the insets shown were derived. (E, F) Magnified sections from the cell pictured in (A), showing gold particles corresponding to anti-Mastigamoeba [FeFe]-hydrogenase localization; scale bar, 500 nm. (G) Mean density of immunogold labeling in engulfed bacteria, the cytosol, the nucleus, and MROs (13 cells), ± standard error of the mean. Brightness and contrast have been adjusted in each image to enhance visibility of the mitochondria and gold particles.
Evolutionary Origins of ATP Generation Enzymes
Eukaryote monophyly is recovered in phylogenies of PFO homologs, and in trees of all of the [FeFe]-hydrogenase maturases (fig. 4, supplementary figs. S2–S5, Supplementary Material online). Several major clades of [FeFe]-hydrogenases are recovered (fig. 5, supplementary figs. S6 and S7, Supplementary Material online), one of which is a long-branched clade that includes bacterial H2-evolving periplasmic [FeFe]-hydrogenases (Vignais and Billoud 2007), as well as homologs from Mastigamoeba, Entamoeba, and Trimastix. Monophyly of all eukaryotic hydrogenases, both periplasmic-like and nonperiplasmic-like, was rejected in AU tests (table 1) (Hug et al. 2010; Leger et al. 2013). However, as in previous studies, monophyly of nonperiplasmic [FeFe]-hydrogenases of eukaryotes was not rejected (table 1, supplementary figs. S6 and S7, Supplementary Material online) (Leger et al. 2013). The origins of these anaerobic energy enzymes remain unclear, as there is no clear prokaryotic sister clade to any of these groups. In contrast to previous studies, monophyly of alphaproteobacteria and eukaryotes was not rejected. Nevertheless, the best constrained trees generated by RAxML for these hypotheses placed alphaproteobacteria branching from within eukaryotes (data not shown), and the reverse hypothesis was rejected in most cases. As in previous studies (Hug et al. 2010; Leger et al. 2013), the hypothetical grouping of alphaproteobacteria with eukaryotes was clearly rejected for PFO, whether sulfite reductases were included in the analyses or not.
Fig. 4.
Unrooted ML tree of PFO sequences. Phylogenetic analyses were performed on 212 sequences and 958 sites, using RAxML v.8.0.23 under the PROTGAMMALG4X model of amino acid substitution, and IQ-TREE v.1.3.11 under the C20+Gamma model of evolution. Bootstrap support values >50% (first number), and ultrafast bootstrap values >95% (second number), are shown next to relevant branches; both support values are shown even where only one is greater than the chosen cutoff. Branches with 100% bootstrap and ultrafast bootstrap support are indicated by black circles. Eukaryotes are shaded blue, and alphaproteobacteria magenta. Eukaryotic PFO and PNO sequences are indicated. For ultrafast bootstrap values, 95 was chosen as a cutoff value as per the recommendation of the IQ-TREE manual; for the ML tree under the C20+gamma model found using IQ-TREE, with full ultrafast bootstrap support values, see supplementary figs. S12–S24, Supplementary Material online.
Fig. 5.
Unrooted ML tree of nonperiplasmic-like [FeFe]-hydrogenase sequences. Phylogenetic analyses were performed on 238 sequences and 346 sites, using RAxML and IQ-TREE. Bootstrap and ultrafast bootstrap values are indicated as in figure 4. Eukaryotes are shaded blue, and alphaproteobacteria magenta. [FeFe]-hydrogenases with C-terminal CysJ or flavodoxin (FLD) domains are indicated.
Table 1.
Approximately Unbiased Tests of Alternate Topologies.
Hypothesis tested
AU test P-value
[FeFe]-hydrogenase and NARF-like (NARFL) proteins
ML tree under the LG4X+Gamma model
0.744
ML tree under the C20+Gamma model
1e−09b
Monophyly of eukaryotic hydrogenases and NARFL proteins; Thalassiosira and Nyctotherus unconstrained
2e−10b
Monophyly of eukaryotic hydrogenases; NARFL proteins unconstrained; Thalassiosira and Nyctotherus unconstrained
0.001b
Monophyly of eukaryotic non-periplasmic-like hydrogenases; eukaryotic periplasmic-like hydrogenases and NARFL proteins unconstrained; Thalassiosira and Nyctotherus unconstrained
0.504
Monophyly of eukaryotic non-periplasmic-like hydrogenases and Clade 1 and 2 alphaproteobacteria; eukaryotic periplasmic-like hydrogenases and NARFL proteins unconstrained; all other alphaproteobacteria unconstrained; Thalassiosira and Nyctotherus unconstrained
0.266
Monophyly of eukaryotic non-periplasmic-like hydrogenases, and Clade 1 alphaproteobacteria basal to eukaryotic non-periplasmic-like hydrogenases; eukaryotic periplasmic-like hydrogenases and NARFL proteins unconstrained; all other alphaproteobacteria unconstrained; Thalassiosira and Nyctotherus unconstrained
0.459
[FeFe]-hydrogenase
ML tree under the LG4X+Gamma model
0.704
ML tree under the C20+Gamma model
5e−08b
Monophyly of eukaryotic hydrogenases; Thalassiosira and Nyctotherus unconstrained
0.002b
Monophyly of eukaryotic non-periplasmic-like hydrogenases; Thalassiosira and Nyctotherus and periplasmic hydrogenases unconstrained
0.555
Monophyly of eukaryotic non-periplasmic-like hydrogenases and Clade 1 and 2 alphaproteobacteria; Thalassiosira and Nyctotherus unconstrained; eukaryotic periplasmic hydrogenases unconstrained; all other alphaproteobacteria unconstrained
0.042a
Clade 1 alphaproteobacteria basal to eukaryotic non-periplasmic-like hydrogenases; Thalassiosira and Nyctotherus unconstrained; Clade 2 eukaryotes unconstrained; all other alphaproteobacteria unconstrained
0.504
[FeFe]-hydrogenase (non-periplasmic-like)
ML tree under the LG4X+Gamma model
0.680
ML tree under the C20+Gamma model
0.016a
Eukaryote monophyly; Thalassiosira unconstrained
0.627
Monophyly of eukaryotes and Clade 1 and 2 alphaproteobacteria; Thalassiosira and Nyctotherus unconstrained; all other alphaproteobacteria unconstrained
0.406
Clade 1 alphaproteobacteria basal to eukaryotes; Thalassiosira and Nyctotherus unconstrained; all other alphaproteobacteria unconstrained
0.576
Clade 2 alphaproteobacteria basal to eukaryotes; Thalassiosira and Nyctotherus unconstrained; all other alphaproteobacteria unconstrained
0.362
PFO
ML tree under the LG4X+Gamma model
1.000
ML tree under the C20+Gamma model
0.057
Monophyly of eukaryotes and alphaproteobacteria
1e−05b
Alphaproteobacteria basal to eukaryotes
1e−05b
PFO+sulfite reductase
ML tree under the LG4X+Gamma model
0.999
ML tree under the C20+Gamma model
0.003b
Monophyly of eukaryotes and alphaproteobacteria
0.013a
Alphaproteobacteria basal to eukaryotes
0.035a
ASCT1B
ML tree under the LG4X+Gamma model
0.734
ML tree under the C20+Gamma model
0.036a
Eukaryote monophyly
1e−33b
Monophyly of Clade 1 eukaryotes and Clade 2 eukaryotes; other eukaryotes unconstrained
0.716
Monophyly of Clade 1, 2 and 3 eukaryotes; other eukaryotes unconstrained
0.601
Monophyly of Clade 2 and Clade 3 eukaryotes; other eukaryotes unconstrained
0.549
Monophyly of Clade 2 and Clade 4 eukaryotes; other eukaryotes unconstrained
8e−07b
Monophyly of Clade 1, 2 and 4 eukaryotes; other eukaryotes unconstrained
7e−06b
Monophyly of Clade 1 eukaryotes and alphaproteobacteria; other eukaryotes unconstrained
0.548
Monophyly of Clade 2 eukaryotes and alphaproteobacteria; other eukaryotes unconstrained
0.525
Flavodiiron protein
ML tree under the LG4X+Gamma model
0.702
ML tree under the C20+Gamma model
1e−06b
T.vaginalis sequence 2 constrained with Mastigamoeba, Entamoeba, Sawyeria and Stygiella
0.521
Eukaryote monophyly; T.vaginalis 2 unconstrained
0.001b
aRejected with P-value <0.05.
bRejected with P-value <0.01.
Unrooted ML tree of PFO sequences. Phylogenetic analyses were performed on 212 sequences and 958 sites, using RAxML v.8.0.23 under the PROTGAMMALG4X model of amino acid substitution, and IQ-TREE v.1.3.11 under the C20+Gamma model of evolution. Bootstrap support values >50% (first number), and ultrafast bootstrap values >95% (second number), are shown next to relevant branches; both support values are shown even where only one is greater than the chosen cutoff. Branches with 100% bootstrap and ultrafast bootstrap support are indicated by black circles. Eukaryotes are shaded blue, and alphaproteobacteria magenta. Eukaryotic PFO and PNO sequences are indicated. For ultrafast bootstrap values, 95 was chosen as a cutoff value as per the recommendation of the IQ-TREE manual; for the ML tree under the C20+gamma model found using IQ-TREE, with full ultrafast bootstrap support values, see supplementary figs. S12–S24, Supplementary Material online.Unrooted ML tree of nonperiplasmic-like [FeFe]-hydrogenase sequences. Phylogenetic analyses were performed on 238 sequences and 346 sites, using RAxML and IQ-TREE. Bootstrap and ultrafast bootstrap values are indicated as in figure 4. Eukaryotes are shaded blue, and alphaproteobacteria magenta. [FeFe]-hydrogenases with C-terminal CysJ or flavodoxin (FLD) domains are indicated.The overall lack of resolution in these trees, and the lack of a clear prokaryotic sister group to eukaryotes that could point to these enzymes being either of mitochondrial origin, or laterally transferred from a specific prokaryotic group, is unfortunately typical of anaerobic energy generation enzyme phylogenies (Horner et al. 2000, 2002; Hug et al. 2010; Stairs et al. 2014). The prevalence of these enzymes among eukaryotes, and eukaryotic monophyly in some phylogenies, has been cited as evidence for their presence in the original mitochondrial endosymbiont (Horner et al. 1999, 2000, 2002; Müller et al. 2012). The suggestion of nonperiplasmic [FeFe]-hydrogenase eukaryotic monophyly, and the fact that alphaproteobacteria + eukaryote monophyly cannot be rejected for nonperiplasmic [FeFe]-hydrogenases, could be argued to be further evidence for this hypothesis. While these findings should not be ignored, they should, however, be treated with caution. If the monophyly of eukaryotes in anaerobic energy generation enzyme phylogenies were indeed a result of their presence in the protomitochondrial endosymbiont, then this must be weighed against the relative scarcity of [FeFe]-hydrogenases in alphaproteobacteria; the extreme scarcity of the three [FeFe]-hydrogenase maturases in the same group; and the rejection of an alphaproteobacterial affinity for PFO. Ancestral presence of modern anaerobic energy generation enzymes in the protomitochondrial endosymbiont requires massive loss from, or replacement of, these enzymes in alphaproteobacteria; or lateral transfer of at least some of them into the lineage giving rise to the endosymbiont shortly before the endosymbiotic event; and, certainly, large-scale subsequent loss in diverse eukaryote lineages. An alternative explanation involves lateral transfer of these genes between anaerobic eukaryotes, which presents an attractive explanation for an increasingly common pattern of genes shared only between anaerobic eukaryotes (Andersson et al. 2003, 2006; Stairset al. 2011, 2014; Tsaousis, Ollagnier de Choudens, et al. 2012). It should be noted that the latter hypothesis does not exclude the possibility of anaerobic energy generation enzymes originally being present in the protomitochondrial endosymbiont, but suggests that, if they were originally present, they have since been lost or replaced in extant eukaryotes (Tsaousis, Leger, et al. 2012).In either case, these analyses highlight the importance of two factors. The first is the utility of gathering more data, shown by the increase in the representation of both eukaryotic and alphaproteobacterial taxa in our trees relative to even recent studies (Hug et al. 2010; Leger et al. 2013; Stairs et al. 2014); improved taxonomic sampling in the future may significantly alter or strengthen the inferences that can be made from these phylogenies. The second is that the periplasmic hydrogenases (and their eukaryotic homologs), although they may be functionally equivalent to the nonperiplasmic hydrogenases, may not be orthologs, and that caution should be used when grouping them together in analyses, as has been done in the past (Hug et al. 2010). AU tests performed on groupings of alphaproteobacteria and eukaryotes, for instance, will likely generate spurious results if periplasmic and nonperiplasmic hydrogenases are treated as a single group, as these enzymes may have quite different origins in eukaryotes.
Iron–Sulfur Cluster Assembly
Iron–sulfur (Fe–S) cluster biosynthesis is known to be the only truly essential function of yeast mitochondria (Lill et al. 1999). The mitochondrial ISC Fe–S cluster assembly pathway is a crucial and conserved function of most MROs described to date (LaGier et al. 2003); it has been suggested that the need to provide an environment for this process explains the retention of the most reduced MROs (Embley et al. 2003; Tovar et al. 2003). Nevertheless, several examples of MROs are known in which the mitochondrial ISC system has been replaced by bacterial NIF systems [Entamoeba histolytica (Ali et al. 2004; van der Giezenet al. 2004; Maralikova et al. 2010), M.
balamuthi (Gill et al. 2007; Nyvltova et al. 2013)] or a SUF system [P.
biforma (Stairs et al. 2014)].The main components of the Fe–S cluster assembly pathway were identified in the transcriptomic survey of S. incarcerata (fig. 2, brown). Most notable are IscS, a cysteine desulfurase that generates sulfur destined for cluster assembly and the scaffold proteins IscU, IscA1 and IscA2 (Lill et al. 2012). Accessory proteins found include the mitochondrial transporter Atm1, as well as the irondonorfrataxin, and ferredoxin Yah1, which maintain a redox balance, completing the complement of Fe–S assembly proteins (for the complete set of proteins found in this pathway, see supplementary table S3, Supplementary Material online). We confirmed the localization of this typical mitochondrial pathway to the putative MROs using immunogold labeling (fig. 3), using a heterologous polyclonal primary antibody raised in rabbit against Giardia IscS (Tovar et al. 2003) and a secondary antibody conjugated to gold particles. As expected, we found a greater (16-fold higher) density of gold particles in the MROs compared with the cytosol; the antibody also cross-reacted with engulfed bacteria, consistent with the presence of IscS homologs in bacteria.
Protein Transport and Folding
Major components of the mitochondrial protein import machinery were represented in the transcriptome data (fig. 6). These include the Translocase of the Outer Membrane (TOM), the Translocase of the Inner Membrane 22 (TIM22), the Translocase of the Inner Membrane 23 (TIM23), and the Sorting and Assembly Machinery (SAM) complexes, as well as the ER-mitochondria encounter structure (ERMES). Several accessory subunits of these complexes that are present in Saccharomyces cerevisiae were not recovered, including components of the TOM and TIM22 complexes, and the Inner Membrane Proteases (Imp1/2). Less surprisingly, the mitochondrial oxidase assembly protein Oxa1 is also absent; this protein mediates the membrane insertion of mitochondrially encoded Cox1p and Cox3p (Hell et al. 2001), neither of which are found in S. incarcerata. All of these import proteins are also absent from T. vaginalis (Carlton et al. 2007). However, S. incarcerata has retained a larger mitochondrial protein import complement relative to T. vaginalis, including the intermembrane space chaperone proteins known as Tiny Tims—Tim8, Tim9, Tim10, and Tim13, as well as the mitochondrial intermembrane space import and assembly (MIA) protein Mia40 (fig. 6).
Fig. 6.
Mitochondrial protein import proteins in various taxa. Dark blue: free-living mitochondrion; pale blue: free-living MRO; dark pink: parasite, mitochondrion; light pink, parasite, MRO; purple: facultative parasite, mitochondrion; dark grey: bacterium; pale grey: incomplete data. Data from Neupert (1997), Hoogenraad et al. (2002), Henriquez et al. (2005), Regoes et al. (2005), van der Laan et al. (2005); Williams and Keeling (2005), Dolezal et al. (2006), Figueroa-Martinez et al. (2008), Atteia et al. (2009), Dagley et al. (2009), Waller et al. (2009), Barberà et al. (2010), Dolezal et al. (2010), Jedelsky et al. (2011), Liu et al. (2011), Schneider et al. (2011), Eckers et al. (2012), Pusnik et al. (2012), Basu et al. (2013), Heinz and Lithgow (2013), Jerlstrom-Hultqvist et al. (2013), Wideman et al. (2013), Zubacova et al. (2013), Gawryluk et al. (2014), Murcha, Kmiec, et al. 2014; Murcha, Wang, et al. 2014; Stairs et al. (2014), Martincova et al. (2015), Murcha et al. (2015), Noguchi et al. (2015), Wojtkowska et al. (2015), and Buczek et al. (2016) this study. 1Transcriptome data, incomplete, particularly in the cases of S. marylandensis and Paratrimastix pyriformis; 2pATOM36; 3Tom9; 4pATOM; 5Metaxin 6Tim8/13; 7Tim17/22/23. For accession numbers and additional proteins, see supplementary table S4, Supplementary Material online.
Mitochondrial protein import proteins in various taxa. Dark blue: free-living mitochondrion; pale blue: free-living MRO; dark pink: parasite, mitochondrion; light pink, parasite, MRO; purple: facultative parasite, mitochondrion; dark grey: bacterium; pale grey: incomplete data. Data from Neupert (1997), Hoogenraad et al. (2002), Henriquez et al. (2005), Regoes et al. (2005), van der Laan et al. (2005); Williams and Keeling (2005), Dolezal et al. (2006), Figueroa-Martinez et al. (2008), Atteia et al. (2009), Dagley et al. (2009), Waller et al. (2009), Barberà et al. (2010), Dolezal et al. (2010), Jedelsky et al. (2011), Liu et al. (2011), Schneider et al. (2011), Eckers et al. (2012), Pusnik et al. (2012), Basu et al. (2013), Heinz and Lithgow (2013), Jerlstrom-Hultqvist et al. (2013), Wideman et al. (2013), Zubacova et al. (2013), Gawryluk et al. (2014), Murcha, Kmiec, et al. 2014; Murcha, Wang, et al. 2014; Stairs et al. (2014), Martincova et al. (2015), Murcha et al. (2015), Noguchi et al. (2015), Wojtkowska et al. (2015), and Buczek et al. (2016) this study. 1Transcriptome data, incomplete, particularly in the cases of S. marylandensis and Paratrimastix pyriformis; 2pATOM36; 3Tom9; 4pATOM; 5Metaxin 6Tim8/13; 7Tim17/22/23. For accession numbers and additional proteins, see supplementary table S4, Supplementary Material online.Many of the matrix proteins involved in folding the imported proteins are present (fig. 2, yellow, fig. 6). They include mtHsp70 and Cpn60, which are typical mitochondrial markers involved in protein transport and refolding, and both the α and β-subunits of the MPP, the enzyme that cleaves N-terminal targeting peptides after protein import into the organellar matrix.As the majority of the proteins involved in protein import are highly divergent between taxa, S. incarcerata homologs of some proteins may simply not have been retrieved by our methods. However, mitochondrial protein import has been poorly studied in eukaryotes other than yeast and mammals, and recent surveys that include data from more diverse taxa (Eckers et al. 2012; Heinz and Lithgow 2013; Gawryluk et al. 2014; Stairs et al. 2014) suggest that the apparently ‘reduced’ complement found in S. incarcerata may in fact be more representative of eukaryotes overall. Despite uncertainly arising from the incomplete nature of transcriptome data, particularly in Sawyeria (Barberà et al. 2010) and Psalteriomonas (de Graaf et al. 2009), a contrast is apparent between the apparently smaller number of protein import machinery components in MROs of parasites such as diplomonads, Entamoeba and microsporidia (Dagley et al. 2009; Waller et al. 2009; Dolezal et al. 2010; Jedelsky et al. 2011; Schneider et al. 2011; Jerlstrom-Hultqvist et al. 2013), and the apparently more complex protein import machinery of typical mitochondria (fig. 6). This difference may reflect an overall reduction in the protein import machinery in parasites, or a more divergent complement of proteins that are not readily identified using methods based on sequence data from model organisms (Makiuchi et al. 2013; Martincova et al. 2015). As with the free-living organisms Pygsuia (Stairs et al. 2014) and the stramenopile C.
marsupialis (Noguchi et al. 2015), the protein import machinery of S. incarcerata more closely resembles that of typical mitochondria. While more genomic data from organisms with MROs are needed to confirm it, this trend suggests that a more reduced or poorly conserved MRO protein import apparatus reflects a parasitic lifestyle, rather than necessarily accompanying the derivation of MROs from aerobic mitochondria.The only other jakobid in which the mitochondrial protein import apparatus has been studied in some detail is Reclinomonas americana. This organism is notable in that, in addition to components of the canonical mitochondrial protein import pathway, it includes subunits of the bacterial SecY and twin-arginine transport complexes, which are involved in protein insertion into and secretion across the inner membrane (Tong et al. 2011). Subsequently, these proteins have been found to be mitochondrially encoded in other jakobids, including the sister-taxon to S. incarcerata, A.
godoyi (Burger et al. 2013), and in the discobid Tsukubamonas globosa (Kamikawa et al. 2014). No nuclear-encoded homologs of these components have so far been found in eukaryotes, and it appears that they were lost from S. incarcerata along with the mitochondrial genome.
Amino Acid Metabolism
Genes encoding all components of the glycine cleavage system were identified from the transcripts, including the L, P, T, and H proteins and serine hydroxymethyl transferase (SHMT) (fig. 2, blue; fig. 7). Targeting peptides have been identified for all of these proteins, providing evidence that this pathway is active within the organellar compartment. Whereas only partial glycine cleavage systems are present in the MROs of the parasites T.
vaginalis (Schneider et al. 2011) and S.
salmonicida (Jerlstrom-Hultqvist et al. 2013), a complete glycine cleavage system is predicted to function in the MROs of Trimastix pyriformis (Zubacova et al. 2013), M.
balamuthi (Nyvltova et al. 2015), and P.
biforma (Stairs et al. 2014). The presence of a glycine cleavage system seems to be the rule, rather than the exception, in the MROs of free-living anaerobes.
Fig. 7.
Amino acid metabolism in MROs. 1Source: (Jedelsky et al. 2011). 2Source: (Jerlstrom-Hultqvist et al. 2013). 3Source: (Schneider et al. 2011). 4Source: (Stairs et al. 2014). 5Source: (Noguchi et al. 2015). 6Protein described in the literature as Glycine Cleavage System H protein-like, but which is not a reciprocal best BLAST hit to other eukaryotic H proteins. +: Predicted to be present in the MRO based on proteomic data or bioinformatic predictions. +? Incomplete sequence at the N-terminus, making localization prediction uncertain. Orange, FeS cluster assembly; Bright yellow, glycine cleavage system; pale yellow, glycine, serine and threonine metabolism; pink, alanine metabolism; brown, tyrosine metabolism; pale blue, lysine and tryptophan metabolism; green, arginine metabolism; purple, glutamate and proline metabolism; dark blue, leucine, isoleucine and valine (branched-chain amino acid) metabolism. For accession numbers, see supplementary table S5, Supplementary Material online.
Amino acid metabolism in MROs. 1Source: (Jedelsky et al. 2011). 2Source: (Jerlstrom-Hultqvist et al. 2013). 3Source: (Schneider et al. 2011). 4Source: (Stairs et al. 2014). 5Source: (Noguchi et al. 2015). 6Protein described in the literature as Glycine Cleavage System H protein-like, but which is not a reciprocal best BLAST hit to other eukaryotic H proteins. +: Predicted to be present in the MRO based on proteomic data or bioinformatic predictions. +? Incomplete sequence at the N-terminus, making localization prediction uncertain. Orange, FeS cluster assembly; Bright yellow, glycine cleavage system; pale yellow, glycine, serine and threonine metabolism; pink, alanine metabolism; brown, tyrosine metabolism; pale blue, lysine and tryptophan metabolism; green, arginine metabolism; purple, glutamate and proline metabolism; dark blue, leucine, isoleucine and valine (branched-chain amino acid) metabolism. For accession numbers, see supplementary table S5, Supplementary Material online.All of the key enzymes in the initial stages of branched-chain amino acid degradation, as well as most downstream enzymes for the further breakdown of leucine, isoleucine, and valine were identified in S. incarcerata (fig. 2, blue), and have predicted targeting peptides. While enzymes carrying out the early steps of branched-chain amino acid degradation have been described in the T. vaginalis genome (Carlton et al. 2007), this pathway is not hypothesized to be present in the hydrogenosome (Carlton et al. 2007; Schneider et al. 2011), despite their mitochondrial localization being typical in aerobic organisms.In addition to these proteins, we identified enzymes involved in alanine, arginine, glutamate, lysine, tryptophan, methionine, and tyrosine metabolism (fig. 7). These are largely absent from the reduced amino acid metabolism complement of Trichomonas MROs (Schneider et al. 2011) (and completely absent from the much more reduced proteomes of Giardia and Entamoeba MROs; Mi-ichi et al. 2009; Jedelsky et al. 2011). A number of these enzymes, including branched-chain amino acid degradation enzymes, are also present in the predicted MRO proteomes of Pygsuia (Stairs et al. 2014) and Cantina (Noguchi et al. 2015). This is consistent with the hypothesis that the MROs of free-living organisms retain more mitochondrial metabolic functions than those of parasites (Stairs et al. 2015). Nevertheless, S. incarcerata MROs possess a larger predicted complement of amino acid metabolic enzymes than Pygsuia MROs, notably those involved in valine, isoleucine and leucine degradation, and in glutamate metabolism (fig. 7). In some cases (e.g., tryptophanase, branched-chain amino acid aminotransferase, glutamate dehydrogenase, cysteine synthase), the genomes of Spironucleus, Giardia, and Trichomonas are known to encode amino acid metabolism enzymes homologous to those of prokaryotes, that are predicted to be active in the cytosol rather than in MROs, and that are predicted to have been acquired by lateral gene transfer (Andersson and Roger 2003; Andersson et al. 2003; Alsmark et al. 2013) (although most of these are not present in the detected or predicted MRO proteome of Stygiella; fig. 7). This suggests that the reduced MRO proteome of parasitic organisms may partly result from acquisition of homologs from prokaryotes and overall gene loss (a pattern commonly observed in parasites of animals; Leckenby and Hall 2015), rather than simple retargeting of ancestrally mitochondrial proteins to the cytosol.
Other Functions and Pathways
As previously reported (Leger et al. 2015), the S. incarcerata transcriptome encodes two homologs of the bacterial and mitochondrial division protein FtsZ, and homologs of three proteins, MinC, MinD and MinE, that, in bacteria, control the placement of FtsZ (Leger et al. 2015).The phospholipid cardiolipin is a key component of both prokaryotic and mitochondrial inner membranes; in aerobic eukaryotes, it is synthesized in mitochondria. Cardiolipin synthesis proteins were until recently believed to be absent from MRO-bearing protists (Tian et al. 2012), but a bioinformatic survey of the PygsuiaMRO proteome uncovered the first evidence of a complete cardiolipin biosynthesis pathway in an MRO (Stairs et al. 2014). Our survey uncovered two enzymes in this pathway, a eukaryotic transferase-type cardiolipin synthesis and the CDP-diacylglycerol synthase Tam41 (Tamura et al. 2013). We found no evidence of phosphatidylglycerol phosphate (PGP) synthase or PGP phosphatase, which are involved in phosphatidylglycerol formation from CDP-diacylglycerol. In the absence of these enzymes, phosphatidylglycerol might be taken up from bacterial food sources; alternatively, homologs of these proteins present in S. incarcerata might simply not have been recovered in our transcriptome survey.Recently, a novel, fused SufCB enzyme was identified in Blastocystis sp.—the first evidence for a Suf system enzyme in a eukaryote. While the ISC system is present in the MROs of Blastocystis sp., SufCB was expressed in the cytosol (Tsaousis, Ollagnier de Choudens, et al. 2012). Homologs of this enzyme were subsequently found to be encoded in the transcriptome of the anaerobic breviate P.
biforma, which possesses both an MRO-targeted and a cytosolic copy (Stairs et al. 2014). Based on phylogenetic studies, the enzyme was hypothesized to have been laterally acquired from an archaeon related to the Methanomicrobiales, and subsequently transferred laterally from one eukaryote to the other (Tsaousis, Ollagnier de Choudens, et al. 2012; Stairs et al. 2014). We recovered a sequence encoding a homolog of this enzyme from our transcriptome data. The S. incarcerata enzyme displays the same fusion of the prokaryotic SufC and SufB proteins as those found in Blastocystis sp. and P. biforma; the enzyme lacks a targeting peptide, suggesting that it is cytosolic (supplementary table S3, Supplementary Material online). The genomic sequence of the enzyme that we amplified from S. incarcerata cultures does not include introns; however, it is also present in transcriptome data derived from the closely related jakobid Velundella trypanoides (Panek T and Cepicka I, personal communication), suggesting that it is not a prokaryotic contaminant. Because the fusion protein has only been identified in Blastocystis, Pygsuia, and S. incarcerata, we initially performed separate phylogenetic analyses of SufC and SufB in prokaryotes and eukaryotes (supplementary figs. S8 and S9, Supplementary Material online). The two analyses recovered broadly congruent results. We then performed analyses using concatenated SufC and SufB. In all three analyses, the three eukaryotes formed a well-supported clade, with Methanomicrobiales as a well-supported sister group (fig. 8, supplementary figs. S8 and S9, Supplementary Material online). Together with the fact that the fusion protein is found only in a small number of distantly-related eukaryotes (a stramenopile, an obazoan, and an excavate), this result is in line with those of previous studies positing an initial transfer from an archaeal source into a microbial eukaryote, followed by lateral transfer to other eukaryotes. In Blastocystis, SufCB is upregulated under oxygen stress, and it has been speculated that the enzyme provides a mechanism for the repair of oxygen-sensitive FeS proteins on exposure to oxygen (Tsaousis, Ollagnier de Choudens, et al. 2012). Because Stygiella, like Blastocystis and Pygsuia, inhabits anoxic environments, it seems likely that its SufCB has a similar function.
Fig. 8.
Unrooted ML tree of concatenated SufC and SufB sequences. Phylogenetic analyses were performed on 63 sequences and 547 sites, using RAxML and IQ-TREE. Bootstrap and ultrafast bootstrap values are indicated as in figure 4. Eukaryotes are shaded in blue.
Unrooted ML tree of concatenated SufC and SufB sequences. Phylogenetic analyses were performed on 63 sequences and 547 sites, using RAxML and IQ-TREE. Bootstrap and ultrafast bootstrap values are indicated as in figure 4. Eukaryotes are shaded in blue.Like MROs of Trichomonas (Schneider et al. 2011), Pygsuia (Stairs et al. 2014), and Cantina (Noguchi et al. 2015), but unlike those of Giardia (Brown et al. 1995), S. incarcerata organelles have retained mitochondrial reactiveoxygen stress response proteins (superoxide dismutase, thioredoxin, and thioredoxin peroxidase; fig. 2). In addition, S. incarcerata possesses homologs of a flavodiiron protein commonly found in anaerobic prokaryotes, as well as some anaerobic protists (Andersson et al. 2003); previously described in Giardia and Trichomonas as having a high affinity for O2, this enzyme has been hypothesized to be involved in oxygen detoxification in eukaryotes (Di Matteo et al. 2008; Smutna et al. 2009; Vicente et al. 2009; Vicente et al. 2012). S. incarcerata possesses two paralogs of this protein that differ in their predicted localization and phylogenetic affinities. The first is predicted to be cytosolic, and groups together with Entamoeba, Mastigamoeba, and Sawyeria homologs. The second possesses a predicted mitochondrial targeting peptide, and forms a clade with Pygsuia, Breviata, Giardia, Trichomonas, and Spironucleus. Consistent with earlier results suggesting at least two eukaryotic acquisitions from prokaryotes (Andersson et al. 2003, 2006), AU tests reject the hypothesis of eukaryote monophyly for thisflavodiiron protein (P-value <0.01) (table 1; supplementary fig. 10, Supplementary Material online). Lateral transfer of the protein between eukaryotes likely followed the initial acquisitions; it is particularly striking that S. incarcerata has acquired paralogs from two distinct sources. Interestingly, the MRO-targeted S. incarcerata protein is a fusion protein, possessing a C-terminal ferredoxin domain. This arrangement, which was confirmed by PCR amplification, appears to be unique to S. incarcerata. Flavodiiron proteins typically accept electrons from rubredoxins (which in turn accept electrons from NADH via a flavoprotein) (Di Matteo et al. 2008; Leger et al. 2015). Rubredoxins do not appear to be present in S. incarcerata’s MRO; the fused ferredoxin likely fulfills this role for the S. incarcerata organellar flavodiiron protein.
Conclusions
The availability of low-cost, high-coverage sequencing in recent years is making it possible to predict the proteomes of mitochondria and their related organelles on a much broader taxonomic and biochemical scale than was previously feasible. It is now possible to investigate the true diversity and flexibility of these organelles, rather than focusing mainly on energy generating functions in a limited number of taxa, as done previously. The examination of MROs in free-living anaerobes and microaerophiles is allowing us to separate adaptations to anoxia from byproducts of a parasitic lifestyle. The presence of a hydrogenosome-like organelle in a lineage closely related to organisms recognized for the unusual, primitive features of their mitochondria presents a particularly interesting opportunity. The complete absence of aerobic energy generation machinery and mitochondrial genome-encoded genes highlights the dramatic changes that can rapidly occur in the course of MRO derivation. Because Stygiellidae emerge from within jakobids, which possess classical mitochondria with genomes and electron transport chains, this absence provides evidence of the independent origins of MROs in S. incarcerata.A comparison of the MROs of S. incarcerata with those of other free-living and parasitic taxa reveals significant similarities as well as differences. Like the well-characterized MROs of Trichomonas, S. incarcerata MROs house an oxygen scavenging system for maintaining an anaerobic environment, and a anaerobic ATP generation pathway involving PFO, [FeFe]-hydrogenase, [FeFe]-hydrogenase maturases, two Complex I subunits and ASCT, but lack additional electron transport chain complexes or subunits; the differences in ASCT subtypes between the two organisms suggest either some degree of convergent adaptation, or differential loss from a common ancestor possessing both subtypes 1B and 1C. A leitmotif in S. incarcerata and other anaerobic eukaryotes (Andersson et al. 2006, 2009; Stairset al. 2011, 2014) is the presence of enzymes shared with a highly restricted number of other eukaryotes with a similar lifestyle (and complete absence from the majority of eukaryotic genomes), that form small eukaryotic clades in trees (e.g., flavodiiron proteins, SufCB, squalene-tetrahymanol cyclase; Takishita et al. 2012). In light of the vast diversity of eukaryotes that have been sampled in recent years, and that still remain to be sampled, we cannot exclude the possibility that these enzymes were present in a distant common ancestor of these disparate eukaryotic anaerobes. Nevertheless, the parsimonious explanation is that this pattern, which is found in both MRO and cytosolic proteins, points to inter-eukaryote LGT as a mechanism that enables lineages to rapidly adapt to new habitats.However, in its complement of typical mitochondrial enzymes, such as those involved in amino acid catabolism, cardiolipin synthesis and mitochondrial protein import, the MROs of S. incarcerata more closely resemble those of much more distantly related, free-living organisms, namely the breviate P.
biforma and the stramenopile C.
marsupialis. These similarities may result from a shorter amount of time elapsed since the process of MRO emergence in these taxa relative to diplomonads, but more likely reflect their shared lifestyle as free-living anaerobes; parasites may have less need of these catabolic pathways, as they can derive more metabolites from the host.As a transcriptomic survey, this study is necessarily incomplete. Further examination of S. incarcerata’s genome, and, ultimately, direct characterization of the proteome, will clarify the role of this organelle within the cell, as well as its relationship to classical mitochondria. Such in-depth examinations will undoubtedly yield useful insights into the order and timing of protein and pathway loss in MROs. In coming years, it will be exciting to examine the mitochondrial proteomes of closely-related jakobids such as A.
godoyi in order to draw inferences about the origins of S. incarcerataMRO proteins, particularly those involved in anaerobic energy generation and oxygen detoxification.
Materials and Methods
Cell Culture
Stygiella
incarcerata MB1 had previously been isolated from Mahone Bay, Nova Scotia, Canada (Simpson et al. 2008). Cells were maintained at 21 °C in a medium composed of 50:50 Page’s modified Neff’s Amoeba Saline (AS; 2 mM Na2HPO4, 2 mM KH2PO4, 0.03 mM MgSO4⋅7H2O, 0.05 mM CaCl2⋅2H2O, 4.1 mM NaCl):Artificial seawater (ASW; 0.42 M NaCl, 9 mM KCl, 9.25 mM CaCl2⋅2H2O, 23 mM MgCl⋅6H2O, 25.5 mM MgSO4⋅7H2O, 2.14 mM NaHCO3) plus 3% Luria-Bertani (LB) broth (10 g tryptone, 5 g yeast extract, 10 g NaCl in 1 l). Cultures were maintained in 50 ml Falcon tubes filled to ∼45 ml.
Expressed Sequence Tag (EST) Library Creation
Total RNA was extracted from high-density cultures of S. incarcerata using TRIzol Reagent (Invitrogen) following the manufacturer’s instructions for cells grown in suspension. A 2-µg aliquot of high-quality total RNA was sent to Amplicon Express (Pullman, USA) for EST library creation. RNA underwent two rounds of poly-A selection, followed by reverse-transcription to complementary DNA (cDNA). cDNA reads were size-selected, and cloned into pBluescript II SK+.The completed EST library was sent to the National Research Council (NRC), Halifax location for Sanger sequencing. A total of 3,456 clones were sequenced and processed using Phred and Phrap (Ewing and Green 1998; Ewing et al. 1998).The library was then amplified, nebulized, and subjected to 454 GS-FLX Titanium pyrosequencing at the McGill University Genome Quebec Innovation Centre, producing 11,905 reads.A mixed Sanger/454 assembly was produced using Mira 2.9.39 (Chevreux et al. 1999) under default parameters with the following adjustments: job = de
novo,est,accurate,sanger,454.
Illumina RNASeq
In order to expand transcript coverage and numbers, total RNA was extracted from high-density cultures of S. incarcerata as described above, and sent to Macrogen (Seoul, Korea) for two rounds of poly-A selection, followed by Illumina HiSeq2000 paired-end sequencing. 63.4 million raw reads were produced, and assembled de novo using Trinity (r2011-07-13) (Grabherr et al. 2011). Contigs were compared with the existing Sanger/454 transcriptome to verify the accuracy of the transcripts. These transcripts were used in all subsequent analyses.
Identification and Analysis of Putative Organellar Protein Genes
A conservative set of sequences encoding possible MRO proteins was identified using CBOrg, a comparative tool for predicting MRO proteomes based on H.
sapiens, Sa.
cerevisiae, Tetrahymena thermophila, and T.
vaginalis proteomes (Gaston et al. 2009). The sequences in this set were re-examined using BLAST (Altschul et al. 1997) searches against the nonredundant nucleotide and protein databases in GenBank to confirm homology to known mitochondrial proteins of other eukaryotes, and to eliminate likely bacterial contaminants. Additionally, hidden Markov Model (HMM) searches were used to identify proteins involved in protein import and translocation, as these are often divergent. This was done using HMMER 3.0 (http://www.hmmer.org; last accessed 31 May 2016), with HMMs constructed from multiple sequence alignments of homologous sequences provided by Dr. Trevor Lithgow and aligned using MUSCLE v3.8.31 (Edgar 2004, 2010). Additional tBLASTn searches were made against the transcriptome using sequences from a dataset of 159 conserved eukaryotic proteins (Brown et al. 2013), and mitochondrially-encoded A. godoyi genes (Burger et al. 2013) (for tRNA gene queries, BLASTn searches were performed). The presence or absence of a full 5′ end of the gene was determined through translation of the sequence and identification of a putative initiator methionine and an in-frame stop codon upstream. BLAST homology was used to confirm the presence of a complete 5′ end compared to other known sequences for the gene in question.
In Silico Detection of N-Terminal Targeting Peptides
For sequences with a full 5′ end of the coding sequence, the translated protein sequence was screened for the presence of a potential N-terminal targeting peptide using the internet-based targeting peptide prediction programs TargetP (Emanuelsson et al. 2000, 2007) and Mitoprot (Claros 1995). Targeting peptides were designated as probable if organelle localization probability was above 50%, and if an N-terminal extension was present relative to the closest bacterial homologs.
Extension of Incomplete Genes and Intron Searching
Total RNA was extracted as described above. From a total RNA extract, messenger RNA (mRNA) was enriched using the Poly(A) Purist mRNA purification kit (Ambion Inc, TX). cDNA was generated from mRNA using the GeneRacer kit (Invitrogen Corp., USA). Total DNA was extracted by centrifuging high-density cultures, resuspending the pellets in extraction buffer (1 M Tris–HCl pH 7.5, 5 M NaCl, 0.5 M EDTA, 20% sodium dodecyl sulfate (SDS), incubating at 50°C for 10 min., and centrifuging for 10 min. at 10,000 × g. The resulting supernatant was subjected to two rounds of phenol:chloroform:isoamyl alcohol (25:24:1) (Fluka, Germany) extraction, followed by a third extraction in chloroform:isoamyl alcohol (24:1), and precipitation through addition of 1/10th volume 3 M sodium acetate and 6/10th volume of isopropanol Rapid Amplification of cDNA Ends PCR was used to obtain missing sequence data from MinC, which was not completely represented in the transcriptomic data, and standard PCR was used to obtain full-length sequence data from specific genes of interest to verify sequence information, or to search for introns in genomic DNA (for HydE, HydF, HydG, all [FeFe]-hydrogenases, all PFOs, ASCT1B, acyl-CoA synthetase, Grx5, SufCB, and ferredoxin-fused flavodiiron protein). Gene-specific primers for genes of interest were designed based on sequence information from the S. incarcerata transcriptome.
Routine Transmission Electron Microscopy (TEM)
Cells were fixed with 2.5% glutaraldehyde in 0.1 M sodium cacodylate buffer with 5% sucrose. Post-fixation was performed in 1% osmium tetroxide and 0.25% uranyl acetate. Samples underwent stepwise dehydration in acetone, before being embedded in Epon/Araldite resin. 100-nm sections were cut using an LKB Huxley ultramicrotome with a Diatome diamond knife, and placed on 300-mesh copper grids. Sections were stained in 2% aqueous uranyl acetate and lead citrate, viewed using a JEOL JEM 1230 Transmission Electron Microscope at 80 kV, and photographed using a Hamamatsu ORCA-HR digital camera.
Western Blotting
IscS, [FeFe]-hydrogenases predicted to localize to the MROs ([FeFe]-hydrogenase 1 and [FeFe]-hydrogenase 4), and the N-terminal [FeFe]-hydrogenase domain of the predicted cytosolic CysJ-fused [FeFe]-hydrogenases ([FeFe]-hydrogenase 2 and [FeFe]-hydrogenase 3) were amplified by PCR from S. incarcerata cDNA using primers with N-terminal restriction sites (NdeI and XhoI for IscS, and XhoI and BamHI for [FeFe]-hydrogenase 1). [FeFe]-hydrogenase 1, the N-terminal domains of [FeFe]-hydrogenase 2 and [FeFe]-hydrogenase 3, and IscS were cloned into pET-16b (Novagen) downstream of a 6×His tag. [FeFe]-hydrogenase 4 was cloned into pET-28a downstream of a 6×His tag. The constructs were expressed from Rosetta 2 (DE3) competent cells (Novagen). The recombinant protein was expressed in inclusion bodies, which were purified using BugBuster reagent (Novagen).Antibodies were tested against inclusion bodies from Rosetta 2 cells expressing recombinant S. incarcerata IscS or [FeFe]-hydrogenases from the pET-16b or pET-28a vectors, or the empty pET-16b vector and pET-28a vectors (as negative controls). The antibodies used were a polyclonal anti-Giardia IscS antibody (Tovar et al. 2003) kindly provided by Dr. Jan Tachezy (Charles University in Prague, Czech Republic), and a custom polyclonal anti-[FeFe]-hydrogenase antibody previously raised against a M.
balamuthi [FeFe]-hydrogenase peptide (CPFGAVMTRSFMLDVMRAMRDSRSAGSKVVAMVAPAVAGHMGNAPIWSICEALKRAGFDEALEVSIGADTTTENEAHEFEERFGEGAPKGKFSFMTTSCCPAYVACVRKHVPEIEDAVSHTRSPMHYTAKLAKERWPGCTTVFVGPCTAKLHEASIDEYTDFAITVVEALSLLRGRGVALDNSQ; Abgent). A monoclonal antibody raised against the polyhistidine tag (anti-His; Thermo Scientific) was used as a positive control (data not shown). Proteins were separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, blotted onto polyvinylidene difluoride membranes, and blocked overnight at 4°C in 5% milk. The blots were then incubated with primary antibody at a ratio of 1:500 (anti-IscS) or 1:250 (anti-[FeFe]-hydrogenase) in 1% milk for 1 h at room temperature, washed, and incubated with horseradish peroxidase-conjugated secondary anti-rabbit IgG antibodies (Sigma) at 1:50,000, for 1 h at room temp. The blots were then washed again, incubated with electrochemiluminescence western blotting reagents (Amersham), and photographed using a FluorChem E imaging system (Protein Simple).
Immuno-Electron Microscopy (Immuno-EM)
Cells were fixed in 4% paraformaldehyde and 0.5% glutaraldehyde in 0.1 sodium cacodylate buffer, rinsed in 0.1 M sodium cacodylate buffer, subjected to stepwise dehydration in ethanol, and embedded in LR White Resin. 100-nm sections were cut using an LKB Huxley ultramicrotome with a Diatome diamond knife, and placed on 200 mesh nickel grids. Sections were blocked in PBS containing 0.8% Bovine Serum Albumin and 0.01% Tween 20 for 30 min, then incubated with primary antibody (anti-Giardia IscS or anti- Mastigamoeba [FeFe]-hydrogenase, as above) diluted in blocking solution for 3 h at room temperature or overnight at 4°C. The grids were then washed for 10 min each of four times in blocking solution before incubation with gold-conjugated anti-rabbit (IscS) or anti-rat ([FeFe]-hydrogenase) secondary antibody (Sigma or Electron Microscopy Sciences) diluted 1:200 in blocking solution. Labeled sections underwent one 10-min wash in blocking solution, three 10-min washes in PBS, and two 30-s washes in dH2O. Following antibody labeling, grids were stained using 2% aqueous uranyl acetate and rinsed, stained with lead citrate, rinsed and air-dried. The sections were viewed using a JEOL JEM 1230 transmission electron microscope at 80 kV, and images were captured using a Hamamatsu ORCA-HR digital camera.The areas of the nucleus, mitochondria, and cytosol of each cell cross section were measured using ImageJ for 8 cells (IscS localization) or 13 cells ([FeFe]-hydrogenase localization), and the gold particles in each part of the cell were counted by eye.
Phylogenetic Analyses
For each protein, all known eukaryotic and bacterial homologs in NCBI were collected and then multiple alignments were generated using PROBCONS v.1.2 (Do et al. 2005) or MAFFT-L-INSI v7.149b (Katoh et al. 2002, 2005; Katoh and Standley 2013), and trimmed of ambiguously aligned sites with BMGE 1.1 (Criscuolo and Gribaldo 2010) (-m BLOSUM30, all other parameters default). In the case of PFO, paralogous PNO sequences were included in alignments. Preliminary phylogenies were generated using FastTree (Price et al. 2009), and datasets were manually curated. Twenty independent Maximum Likelihood (ML) tree estimates and 200 bootstrap replicates were generated using RAxML v.8.0.23 (Stamatakis 2014) under the PROTGAMMALG4X (Le et al. 2012) model of amino acid substitution. Additional ML analyses using the C20 + Gamma model were carried out using IQ-TREE v.1.3.11 (Nguyen et al. 2015), with 1,000 ultrafast bootstrap replicates (Minh et al. 2013) (note that the IQ-TREE manual recommends treating only ultrafast bootstrap support values only over 95 as robust support; for the ML tree under the C20 + gamma model found using IQ-TREE, with full ultrafast bootstrap support values, see supplementary figs. S12–S24, Supplementary Material online). We tested whether specific phylogenetic hypotheses were rejected by the data using the Approximately Unbiased test implemented in CONSEL v.1.20 (Shimodaira and Hasegawa 2001). ML trees given specific constraints (i.e., corresponding to specific hypotheses) were generated using RAxML. The 200 trees from bootstrap replicates were included in analyses (as required by CONSEL), as were the ML trees generated by both RAxML and IQ-TREE. Site likelihoods were calculated under either the LG4X + Gamma model in RAxML. PFO and [FeFe]-hydrogenase phylogenies were performed both including and excluding paralogs (sulfite reductases, and periplasmic [FeFe]-hydrogenases and NARF-like proteins, respectively).
Availability of Supporting Data
The datasets supporting the results of this article are available in the GenBank repository, Accession Numbers SRR2566811 (raw reads) and KT984512–KT984652 and KP258196-KP258200 (coding sequences reported in this manuscript).
Supplementary Material
Supplementary figures S1–S24 and tables S1–S5 are available at Molecular Biology and Evolution online (http://www.mbe.oxfordjournals.org/).
Authors: Shawn E McGlynn; Eric M Shepard; Mark A Winslow; Anatoli V Naumov; Kaitlin S Duschene; Matthew C Posewitz; William E Broderick; Joan B Broderick; John W Peters Journal: FEBS Lett Date: 2008-05-22 Impact factor: 4.124
Authors: Brendan Loftus; Iain Anderson; Rob Davies; U Cecilia M Alsmark; John Samuelson; Paolo Amedeo; Paola Roncaglia; Matt Berriman; Robert P Hirt; Barbara J Mann; Tomo Nozaki; Bernard Suh; Mihai Pop; Michael Duchene; John Ackers; Egbert Tannich; Matthias Leippe; Margit Hofer; Iris Bruchhaus; Ute Willhoeft; Alok Bhattacharya; Tracey Chillingworth; Carol Churcher; Zahra Hance; Barbara Harris; David Harris; Kay Jagels; Sharon Moule; Karen Mungall; Doug Ormond; Rob Squares; Sally Whitehead; Michael A Quail; Ester Rabbinowitsch; Halina Norbertczak; Claire Price; Zheng Wang; Nancy Guillén; Carol Gilchrist; Suzanne E Stroup; Sudha Bhattacharya; Anuradha Lohia; Peter G Foster; Thomas Sicheritz-Ponten; Christian Weber; Upinder Singh; Chandrama Mukherjee; Najib M El-Sayed; William A Petri; C Graham Clark; T Martin Embley; Bart Barrell; Claire M Fraser; Neil Hall Journal: Nature Date: 2005-02-24 Impact factor: 49.962
Authors: Aloysius G M Tielens; Koen W A van Grinsven; Katrin Henze; Jaap J van Hellemond; William Martin Journal: Int J Parasitol Date: 2010-01-18 Impact factor: 3.981
Authors: Chelsea L Murphy; Noha H Youssef; Radwa A Hanafy; M B Couger; Jason E Stajich; Yan Wang; Kristina Baker; Sumit S Dagar; Gareth W Griffith; Ibrahim F Farag; T M Callaghan; Mostafa S Elshahed Journal: Appl Environ Microbiol Date: 2019-07-18 Impact factor: 4.792
Authors: Jiwon Yang; Tommy Harding; Ryoma Kamikawa; Alastair G B Simpson; Andrew J Roger Journal: Genome Biol Evol Date: 2017-05-01 Impact factor: 3.416
Authors: Courtney W Stairs; Anna Kokla; Ásgeir Ástvaldsson; Jon Jerlström-Hultqvist; Staffan Svärd; Thijs J G Ettema Journal: BMC Biol Date: 2019-03-01 Impact factor: 7.431
Authors: Courtney W Stairs; Laura Eme; Sergio A Muñoz-Gómez; Alejandro Cohen; Graham Dellaire; Jennifer N Shepherd; James P Fawcett; Andrew J Roger Journal: Elife Date: 2018-04-26 Impact factor: 8.140