Literature DB >> 27181584

Potent neutralizing monoclonal antibodies against Ebola virus infection.

Qi Zhang1, Miao Gui2, Xuefeng Niu3, Shihua He4,5, Ruoke Wang1, Yupeng Feng6, Andrea Kroeker4,5, Yanan Zuo1, Hua Wang1, Ying Wang1, Jiade Li1, Chufang Li3, Yi Shi7, Xuanling Shi1, George F Gao7, Ye Xiang2, Xiangguo Qiu4,5, Ling Chen3,6, Linqi Zhang1.   

Abstract

Ebola virus infections cause a deadly hemorrhagic disease for which no vaccines or therapeutics has received regulatory approval. Here we show isolation of three (Q206, Q314 and Q411) neutralizing monoclonal antibodies (mAbs) against the surface glycoprotein (GP) of Ebola virus identified in West Africa in 2014 through sequential immunization of Chinese rhesus macaques and antigen-specific single B cell sorting. These mAbs demonstrated potent neutralizing activities against both pseudo and live Ebola virus independent of complement. Biochemical, single particle EM, and mutagenesis analysis suggested Q206 and Q411 recognized novel epitopes in the head while Q314 targeted the glycan cap in the GP1 subunit. Q206 and Q411 appeared to influence GP binding to its receptor NPC1. Treatment with these mAbs provided partial but significant protection against disease in a mouse model of Ebola virus infection. These novel mAbs could serve as promising candidates for prophylactic and therapeutic interventions against Ebola virus infection.

Entities:  

Mesh:

Substances:

Year:  2016        PMID: 27181584      PMCID: PMC4867612          DOI: 10.1038/srep25856

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Ebolavirus is the etiologic agent of lethal hemorrhagic fever in humans and nonhuman primates. Since its discovery in 1976, Ebolavirus has caused frequent outbreaks across Central Africa with exceedingly high mortality rate up to 90%12. While the natural host is currently unknown, Ebolavirus has been exploring more species as hosts across broader geographic frontiers345. Most notable was the unprecedented outbreak in West Africa in 2014 where the number of affected people has surpassed all the previously recorded cases combined1, raising the concerns about its pandemic potential and posing a serious threat to global health. Genetically, Ebolavirus isolated so far represents a divergent and evolving cluster and can be broadly classified into 5 species: Zaire (EBOV), Sudan (SUDV), Bundibugyo (BDBV), Reston (RESTV), and Tai Forest (TAFV) viruses6. Multiple lineages of EBOV were identified with increasing phylogenetic and genetic diversity in the 2014 outbreak in West Africa789101112. While it is uncertain whether the observed genetic diversity is the cause or the consequence of the current epidemic, the high mortality rate associated with rapid human to human transmission strongly argue for more effective therapeutics and vaccines against EBOV infection. The surface glycoprotein (GP) of EBOV mediates viral entry and serves as the main target for antibody-based therapy and vaccination. Once translated inside the target cell, GP is cleaved by furin to yield disulphide-linked GP1 and GP2 subunits that further assemble into metastable trimers13. The GP1 subunit is responsible for cellular attachment and binding to the receptor Niemann Pick C1 (NPC1), whereas GP2 mediates fusion of the viral and cellular membranes13. Three GP1 subunits forms a chalice consisting of the receptor binding domains (RBD), the glycan caps and heavily glycosylated mucin-like domains (MLD)14. The RBDs are sequestered in the chalice bowl while the glycan caps and MLDs are projected at the rim of chalice to prevent immune recognition14. GP2 wraps around GP1 to forms the base of the chalice containing the fusion loop as well as N- and C-terminal heptad repeat regions critical for viral fusion14. During viral entry, GP undergoes proteolytic cleavage by endosomal cathepsin proteases to generate cleaved GP (GPcl) devoid of the glycan cap and MLD and exposes additional surface residues required for NPC1 binding15. In addition, the unedited GP gene encodes for soluble GP (sGP) which includes the glycan cap but lacks the MLD and GP213. It has been shown that sGP is produced in larger quantity than GP during replication and may therefore act as a decoy by binding to neutralizing antibodies13. Such complexity in GP structure and insidious tactics to evade and distract immune recognition may partially explain why majority of infected individuals succumbed to diseases and failed to generate strong neutralizing antibody during natural infection1617. Recently, significant progress has been made in antibody therapy and vaccines against EBOV although no product has yet to receive regulatory approval181920212223242526. In particular, monoclonal antibody (mAb) cocktails instead of single mAb conferred protection to nonhuman primates when passively administered after otherwise lethal viral challenge212224252627. The most potent and successful cocktails include MB-003 consisting of human or human-mouse chimeric mAbs c13C6, h13F6 and c6D82225, ZMAb consisting of murine mAbs m1H3, m2G4 and m4G723, and ZMapp consisting of human-mouse chimeric mAbs c13C6, c2G4 and c4G724. Most strikingly, ZMapp demonstrated protection effect in nonhuman primates when administered as late as 5 days post infection and used on a compassionate basis in humans during the 2014 outbreak2428. Epitope mapping of these mAbs as well as those published elsewhere has revealed convergence to the three major sites on the surface of GP including the glycan cap, mucin-like domain and the base of GP where the GP1 and GP2 subunits interact29. Unexpectedly, all the neutralizing mAbs target to the overlapping epitopes in the base of GP while those that do not neutralize or do not neutralize in the absence of complement bind to the glycan cap and mucin-like domains2930313233343536. Most recent studies have identified several novel and cross-reactive mAbs with potent neutralizing activity and conferred protection in mouse, guinea pig or monkey models333738394041. It needs to be noted, however, that neutralizing activities of mAb is not necessarily the predictor of protection in vivo263334 and other mechanisms such as preventing budding of nascent viral particles from infected cells and Fc-mediated functions have to be taken into account42. Here, we set out to raise neutralizing mAb targeting the GP of EBOV identified in 2014. Through sequential immunization of Chinese rhesus macaques and antigen-specific single B cell sorting, we have successfully identified three mAbs (Q206, Q314 and Q411) with potent neutralizing activities against pseudo and live EBOV. Epitope mapping through competitive binding, single-particle EM reconstructions and site-directed mutagenesis have revealed that Q206 and Q411 bind to novel and overlapping epitopes spanning the glycan cap and the head subdomain, approaching to the RBD of GP1 subunit. Q314, on the other hand, binds to an epitope that is partially overlapping with that of c13C6 in the glycan cap but is orientated towards the upper surface of the chalice. In distinct contrast to c13C6 and other mAbs binding to the similar or adjacent epitopes, the newly isolated mAbs are completely or partially independent of complement in live EBOV neutralization. In particular, all these novel mAbs are able to achieve close to 100% inhibition of live EBOV in the presence of complement while c13C6 plateaued just above 50% inhibition. Furthermore, treatment with these mAbs individualy provided partial but significant protection against disease progression in a mouse model of EBOV infection. Collectively, these results suggest that Q206 and Q411 recognize novel epitopes in the GP1 subunit with potent neutralizing activity and could serve as promising candidates for prophylactic and therapeutic interventions against Ebola virus infection.

Results

Generation and isolation of mAb from GPdM immunized macaques

We used recombinant GPdM with the deletion of mucin-like domain (MLD) and transmembrane domains to immunize two rhesus macaques (Rh091730 and Rh100888) largely due to the earlier studies indicating the bulky MLD is highly variable and able to shield the critical receptor binding domain (RBD) of Ebola virus glycoprotein1314294344. To enhance and promote the maturation of the antibody response, eight consecutive immunizations were performed through intramuscular route at 4-week intervals before the blood samples were collected and evaluated for antibody binding and neutralization activities. Both animals mounted a strong antibody binding activity measured by ELISA as well as neutralizing activity using pseudovirus bearing the glycoprotein of EBOV Mayinga strain (supplementary Fig. 1). In particular, Rh100888 appeared to have 3-fold higher neutralizing activities than that of Rh091730 (527 vs. 156 in ID50 values) (supplementary Fig. 1b). We have therefore chosen the peripheral blood mononuclear cells (PBMCs) from Rh100888 to isolate GPdM-specific single memory B cells (CD3−, CD16−, CD235a−, CD19+, CD27+, CD38−, and IgG+) by FACS (supplementary Fig. 1c) and to amplify the variable regions of immunoglobulin heavy and light chain genes (VH and VL) by an optimized nested polymerase chain reaction (PCR). A total of 27 paired VH and VL sequences from the sorted single B cells were obtained and fused with the constant region fragment of human IgG1 to generate bivalent full-length chimeric mAbs. Once confirmed by sequencing, the full-length heavy and light chain plasmids were co-transfected into 293T cells for the production, purification and characterization of mAbs.

Binding and neutralizing activity against pseudo and live Ebola virus infection

We first analyzed the binding activity of isolated mAbs to four different forms of EBOV GP including the recombinant GPdM, sGP, and GPcl as well as GP with deletion of MLD (GPdMuc) expressed on the surface of 293T cells. Among the total of 27 mAbs successfully isolated and produced, 5 (Q203, Q206, Q314, Q411 and Q703) had detectable binding to GPdM measured by ELISA. Q206, Q314 and Q411 demonstrated strong binding affinity comparable to that of the control mAbs c13C6 and KZ52 while Q203 or Q703 was merely above the detection threshold (Fig. 1a). Similar differences were also found in the binding to GPdMuc expressed on the surface of 293T cells, suggesting that binding of these mAbs is independent of MLD. Like c13C6, Q206, Q314 and Q411 bound strongly to sGP indicating their epitopes are located in the N-terminus of GP1 subunit where GPdM and sGP share amino acid residues between 31–29529. Interestingly, Q206 and Q411 maintained strong binding to the glycan cap missing GPcl while Q314 and c13C6 failed, suggesting that Q206 and Q411 recognized epitopes distinct from that by Q314 and c13C6. Genetically, each of the 5 mAbs had unique VH and VL sequences although Q206 and Q411 shared homologous sequence throughout except for the CDR3 sequence in VH (Table 1). The gene families of the 5 mAbs were quite divergent for both VH (1 VH1, 1 VH2, 2 VH3, and 1 VH4) and VL (3 Vλ1, and 2 Vλ2) with variable degree of divergence (90.1–95.3%) from the rhesus macaque germline sequences (Table 1). The degree of humanness of these recombinant full-length mAbs ranged from 97.3–99.7% by analyzing the amino acid sequence compared with human immunoglobulin gene using germline index45.
Figure 1

Binding (a) and neutralizing activities of isolated mAbs against pseudo (b) and live (c) Ebolaviruses. Pseudoviruses bearing the envelope glycoprotein from the five species of Ebolaviruses (EBOV, SUDV, BDBV, RESTV, TAFV) are presented as well as the controls from Marburg virus, human immunodeficiency virus (HIV) and vesicular stomatitis virus (VSV). Dashed line indicates 50% inhibition. Controls antibodies used here include VRC01, a human neutralizing mAb against HIV-1, c13C6 and KZ52, previously isolated neutralizing mAbs against EBOV. In live EBOV experiment (c), neutralizing activity was evaluated in the presence (dark) and absence (light) of complement in comparison with c13C6, one of the three mAbs in the ZMapp cocktail and its neutralizing activity is complement-dependent in vitro. Data presented are average values from at least two independent experiments and the error bars indicate for the standard error of the mean (SEM).

Table 1

Genetic analysis of the heavy and light chain variable regions of isolated mAbs.

 mAbVVariable region identity(%)*Full length identity (%)CDR1CDR2CDR3
VHQ203VH2.1295.398.7GFSLSTSGMGIYWDDDKRVRWAPPSAMLGDAFDFWG
Q206VH3.993.099.7GFTFSTFWIKTKPDGGTATTRQRAHDYWG
Q314VH4.2690.598.8GASISSYWINGNSGITARRSQGSLDWLLDHGLDSWG
Q411VH3.994.399.2GFTFSSVWIKSKADGGTPTTRITTFALILNRFDVWG
Q703VH1.5392.298.3GYTFTDYYVDPEDGDVTAGGSGNSNWFHVWG
VLQ203Vλ2.1394.397.3SSDIGGYNYEVNSSYVDSHNLLFG
Q206Vλ1.3094.698.6SSNIGAGYSENDQSYDSRMSDNAVFG
Q314Vλ1.2790.197.7RSNIGADNHSNAAWDDSLSSMLFG
Q411Vλ1.3094.697.6SSNIGTGYGENNQSYDSSLSDHYVFG
Q703Vλ2.1395.398.6SSDIGGYNYEVNSSYVDSHSLLFG

*Variable region identity to Rhesus germline (%).

†Full length identity to Human germline (%).

Neutralizing activity of Q203, Q206, Q314, Q411 and Q703 was then tested on the susceptible Vero-E6 cells against Ebola pseudovirus bearing the surface glycoprotein of EBOV, SUDV, BDBV, RESTV, or TAFV (Fig. 1b and Table 2). Consistent with binding activity, Q206, Q314 and Q411 demonstrated potent neutralization against EBOV (Mayinga strain) with IC50 values ranging from 0.36 to 0.78 μg/ml while Q203 and Q703 showed negligible effect (Fig. 1b and Table 2). Like KZ52, Q206, Q314 and Q411 were able to reach IC90 but c13C6 plateaued prematurely around 70% inhibition despite increases in concentration (Fig. 1b), consistent with earlier report46. Furthermore, differences in slope and AUC were also found among and between isolated and control mAbs, suggesting different mAbs demonstrated different potency and may exert their neutralizing activity through different mechanisms (Table 2)47. None of the isolated mAbs demonstrated any cross-neutralizing activity against the remaining species of Ebolaviruses (SUDV, BDBV, RESTV, or TAFV) or the pseudovirus bearing the envelope glycoprotein from MARV, HIV-1 or VSV. Only c13C6 displayed some level of cross-activity against SUDV strain as previously reported32. No cross-binding was found against GPdM from SUDV, BDBV and MARV (supplementary Fig. 2). VRC01, a human broadly neutralizing mAb against HIV-148, demonstrated neutralizing activity against only HIV-CNE30 (Fig. 1b). Furthermore, Q206, Q314 and Q411 also showed potent neutralization against live EBOV virus (Fig. 1c and Table 2). In particular, Q206 and Q411 had similar IC50 concentrations in the presence or absence of complement suggesting their neutralizing activity is largely independent of complement. In contrast, Q314, like the mAb c13C6 control, required the presence of complement for optimal neutralization although significantly higher neutralization activity was found (Fig. 1c).
Table 2

Neutralizing activity of isolated mAbs against pseudo and live Ebola virus.

EBOV pseudovirus*
EBOV live virus
mAbIC50 (μg/ml)IC90 (μg/ml)Slope (m)AUC (μg/ml)IC50 (μg/ml)IC90 (μg/ml)Slope (m)AUC (μg/ml)
Q203>50>50n.a.n.a.n.a.n.a.n.a.n.a.
Q2060.361.491.54234.017.08/5.1617.66/n.a.2.41/1.62125.03/84.12
Q3140.786.771.02239.2942.96/38.9091.20/n.a.2.24/0.9145.09/29.17
Q4110.432.231.33247.3414.92/15.2461.66/61.651.40/1.93105.37/62.40
Q703>50>50n.a.n.a.n.a.n.a.n.a.n.a.
c13C60.17n.a.1.04247.2954.95/n.a.n.a./n.a.0.41/n.a.54.35/n.a.
KZ520.120.581.41291.42n.d.n.d.n.d.n.d.

*Neutralization activity is presented by four different parameters: IC50, IC90, Slope and Area under the curve (AUC).

†Neutralization activity was evaluated with and without complement and expressed numerically before and after the forward slash, respectively.

n.a.: not applicable. n.d.: not determined.

Kinetics and competitive binding of isolated mAbs measured by SPR

The observed differences in neutralizing activity against pseudo and live Ebola virus could be due to their differences in binding affinity and epitopes recognized. To test this hypothesis, we measured the binding kinetics of Q206, Q314, and Q411 antigen-binding fragment (Fab) to the recombinant GPdM, sGP, or GPcl by surface plasmon resonance (SPR). As shown in Fig. 2, the differential binding to these recombinant proteins is consistent with those analyzed by ELISA (Fig. 1a). Furthermore, the estimated binding affinity to GPdM appeared to correlate with their neutralizing activity (Table 3). Q206 demonstrated the strongest binding affinity (Kd = 16.1 nM) while Q411 was intermediate (Kd = 24.0 nM) and Q314 was the weakest (Kd = 44.8 nM). Consistent with earlier report49, KZ52 demonstrated a higher binding affinity (Kd = 3.4 nM) than the 3 mAbs we isolated, hence also showing stronger neutralizing activity. However, c13C6 was an outlier perhaps due to its unique and unusual neutralization curve in that its inhibitory activity appeared early at the relatively lower concentration and then plateaued prematurely about 70% despite increases in concentration (Fig. 1b). In contrast, binding affinity to sGP didn’t seem to follow their trend in neutralization. Q314, the weakest neutralizing mAb isolated, showed the highest affinity (Kd = 6.3 nM) to sGP while Q206 demonstrated the intermediate (Kd = 7.1 nM) and Q411 was the weakest (Kd = 13.5 nM). Interestingly, removal of the glycan cap from GPdM by thermolysin (GPcl) dramatically increased the binding of Q206 (from Kd = 16.1 to 7.1 nM) while having no effect on Q411 (from Kd = 24.0 to 24.0 nM) (Table 3). These results highlight the binding affinity to membrane associated (GPdM and GPcl) but not secreted (sGP) form of GP may contribute to the differential neutralizing activity among the isolated mAbs. In particular, as EBOV entry requires cleavage of envelope glycoprotein in the endosome1315, more favorable binding of Q206 to GPcl over GPdM suggests a possible enhanced inhibitory effect by this mAb during the process of viral entry.
Figure 2

Binding kinetics of isolated mAbs with purified EBOV GPdM (a), sGP (b) and GPcl (c) measured by surface plasmon resonance (SPR). The purified soluble antigens GPdM, sGP and GPcl were covalently immobilized onto a CM5 sensor chip followed by injection of individual Fab of Q206, Q314, Q411 as well as control Fab c13C6 and KZ52 at five different concentrations. The black lines indicate the experimentally derived curves while the red lines represent fitted curves based on the experimental data.

Table 3

Binding kinetics of isolated mAbs with purified GPdM, sGP and GPcl of EBOV.

mAbGPdM*sGPGPcl
Kon (M−1s−1)Koff (s−1)Kd (M)Kon (M−1s−1)Koff (s−1)Kd (M)Kon (M−1s−1)Koff (s−1)Kd (M)
Q2067.30E + 041.17E − 031.61E − 081.92E + 051.36E − 037.08E − 091.55E + 051.12E − 037.21E − 09
Q3141.10E + 044.94E − 044.48E − 086.80E + 044.31E − 046.33E − 09
Q4112.21E + 045.32E − 042.40E − 087.71E + 041.04E − 031.35E − 081.52E + 043.64E − 042.40E − 08
c13C64.60E + 041.39E − 033.02E − 087.83E + 045.12E − 036.54E − 08
KZ525.26E + 041.77E − 043.37E − 09

*Kon (association rate, in M−1s−1), Koff (dissociation rate, in s−1), and Kd (dissociation constant, in M) are indicated for each paired interaction.

†Dash sign indicates the negative binding.

We went further to determine the epitopes of the isolated mAbs on GPdM through pairwise competition using SPR. Specifically, pairs of the testing Fabs were sequentially applied to the purified GPdM covalently immobilized on a CM5 sensor chip to monitor for additional binding to determine whether the two mAbs recognized the separate or closely situated epitopes. As shown in Fig. 3a, Q206 did not compete with Q314 nor with KZ52, but strongly with Q411 and partially with c13C6. Q314, on the other hand, strongly competed with c13C6, but not with Q206, Q411 or KZ52 (Fig. 3b). Conversely, Q411 strongly competed with Q206, partially with c13C6 but not with Q314 or KZ52 (Fig. 3c). These results clearly indicate that Q206 and Q411 recognize an overlapping epitope and so did Q314 and c13C6. The two overlapping epitopes appeared to be closely located but grossly distinct from that recognized by KZ52.
Figure 3

Epitope mapping through competitive binding measured by SPR.

The sensorgrams show distinct binding patterns when pairs of testing Fabs were sequentially applied to the purified GPdM covalently immobilized onto a CM5 sensor chip. Arrows indicate the time points when Fabs were injected. Whether additional binding after injecting the second Fab is the key criteria for determining the two mAbs recognize the separate or closely situated epitopes.

Single particle EM reconstructions of GPdM in complex with Q206, Q314 or Q411 Fab

To further determine the epitopes in a more precise manner, negative stain single-particle EM reconstructions were performed with GPdM in complex with Fab of Q206, Q314 or Q411. Each Fab was added in excess to GPdM, purified by size-exclusion chromatography and then subjected to staining and EM analyses (Fig. 4, supplementary Fig. 3 and supplementary Table 1). The structures of Q206- and Q411-GPdM complexes showed that the antibodies bound to novel epitopes within the center of the GPdM chalice, perpendicularly to the expected plane of the membrane and making contacts with a region spanning the glycan cap (cyan) and the head (blue) subdomains of GP1 subunit (Fig. 4a and supplementary Fig. 3). Q314, on the other hand, bound in the vicinity of the glycan cap with an angle of approach much less steep than that of Q206 and Q411 (Fig. 4a and supplementary Fig. 3). To compare the binding sites of Q206, Q314 and Q411 to those of c13C6 and KZ52, we generated a hybrid map based on the structure information obtained here and previously published elsewhere29. As shown in Fig 4b, the binding sites for Q206 and Q411 are located next to that of c13C6 but closer to the inner chalice of the GP1 subunit. On the contrary, the Q314 binding sites are located to the opposite side of c13C6 in the glycan cap orientated towards the upper surface of the chalice (Fig. 4b). As shown previously, the control KZ52 bound the base of GPdM1429. These results are consistent with those from the epitope mapping studies conducted above and provided a clear three dimensional understanding of the location and distribution of epitopes recognized by Q206, Q314 and Q411 on the GP1 subunit.
Figure 4

Single-particle EM reconstructions of Q206, Q314 and Q411 Fabs bound to EBOV GPdM.

Hybrid models of negative-stain EM reconstructions fit with the EBOV GPdM crystal structures (PDB assessing number 3CSY) and a reference Marburg virus mAb MR78 Fab (PDB assessing number 3X2D). (a) Side view of individual Fab Q206 (mustard), Q314 (blue) and Q411 (magenta) bound to the EBOV GPdM. Overall as well as focused views at the binding interface between Fab and GPdM are shown in ribbon diagram. Four residues (T144, F225, E231 and W275) found to be critical for mAb binding and neutralization through mutagenesis study are highlighted and found to be located in the glycan cap (cyan) and the head regions (dark blue) within the EBOV GPdM. b) Side and top views of combined Fabs of Q206 (mustard), Q314 (blue), and Q411 (magenta) bound to the EBOV GPdM relative to the control Fabs c13C6 (cyan) and KZ52 (orange).

Epitope mapping through site-directed mutagenesis

To confirm the epitope information obtained, we conducted site-directed mutagenesis on EBOV GPdMuc (Mayinga strain) based on the structural information as well as previously published studies shown to confer resistance to control mAbs c13C6 and KZ52293250. A total of 23 single mutant clones were generated, one in the base, four in the head, thirteen in the glycan cap of GP1 subunit and five in the GP2 subunit (Table 4). Once confirmed by sequencing, the expressing vectors encoding the wild type and mutant clones were transfected into 293T cells and analyzed for the binding of Q206, Q314 and Q411 as well as c13C6 and KZ52 by FACS. Nine out of the 23 clones had profound impact on the binding activity of the mAbs. T144A and F225A mutations in the head, for instance, either completely abolished or significantly reduced the binding of Q206 and Q411. Mutant T144A also demonstrated significant reduction to Q314 binding. In addition, mutations in the glycan cap (E231A, T270A and W275A) had biased effect towards Q314 and c13C6. For example, both E231A and W275 mutants either abolished or significantly reduced the binding by Q314 and c13C6 while E231A also demonstrated negative effect on binding by Q206, Q411 and KZ52. T270A mutant, previously shown to affect c13C6 binding, resulted in the similar effect in our assay32. Lastly, consistent with previous reports3250, mutations at Q508, C511, N550, and D552 in the GP2 had detrimental effect on KZ52 binding but minimal effect on the rest of the mAbs tested here.
Table 4

Impact of mutant residues on mAb binding to surface expressed GPdMuc.

GPdMuc mutantsLocationQ206*Q314Q411c13C6KZ52
W104ABase++++++++++
D117AHead++++++++++
T144AHead+++++
P146AHead++++++++++
F225AHead++++++++
N228AGlycan cap++++++++++
T227AGlycan cap++++++++++
E231AGlycan cap+++
V236AGlycan cap++++++++++
L253AGlycan cap++++++++++
L254AGlycan cap++++++++++
T270AGlycan cap+++++++++
W275AGlycan cap+++++++
K276AGlycan cap++++++++++
P279AGlycan cap++++++++++
T283AGlycan cap++++++++++
N296AGlycan cap++++++++++
L297AGlycan cap++++++++++
Q508RGP2++++++++
C511AGP2++++++++
N550AGP2++++++++
D552AGP2++++++++
G553AGP2++++++++++

*“+” indicates at least 50% reduction in fluorescent intensity compared to the wild type and “−” indicates complete abolish of antibody binding.

Next, we studied whether reduction in binding could confer resistance to mAb neutralization in the context of pseudovirus. To this end, the pseudoviruses bearing the representative mutations were generated and subjected to standard neutralization test (Fig. 5). Consistent with the binding analysis, T144A and F225A mutations in the head resulted in complete resistance to Q206 and Q411 neutralization with at least 100-fold increase in IC50 compared to the wild type. Similarly, W275A mutation in the glycan cap and Q508A, N550A and D552A in GP2 subunit also rendered pseudovirus completely resistant to Q314 and c13C6 as well as KZ52, respectively. It needs to be noted that the same set of mutations had some noticeable cross-effect on neutralization activity of other mAbs, but all limited within the 10-fold differences from the wild type and most likely due to the indirect consequences (Fig. 5b). But nevertheless, these results confirm that Q206 and Q411 bind to a novel epitope located between the glycan cap and the head subdomain approaching to RBD in the inner chalice of GP1. Q314, on the other hand, binds to an overlapping epitope with c13C6 in the glycan cap but more towards the upper surface of the chalice.
Figure 5

Critical residues on the EBOV envelope glycoprotein in conferring resistance to Q206, Q314 and Q411 neutralization.

Comparison of neutralization sensitivity of mutant and wild-type pseudoviruses to Q206, Q314, and Q411 in graphic (a) and numerical (b) format. Dashed line indicates 50% inhibition. Controls antibodies used here include VRC01, a human neutralizing mAb against HIV-1, c13C6 and KZ52, previously isolated neutralizing mAbs against EBOV. Data presented are average values from at least two independent experiments and the error bars indicate for the standard error of the mean (SEM).

Post attachment inhibition through partial interference with receptor NPC1 binding

To determine potential steps of inhibition, we applied the testing mAbs to pseudoviruses and target Vero-E6 cells in two separate time scales. One was to incubate with pseudoviruses first at 37 °C for 1 h before virus attachment to Vero-E6 cells. The other was allow virus attachment to Vero-E6 cells first at 4 °C for 1 h before adding the testing mAbs and elevating temperature to 37 °C to initiate the virus entry. We reasoned that if the testing mAb inhibited virus attachment to the cell surface, the reduction in luciferase activity would only be detectable in the former experiment. On the other hand, if the testing mAb inhibited the steps after virus attachment, the reduction in luciferase activity would be detectable in both cases. As shown in Fig. 6a, Q206, Q314 and Q411 were all able to reduce luciferase activity more than 90% in both cases, suggesting they inhibited steps after virus attachment. Consistent with earlier reports, the positive control KZ52 also inhibited post-attachment steps while the negative control VRC01 failed in both cases (Fig. 6a).
Figure 6

Post attachment inhibition through partial interference with receptor NPC1 binding.

(a) The testing mAb were applied to pseudovirus and Vero-E6 cells before or after attachment and (b) Competitive binding of the testing mAbs with NPC1-C to immobilized GPcl on a chip. The blocking efficacy was determined as 12.9% for Q206, 3.9% for Q314, 14.9% for Q411, and 72.7% for control mAb 114, respectively.

As the epitopes of Q206 and Q411 located between the glycan cap and the head subdomain approaching to the RBD, Q206 and Q411 may exert their neutralizing activity after attachment through interfering with GPcl binding to the cellular receptor NPC1. To test this hypothesis, we immobilized GPcl to a CM5 sensor chip followed by injection of Q206, Q314 or Q411 separately until reaching the binding steady-state. Domain C of NPC1 (NPC1-C) was then injected to compare the binding kinetics with or without the testing mAbs. As shown in Fig 6b, both Q206 and Q411 partially interfered with NPC1-C binding with efficacy about 12.9% and 14.9%, respectively. Q314, on the other hand, demonstrated negligible effect of 3.9%. The positive control mAb114, recently isolated and shown to block receptor NPC1 binding41, was about 72.7% effective. These results indicate that Q206, Q314 and Q411 inhibit virus entry at the post attachment steps. Q206 and Q411 appear to partially interfere with receptor NPC1 binding while Q314 functional step warrants further study.

Protective efficacy in mouse model of EBOV infection

To determine the protective efficacy of isolated mAbs in vivo, we infected mice through intraperitoneal injection (IP) with a dose of 1000 × LD50 mouse-adapted EBOV and administered Q206, Q314 or Q411 at either 1 or 2 days post infection. All control animals, which received only PBS, succumbed to the virus with an average time of death of 7.4 ± 3.1 days. In contrast, mAb treatment significantly increased survival in infected mice (p-value = 0.028). The highest survival rates were 67% and 50% for the animal groups treated with Q206 48h (p-value = 0.0033) and Q411 at 24 h (p-value = 0.0169) (Table 5). Interestingly, the degree of weight change did not correlate with protective efficacy. In fact, the two groups with the highest survival also had the highest weight loss (supplementary Fig. 4).
Table 5

Protective efficacy of mAbs against mouse-adapted EBOV in mice.

GroupSurviving/Total animalsSurvival (%)Mean time to death (days) ± SD
PBS0/507.4 ± 3.1
Q206 24h3/650.012.0 ± 4.4
Q206 48h4/666.614.0 ± 3.6
Q314 24h2/633.310.2 ± 4.6
Q314 48h2/633.39.5 ± 5.3
Q411 24h3/650.012.3 ± 4.1
Q411 48h1/616.78.5 ± 3.7

Discussion

The unprecedented EBOV outbreak in West Africa in 2014 has affected more people than all previously recorded outbreaks combined and highlighted the threat to global health15152. While significant process has been made in therapeutics and vaccines against EBOV, no licensed products are currently available181922232425. Combination of monoclonal antibodies represent one of the most specific and promising therapeutic modalities22232425 and one such cocktail ZMapp has demonstrated safety and efficacy in nonhuman primates as well as encouraging results in compassionate use in humans although the development for clinical application requires further studies2428. These antibodies, together with most of the published ones, are directed to several vulnerable sites on the surface of GP including the glycan cap, mucin-like domain and the base of GP where the GP1 and GP2 interact1429. All neutralizing mAbs, however, target to the overlapping epitopes in the base of GP while those do not neutralize or do not neutralize in the absence of complement bind to the glycan cap and mucin-like domains1429313236. The most recent studies have isolated a large number of mAbs from convalescent individuals with neutralizing activities targeting to additional sites on the GP383940. This study aimed to identify neutralizing mAbs targeting additional sites on the GP of Ebola virus identified in 20141. Through sequential immunization of Chinese rhesus macaques with recombinant GPdM and antigen-specific single B cell sorting, we have successfully isolated and characterized three mAbs (Q206, Q314 and Q411) with potent neutralizing activities against pseudo and live EBOV. Epitope mapping through differential binding, single-particle EM reconstructions and site-directed mutagenesis have revealed that Q206 and Q411 bind to novel and overlapping epitopes spanning the glycan cap and the head subdomain approaching to the RBD in the inner chalice of GP1. Q314, on the other hand, binds to an overlapping epitope with c13C6 in the glycan cap but orientated towards the upper surface of the chalice. In distinct contrast to c13C6 and other mAbs binding to the similar or adjacent epitopes, the newly isolated mAbs are completely or partially independent of complement in live EBOV neutralization. In particular, all these novel mAbs are able to achieve close to 100% inhibition of live EBOV in the presence of complement while c13C6 plateaued just above 50% inhibition. Furthermore, treatment with these mAbs provided partial but significant protection against disease progression in a mouse model of EBOV infection. Collectively, these results suggest that Q206 and Q411 recognize novel epitopes in the GP1 with potent neutralizing activity and could serve as promising candidates for prophylactic and therapeutic interventions against Ebola virus infection. We believe that the neutralizing mAbs identified here represent a new arsenal against EBOV infection. The most potent and protective mAbs, Q206 and Q411, recognize overlapping epitopes within the core of GP1, a region that encompasses the RBD and the base of GP1142932. While previous studies suggested that this region may be concealed before proteolysis by endosomal cathepsins and receptor binding152953, the binding as well as neutralizing profile of Q206 and Q411 indicated this region contains opening spots for antibody binding and neutralization at the early steps during viral entry. While the exact underlying mechanism requires further investigation, it appeared that Q206 and Q411 exert their neutralization activity through interfering with GP binding to its receptor NPC-1 which may lead to affecting the subsequent fusion between viral and cellular membrane. This hypothesis is further supported by the mutagenesis study where mutant virus with T144, a residue located at the edge of RBD critical for NPC-1 binding54, became resistant to Q206 and Q411 (Fig. 5 and Table 4). For Q314, however, the mechanism of action is far less clear. Despite of its overlapping epitope with c13C6, Q314 protective activity in the mouse model is much less effective31, perhaps due to the differences in exact epitope, the affinity, the approaching angle or the Fc-mediated functions of the antibody to the GP. Of note, it is important to recognize that neutralizing activity does not always translate into protective activity in mouse model and mouse model can’t always predict the monkey model. The ultimate test will have to be conducted in human before any meaningful protective activity could be evaluated and determined. In any case, it would be interesting to study whether the combination of our newly isolated mAbs could have any synergistic effect to provide stronger and broader neutralizing and protective activities against wild-type and mutant EBOV14222324253334353649. Although the current dataset for EBOV shows a limited degree of sequence variation, this is by no means to suggest the virus will remain unchanged in the long run given their wide spread in several animal species, continuing zoonotic introductions into and rapid transmission within human population781250555657. With the potent neutralizing mAbs identified here and their novel epitope specificities, we are at more advantageous position to generate and optimize next-generation of therapeutic antibody cocktail against EBOV infection.

Methods

Ethics statement

Rhesus macaque experiment was carried out in strict compliance with Chinese government rules and regulations for animal health and welfare. The experimental protocol for immunization and blood collection at Guangzhou Institute of Biomedicine and Health, Chinese Academy of Sciences were approved by the Institutional Animal Care and Use Committee. Mice experiments were performed at the National Microbiology Laboratory in Winnipeg, Canada. All animal experiments have been approved by the Animal Care Committee at the Canadian Science Center for Human and Animal Health in accordance with the guidelines outlined by the Canadian Council on Animal Care.

Immunization of rhesus macaques

Two 5–6 year old Chinese rhesus macaques (Macaca mulatta) (Rh091730 and Rh100888) were immunized intramuscularly about every 4 weeks with 100 or 200 μg of recombinant EBOV GP devoid of mucin-like and transmembrane domains (GPdM) derived from the Guinean patient C7 (Genbank accession number KJ660347) identified in the 2014 outbreak1. The first two doses were formulated with alum adjuvant (Imject Alum, Thermo Scientific) while the subsequent doses were recombinant GPdM only. Plasma and peripheral blood mononuclear cells (PBMCs) were collected after the 8th immunization, evaluated for binding and neutralization activity and used for sorting of single B cells and amplifying immunoglobulin heavy and light chain genes (VH and VL) by nested polymerase chain reaction (PCR). The animals were housed in the Animal Experimental Center of the Guangzhou Institute of Biomedicine and Health, Chinese Academy of Science.

Production and purification of Ebola virus glycoprotein

All forms of EBOV GP (GPdM, sGP and GPcl) were derived from the Guinean patient C7 (Genbank accession number KJ660347) identified in 2014 outbreak and shared approximately 97% homology with Zaire strain from the Democratic Republic of Congo and Gabon1. Specifically, GPdM with the deletion of mucin-like (MLD) and transmembrane domains (residues 1–32, 312–463 and 633–676) was cloned into the pFastBac1 vector (Invitrogen) as previously described14. For protein secretion and purification, a gp67 signal peptide and a His6-tag were added at the N-terminus and C-terminus of the protein, respectively. Transfection and virus amplification were performed according to manufacture instructions (Invitrogen)58. Soluble GPdM was produced in Hi5 cells (Invitrogen), harvested from the culture supernatants by metal affinity chromatography using a HisTrap® HP 5-ml column (GE Healthcare), and purified by gel filtration on a HiLoad 16/60 Superdex®200 PG column (GE Healthcare). GPcl with glycan cap removed was generated by treating the GPdM (2 mg/ml) with thermolysin (Sigma, 0.5 mg/ml) in HEPES-MES buffer (20 mM HEPES, 20 mM morpholinepropanesulfonic acid, 130 mM NaCl, pH 7.5) at 37 °C for 1 h. The cleavage was stopped by the addition of EDTA to final concentration of 10 mM. The gene encoding the sGP (residues 33–324) was cloned into the baculovirus transfer vector pFastBac1 (Invitrogen) in-frame with an N-terminal gp67 signal peptide for secretion and a His6-tag at the C terminus for purification. Transfection and virus amplification were performed according to manufacture instructions (Invitrogen). Recombinant proteins were produced by infecting suspension cultures of Hi5 cells (Invitrogen) for 2 days, recovered from cell supernatants by metal affinity chromatography using a HisTrap HP 5-ml column (GE Healthcare), and purified by gel filtration chromatography using a Superdex-200® 16/60 GL column (GE Healthcare) with a running buffer of 20 mM Tris-HCl, pH 8.0, 150 mM NaCl.

PCR amplification of antibody heavy and light genes from sorted single B cells

Peripheral blood mononuclear cells (PBMCs) of immunized rhesus macaques were isolated from the whole blood by standard Ficoll-Hypaque (GE Healthcare) separations, and subsequently stained with various cell surface markers to identify, enrich and sort for single antigen-specific memory B cells (CD3−, CD16−, CD235a−, CD19+, CD27+, CD38−, IgG+ and GPdM-positive) using FACS Aria II flow cytometer (BD Biosciences, USA). The sorted single B cells in the 96 well plate were then reverse transcribed and variable regions of immunoglobulin heavy and light chain genes (VH and VL) were amplified by nested PCR using an optimized version of a previously described protocol59. In brief, the reverse transcription reaction was performed with mixture of SuperScript III reverse transcriptase, RNase Out, dNTPs (Invitrogen), primers specific for IgG, IgM, IgA, IgD, IgE, Igκ, and Igλ, and incubated at 55 °C for 60 min. The cDNA was then amplified by PCR with appropriate primer pairs in a 50 μl reaction at 95 °C for 5 min followed by 35 cycles of 94 °C for 30 s, 67 °C for 45 s, 72 °C for 90 s with final extension of 72 °C for 7 min. The second PCR was performed in exactly the same conditions except for the primer pairs located within the internal region compared to those used in the first PCR. PCR products were analyzed on a 1.0 % agarose gel, purified and sequenced for confirmation.

Expression and purification of recombinant antibody

The PCR-amplified and sequence-confirmed the variable regions of heavy and light chain genes were separately cloned into backbone of antibody expression vectors containing the constant regions of human IgG160. Whole recombinant human IgG1 antibodies were expressed in 293T cells (ATCC) by transient transfection and purified by affinity chromatography using Protein A agarose. The concentration was determined by BCA Protein Assay Kit (Thermo Scientific). The expression clones encoding the control antibody KZ52, c13C6, mAb114 were synthesized and confirmed by sequencing before production.

Analysis of antibody binding through ELISA and cell surface expressed glycoprotein

For enzyme-linked immunosorbent assay (ELISA), purified EBOV GP (GPdM, sGP, and GPcl) were immobilized at 100 ng/well in phosphate-buffer saline (PBS) on 96 well plates at 4 °C overnight. After blocking with 1% BSA, serial dilutions of purified antibodies were added and the bound antibodies were detected by anti-human immunoglobulin G (IgG)-horseradish peroxidase (Promega) and TMB (3, 3′, 5′, 5′- tetramethylbenzidine) substrate (CWBio). Absorbance was measured at 450 nm with background blank measured at 620 nm. For cell surface binding analysis, the expressing vector pcDNA3.1 encoding the gene of EBOV GPdMuc with the deletion of MLD (Mayinga strain) was transfected into 293T cells. Approximately forty hours later, the transfected cells were harvested, trypsinized, fixed with 4% paraformaldehyde, stained with a serial dilution of testing and control mAbs, detected by the anti-human IgG-Alexa Fluor 488 secondary antibody (Santa Cruz Biotechnology) using a FACS Calibur flow cytometer (BD Biosciences). To measure the antibody cross-reactive against additional Ebolavirus species, Costar half-area high binding assay plates (Corning #3690) were coated at 4 °C overnight with 30 ng of EBOV GPdTM, EBOV sGP, SUDV GPdTM, BDBV GPdTM and MARV GPdTM (IBT BioServices, USA) diluted in 30 μl of PBS, respectively. Plates were blocked for 1 h with 5% skim milk/PBS at 37 °C. Testing mAbs were serially diluted in 2% skim milk/PBS (30 μl/well) and incubated for 2 h at 37 °C. After wash 6 times with PBS/0.1% Tween-20, 30 μl/well of a secondary antibody (horseradish peroxidase (HRP)–conjugated goat anti-human IgG) (KPL #474–1006, USA) was added at 0.5 μg/ml in 2% skim milk/PBS and incubated for 1 h at 37 °C. Following wash with PBS/0.1% Tween20, 50 μl/well of the HRP substrate TMB (ThermoFisher #00-2023) was added and incubated at room temperature for 30 min in the dark. Plates were read with the VersaMax Microplate Reader (Molecular Devices) using the SoftMax Pro 4 software, and results were reported as the optical density measured at 650 nm. At every step the plates were sealed with sealing film (Excel Scientific #100SEALPLT).

Ebola pseudo and live virus neutralization assay

A total of five different species of Ebola pseudovirus (EBOV, SUDV, BDBV, RESTV, and TAFV) were generated by co-transfection of human immunodeficiency virus backbone expressing firefly luciferase (pNL43R-E-luciferase) and expression vectors pcDNA3.1 (Invitrogen) encoding the full-length glycoprotein of each Ebola specie into the 293T cells (ATCC). Viral supernatants were collected 48 h later, and viral titers were measured in luciferase activity in relative light units (Bright-Glo Luciferase Assay vector System, Promega Biosciences). The mutant EBOV glycoprotein was generated by the site-directed mutagenesis on the expression vector encoding the wild type EBOV glycoprotein (Mayinga strain) following the manufacture instructions (Agilent). All mutant clones were confirmed by sequencing. Control envelope glycoprotein from Marburg virus (MARV), human immunodeficiency virus (HIV-CNE30) and vesicular stomatitis virus (VSV) and corresponding pseudoviruses were made in the same manner. Controls mAbs included VRC01, a human neutralizing mAb against HIV-148, c13C6, KZ52, mAb 114 previously isolated neutralizing mAbs against EBOV313949. Neutralization assays were performed by incubating pseudovirus with 8 serial 3-fold dilutions of purified testing mAbs at 37 °C for 1 h. Vero-E6 cells (about 1.5 × 104 per well) (ATCC) were infected in triplicate with the virus-antibody mixture. Neutralizing activities of the testing mAbs was determined by the luciferase activity 48 hours after infection and presented as IC50, IC90, slope calculated by the dose-response inhibition function in GraphPad Prism 5 (GraphPad Software Inc.) and the area under the curve (AUC) determined by MATLAB (MathWorks). The fluorescent neutralization assay was performed in 96-well tissue culture plates (Corning) as previously described2450. The virus, EBOV/May-eGFP (passage 4), was incubated with serial dilution of testing mAbs, ranging from 0.137 to 300 μg/ml, for 1 h at 37 °C in plain DMEM with or without complement (Sigma). Vero-E6 cells (ATCC) at 90–100% confluence were infected in triplicate with the virus-antibody mixture at an MOI of 0.1 TCID50 per cell. Infection was carried out for 1 h at 37 °C, 5% CO2, and the inoculum was then removed and replaced with DMEM/2% FBS. Plates were incubated for 72 h before fluorescent intensities of GFP were measured using a Synergy HT microplate reader (Biotek). The median EBOV neutralization concentration was calculated based on a four-parameter curve fitted to the EBOV/May-eGFP fluorescence curves using GraphPad Prism 5.

Antibody binding kinetics, epitope mapping and competition with receptor NPC1 measured by SPR

The binding kinetics and affinity of mAbs to the three purified EBOV antigens GPdM, sGP, and GPcl were analyzed by surface plasmon resonance (SPR) (Biacore T200, GE Healthcare). The purified soluble antigens were covalently immobilized to a CM5 sensor chip via amine group in 10 mM sodium acetate buffer (pH 5.5) for a final RU around 350. All mAbs were cleaved to antigen-binding fragments (Fabs) by incubating with protease Lys-C (Sigma) at a ratio IgG:LysC = 4000:1 (w/w) in 10 mM EDTA, 100 mM Tris/Cl−, pH 8.5 at 37 °C for about 12 hours. SPR experiments were run at a flow rate of 30 ml/min in PBS buffer. The sensograms were fit in a 1:1 binding model with BIA Evaluation software (GE Healthcare). For epitope mapping, two different Fabs were injected sequentially to monitor for additional binding activity to determine whether the two mAbs recognized the separate or closely situated epitopes. For competition experiment with the domain C of NPC1 (NPC1-C), GPcl was immobilized to a CM5 sensor chip via amine group for a final RU around 2000. 1 μM of antibodies were injected onto the chip for 300 seconds until reaching a binding steady-state and then 100 μM of NPC1-C was injected for 60 seconds. The blocking efficacy was determined by the comparison of response units with and without antibodies pre-incubation. NPC1-C was produced and purified as previously reported54.

Electron microscopy analysis of GPdM and Fab interaction

Purified EBOV GPdM was incubated with Fab of the testing mAbs in a molar ratio of 1:4 at 4 °C for about 12 h and the formed complex was purified with size exclusion chromatography. Four microliters of each GPdM-Fab complex at a concentration of ~0.02 mg/ml was applied onto a glow discharged continuous carbon grid (Beijing Xinxing Braim Technology Co., Ltd.). Once enough materials were adsorbed, the grid was treated with filter paper to remove the excess sample, immediately washed twice and incubated with ~4 μl of 1% uranyl acetate (UA) solution for additional 30 s. The grid was then further treated with filter paper to remove the UA, air-dried at room temperature, and examined under an FEI Tecnai F20 electron microscope equipped with an FEG filament and operated at 200-kV acceleration voltage, using a nominal magnification of 50,000× at a pixel size of 0.168 nm.

Electron microscopy image processing

Images were recorded using a Gatan 895 4 k × 4 k CCD camera with an exposure dose of 20–30 e−/Å2. The defocus range used was -1 μm to -3.5 μm. EMAN2 software package61 was used to pick the particles and generate the initial models. Several rounds of reference-free 2D classification and 3D classification were performed to select good particles using the program Relion1.462. The selected particles were then used for the 3D auto-refinement and reconstruction with a C3 symmetry imposed. The resolution of the final map was calculated using the golden standard Fourier shell correlation value at 0.143. EM maps and related materials have been deposited to the EM Data Bank under accession codes EMD-8158, EMD-8159 and EMD-8160. To better interpret the EM maps, crystal structures of the EBOV GPdM (PDB accessing number 3CSY) and a Marburg virus mAb MR78 Fab (PDB accessing number 3X2D) were fitted into the EM density maps with the programs Situs63. The EBOV GPdTM, Fabs c13C6, KZ52 EM map (EMDB accessing number 6153) was fitted with our EM density maps using Chimera64.

Protective efficacy of mAbs in mice

BALB/c mice, 4–6 week old, female and weighing between 15–19 g, were randomly assigned into groups of 5–6 mice. All mice were challenged through intraperitoneal injection (IP) with a dose of 1000 × LD50 mouse-adapted EBOV in 200 μL DMEM. The mAb were given IP once at 1 or 2 days post infection with 100 μg of each individual mAb per mouse. The control group was given the same volume of PBS. All animals were monitored for signs of disease, survival and weight change for 16 days, and survival was monitored for 12 additional days.

Statistical analysis

In Ebola pseudovirus neutralization experiments, half-maximal and ninety percent inhibitory concentrations (IC50 and IC90) as well as inhibitory slope for each mAb were calculated using the dose-response inhibition model in GraphPad Prism (GraphPad Software Inc.). The area under the curve (AUC) for each mAb was determined by MATLAB (MathWorks). In EBOV live virus neutralization experiments, the median neutralization concentration for each mAbs was calculated based on a four-parameter curve fitted to the EBOV/May-eGFP fluorescence curves using GraphPad Prism 5. In mice challenge and protection experiments, differences in survival were calculated for each group compared to those receiving PBS using a log-rank (Mantel-Cox) test in GraphPad Prism 5 with * means P < 0.05 and ** means P < 0.01, respectively.

Additional Information

How to cite this article: Zhang, Q. et al. Potent neutralizing monoclonal antibodies against Ebola virus infection. Sci. Rep. 6, 25856; doi: 10.1038/srep25856 (2016).
  64 in total

1.  Pre- and postexposure prophylaxis of Ebola virus infection in an animal model by passive transfer of a neutralizing human antibody.

Authors:  Paul W H I Parren; Tom W Geisbert; Toshiaki Maruyama; Peter B Jahrling; Dennis R Burton
Journal:  J Virol       Date:  2002-06       Impact factor: 5.103

2.  Endosomal proteolysis of the Ebola virus glycoprotein is necessary for infection.

Authors:  Kartik Chandran; Nancy J Sullivan; Ute Felbor; Sean P Whelan; James M Cunningham
Journal:  Science       Date:  2005-04-14       Impact factor: 47.728

3.  Human asymptomatic Ebola infection and strong inflammatory response.

Authors:  E M Leroy; S Baize; V E Volchkov; S P Fisher-Hoch; M C Georges-Courbot; J Lansoud-Soukate; M Capron; P Debré; J B McCormick; A J Georges
Journal:  Lancet       Date:  2000-06-24       Impact factor: 79.321

4.  Delayed treatment of Ebola virus infection with plant-derived monoclonal antibodies provides protection in rhesus macaques.

Authors:  Gene Garrard Olinger; James Pettitt; Do Kim; Cara Working; Ognian Bohorov; Barry Bratcher; Ernie Hiatt; Steven D Hume; Ashley K Johnson; Josh Morton; Michael Pauly; Kevin J Whaley; Calli M Lear; Julia E Biggins; Corinne Scully; Lisa Hensley; Larry Zeitlin
Journal:  Proc Natl Acad Sci U S A       Date:  2012-10-15       Impact factor: 11.205

5.  Multiple Ebola virus transmission events and rapid decline of central African wildlife.

Authors:  Eric M Leroy; Pierre Rouquet; Pierre Formenty; Sandrine Souquière; Annelisa Kilbourne; Jean-Marc Froment; Magdalena Bermejo; Sheilag Smit; William Karesh; Robert Swanepoel; Sherif R Zaki; Pierre E Rollin
Journal:  Science       Date:  2004-01-16       Impact factor: 47.728

6.  Therapeutic intervention of Ebola virus infection in rhesus macaques with the MB-003 monoclonal antibody cocktail.

Authors:  James Pettitt; Larry Zeitlin; Do H Kim; Cara Working; Joshua C Johnson; Ognian Bohorov; Barry Bratcher; Ernie Hiatt; Steven D Hume; Ashley K Johnson; Josh Morton; Michael H Pauly; Kevin J Whaley; Michael F Ingram; Ashley Zovanyi; Megan Heinrich; Ashley Piper; Justine Zelko; Gene G Olinger
Journal:  Sci Transl Med       Date:  2013-08-21       Impact factor: 17.956

7.  Antibody-mediated neutralization of Ebola virus can occur by two distinct mechanisms.

Authors:  Devon J Shedlock; Michael A Bailey; Paul M Popernack; James M Cunningham; Dennis R Burton; Nancy J Sullivan
Journal:  Virology       Date:  2010-03-20       Impact factor: 3.616

Review 8.  The secret life of viral entry glycoproteins: moonlighting in immune evasion.

Authors:  Jonathan D Cook; Jeffrey E Lee
Journal:  PLoS Pathog       Date:  2013-05-16       Impact factor: 6.823

9.  Dose-response curve slope helps predict therapeutic potency and breadth of HIV broadly neutralizing antibodies.

Authors:  Nicholas E Webb; David C Montefiori; Benhur Lee
Journal:  Nat Commun       Date:  2015-09-29       Impact factor: 14.919

10.  Reversion of advanced Ebola virus disease in nonhuman primates with ZMapp.

Authors:  Xiangguo Qiu; Gary Wong; Jonathan Audet; Alexander Bello; Lisa Fernando; Judie B Alimonti; Hugues Fausther-Bovendo; Haiyan Wei; Jenna Aviles; Ernie Hiatt; Ashley Johnson; Josh Morton; Kelsi Swope; Ognian Bohorov; Natasha Bohorova; Charles Goodman; Do Kim; Michael H Pauly; Jesus Velasco; James Pettitt; Gene G Olinger; Kevin Whaley; Bianli Xu; James E Strong; Larry Zeitlin; Gary P Kobinger
Journal:  Nature       Date:  2014-08-29       Impact factor: 49.962

View more
  22 in total

Review 1.  Achieving cross-reactivity with pan-ebolavirus antibodies.

Authors:  Liam B King; Jacob C Milligan; Brandyn R West; Sharon L Schendel; Erica Ollmann Saphire
Journal:  Curr Opin Virol       Date:  2019-03-15       Impact factor: 7.090

Review 2.  The structural basis for filovirus neutralization by monoclonal antibodies.

Authors:  Liam B King; Brandyn R West; Sharon L Schendel; Erica Ollmann Saphire
Journal:  Curr Opin Immunol       Date:  2018-06-22       Impact factor: 7.486

3.  Intramuscular Adeno-Associated Virus-Mediated Expression of Monoclonal Antibodies Provides 100% Protection Against Ebola Virus Infection in Mice.

Authors:  Laura P van Lieshout; Geoff Soule; Debra Sorensen; Kathy L Frost; Shihua He; Kevin Tierney; David Safronetz; Stephanie A Booth; Gary P Kobinger; Xiangguo Qiu; Sarah K Wootton
Journal:  J Infect Dis       Date:  2018-03-05       Impact factor: 5.226

4.  Epitope-focused immunogens against the CD4-binding site of HIV-1 envelope protein induce neutralizing antibodies against auto- and heterologous viruses.

Authors:  Hua Wang; Xiangjun Chen; Dianhong Wang; Chen Yao; Qian Wang; Jiayu Xie; Xuanling Shi; Ye Xiang; Wanli Liu; Linqi Zhang
Journal:  J Biol Chem       Date:  2017-11-29       Impact factor: 5.157

5.  Combinatorial peptide-based epitope mapping from Ebola virus DNA vaccines and infections reveals residue-level determinants of antibody binding.

Authors:  Daniel R Ripoll; Daniel A J Mitchell; Lesley C Dupuy; Anders Wallqvist; Connie Schmaljohn; Sidhartha Chaudhury
Journal:  Hum Vaccin Immunother       Date:  2017-09-18       Impact factor: 3.452

6.  In silico-based vaccine design against Ebola virus glycoprotein.

Authors:  Raju Dash; Rasel Das; Md Junaid; Md Forhad Chowdhury Akash; Ashekul Islam; Sm Zahid Hosen
Journal:  Adv Appl Bioinform Chem       Date:  2017-03-21

7.  Successful post-exposure prophylaxis of Ebola infected non-human primates using Ebola glycoprotein-specific equine IgG.

Authors:  Oleg V Pyankov; Yin Xiang Setoh; Sergey A Bodnev; Judith H Edmonds; Olga G Pyankova; Stepan A Pyankov; Gabor Pali; Shane Belford; Louis Lu; Mylinh La; George Lovrecz; Valentina A Volchkova; Keith J Chappell; Daniel Watterson; Glenn Marsh; Paul R Young; Alexander A Agafonov; Jillann F Farmer; Victor E Volchkov; Andreas Suhrbier; Alexander A Khromykh
Journal:  Sci Rep       Date:  2017-02-03       Impact factor: 4.379

8.  An adenovirus serotype 2-vectored ebolavirus vaccine generates robust antibody and cell-mediated immune responses in mice and rhesus macaques.

Authors:  Yupeng Feng; Chufang Li; Peiyu Hu; Qian Wang; Xuehua Zheng; Yongkun Zhao; Yi Shi; Songtao Yang; Changhua Yi; Ying Feng; Chunxiu Wu; Linbing Qu; Wei Xu; Yao Li; Caijun Sun; Fu Geroge Gao; Xianzhu Xia; Liqiang Feng; Ling Chen
Journal:  Emerg Microbes Infect       Date:  2018-06-06       Impact factor: 7.163

9.  Neutralization of Zika virus by germline-like human monoclonal antibodies targeting cryptic epitopes on envelope domain III.

Authors:  Yanling Wu; Shun Li; Lanying Du; Chunyu Wang; Peng Zou; Binbin Hong; Mengjiao Yuan; Xiaonan Ren; Wanbo Tai; Yu Kong; Chen Zhou; Lu Lu; Xiaohui Zhou; Shibo Jiang; Tianlei Ying
Journal:  Emerg Microbes Infect       Date:  2017-10-11       Impact factor: 7.163

Review 10.  Ebola virus disease: an update on post-exposure prophylaxis.

Authors:  William A Fischer; Pauline Vetter; Daniel G Bausch; Timothy Burgess; Richard T Davey; Robert Fowler; Frederick G Hayden; Peter B Jahrling; Andre C Kalil; Douglas L Mayers; Aneesh K Mehta; Timothy M Uyeki; Michael Jacobs
Journal:  Lancet Infect Dis       Date:  2017-11-15       Impact factor: 25.071

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.