Literature DB >> 27081314

Tracking Diacylglycerol and Phosphatidic Acid Pools in Budding Yeast.

Suriakarthiga Ganesan1, Brittney N Shabits1, Vanina Zaremberg1.   

Abstract

Phosphatidic acid (PA) and diacylglycerol (DAG) are key signaling molecules and important precursors for the biosynthesis of all glycerolipids found in eukaryotes. Research conducted in the model organism Saccharomyces cerevisiae has been at the forefront of the identification of the enzymes involved in the metabolism and transport of PA and DAG. Both these lipids can alter the local physical properties of membranes by introducing negative curvature, but the anionic nature of the phosphomonoester headgroup in PA sets it apart from DAG. As a result, the mechanisms underlying PA and DAG interaction with other lipids and proteins are notoriously different. This is apparent from the analysis of the protein domains responsible for recognition and binding to each of these lipids. We review the current evidence obtained using the PA-binding proteins and domains fused to fluorescent proteins for in vivo tracking of PA pools in yeast. In addition, we present original results for visualization of DAG pools in yeast using the C1 domain from mammalian PKCδ. An emerging first cellular map of the distribution of PA and DAG pools in actively growing yeast is discussed.

Entities:  

Keywords:  diacylglycerol; fluorescent binding probes; glycerolipid metabolism; phosphatidic acid; signaling

Year:  2016        PMID: 27081314      PMCID: PMC4824325          DOI: 10.4137/LPI.S31781

Source DB:  PubMed          Journal:  Lipid Insights        ISSN: 1178-6353


Introduction

Lipids are active components of signal transduction pathways that regulate cell survival and cell death. Key to the operative role of lipids as signaling molecules is their low abundance in membranes and the informational outcomes of their interactions with proteins and other lipids. The efficacy of signals mediated by lipid messengers is intimately interconnected with their metabolism. The localization of biosynthetic and catabolic enzymatic systems that produce lipid messengers is a first determinant of their cellular distribution. In addition, lipid messengers can be traded between membranes of different cellular compartments, and some can undergo transbilayer and lateral movements in a given membrane. Of particular interest for this review is the spatiotemporal regulation of two glycerolipid messengers, phosphatidic acid (PA) and diacylglycerol (DAG) (Tables 1 and 2). Pioneering studies conducted 35 years ago on the role of DAG as activator of the serine/threonine protein kinase C (PKC) have revolutionized our view of lipids as second messengers and bioactive molecules.1–4 This recognition was comparatively delayed for PA,5–7 which has more recently emerged as an intracellular lipid mediator of a large number of effector proteins.8 Besides their role in signal transduction pathways, PA and DAG are the precursors of the entire array of cellular glycerolipids, including membrane phospholipids (PLs) and triglycerides.9 Although production of PA and DAG as lipid messengers has been initially associated with PL turnover through regulation of phospholipases,10 it is clear now that biosynthetic systems are also critical components of these signaling circuits.9,11–14 Furthermore, the regulated interconversion of PA and DAG in space and time provides the versatility needed for the signal to be dynamic and transient. The aim of this study is to review the current evidence supporting the existence of different PA and DAG pools in eukaryotes, focusing on studies performed in budding yeast. In addition, we analyze the emerging cellular map of their localization obtained using fluorescent probes combined with live microscopy and the impact that alteration of metabolic pathways has on their distribution.
Table 1

Lipid shapes and curvature.

LIPIDSHAPECURVATURE
LysolipidsInverted cone Positive
PC, PI, PSCylindrical Neutral
PA, DAG, PECone Negative

Notes: Lipids introducing positive, neutral, and negative curvatures into bilayers have inverted cone, cylindrical, and cone shapes, respectively.16 Cylindrical shape depends on the unsaturation and the length of acyl chains. In the case of PA, changes in pH and Ca2+ concentrations can modulate its shape.

Abbreviations: DAG, diacylglycerol; PA, phosphatidic acid; PC, phosphatidylcholine; PE, phosphatidylethanolamine; PI, phosphatidylinositol; PS, phosphatidylserine.

Table 2

Similarities and differences between PA and DAG in budding yeast.

PHOSPHATIDIC ACIDDIACYLGLYCEROL
Structure
Lipid shape         Cone induces negative curvature
Speciesa,24,25,9626:0; 26:128:0; 28:1    30:0; 30:1; 30:2  32:1; 32:2  34:1; 34:2  36:1; 36:2
Headgroup chargeNegativeDeprotonated: −2Protonated: −1Neutral
Abundanceb8–10 mol% (cell extract)24,962 mol% (TGN/E)45,9710 mol% (PM)454% total PL (PM)980.6–2% total PL (mito)984% total PL (ER)982% total PL (vacuole)981.8% total PL (LD)354–6 mol% (cell extract)24,9610 mol% (TGN/E)45,97n.d. (PM)45
Transbilayer movement26NoRapid “flip flop” without protein assistance
Interaction with effector proteinsElectrostatic/hydrogen bond switch model65No consensus sequence8Specific, mediated by C1 consensus domain55,59
Proposed rolespH sensor68Fusion (prospore formation)74,99Mediates membrane recruitment of Pah1 (ER),50 Opi1 (ER),11 Spo20 (PM)73Mitochondrial protein biogenesis100Fusion (vacuole)20Regulates protein secretion44Membrane recruitment of Pkc1 is controversial60,61

Notes:

Common PA and DAG species, most abundant species are in bold.

Unless otherwise indicated, abundance is expressed as mol% of all yeast lipids, including glycerolipids, sphingolipids, and ergosterol.

Abbreviations: PL, phospholipids; TGN/E, trans-Golgi network/endosomes; PM, plasma membrane; LD, lipid droplet; mito, mitochondria; n.d., non detected.

PA and DAG: Structural Similarities and Critical Differences

PA and DAG are simple glycerolipids with acyl chains attached to the sn-1 and sn-2 positions of the glycerol backbone through ester linkages. The free sn-3 hydroxyl group represents the headgroup of DAG, while a phosphate is attached to this sn-3 position in PA as a phosphomonoester. This anionic headgroup is a defining feature of PA that distinguishes it from DAG and other PLs.15 In both PA and DAG, the polar headgroup has a smaller transversal section than that of the hydrophobic moiety, resulting in a cone molecular shape under physiological conditions (Tables 1 and 2).16,17 Therefore, small amounts of PA or DAG in bilayers introduce negative curvature, and this change in membrane architecture plays a critical role in the recruitment of proteins and in the fusion and fission processes of cellular membranes.15,17 Interestingly, DAG is able to promote the fusion of protein-free liposomes18 and has been identified as an essential lipid responsible for vacuolar fusion in yeast.19,20 It is important to recognize that eukaryotes possess a remarkable diversity of PA and DAG species, varying in acyl chain length and number of double bonds.10,21 Moreover, unique and sometimes opposite biological effects have been associated with PA or DAG, depending on their degree of saturation/unsaturation.2,12,22 This holds true even in the case of budding yeast Saccharomyces cerevisiae,23 which is a relatively simple eukaryote with a discrete complement of glycerolipid acyl chains mostly composed of C16:0, C16:1, C18:0, and C18:1.24 Lipidomic analysis of wild-type yeast grown in standard defined medium conditions revealed that PA and DAG represented a minimum of 8 and 4 mol% of total lipids, respectively, and the most abundant species contained at least one monounsaturated fatty acyl (MUFA) chain (16:1–18:1, 16:1–16:1, 16:0–16:1, and 16:0–18:1; Table 2).24 Interestingly, a recent study showed that while MUFA-containing PA species dominated all phases of yeast growth in rich medium, DAG displayed a different profile during exponential growth phase, where species containing MUFA were almost as abundant as those containing saturated fatty acyl chains.25 This unique profile of DAG in the exponential phase probably reflects a pool of DAG derived from phosphatidylinositol (PI), which is the PL that serves as precursor for the synthesis of complex sphingolipids (SLs) in the Golgi during active growth.25 Throughout postdiauxic and stationary growth phases, MUFA-containing DAG species become dominant, coinciding with the profile observed for PA species and divergent from those of PI, which display a MUFA/saturated fatty acyl ratio close to one, regardless of the phase of growth.25 Another unique feature of DAG is that in great contrast to PA, DAG moves freely across transbilayer membranes in a process called flip flop without protein assistance.26,27 Biophysical studies using model membranes have shown that insertion of DAG induces a change from lamellar to hexagonal structures and this is dependent on the amount of DAG present in the bilayer.26,28 Recent findings report that a pool of DAG is constitutively present at basal level in the outer leaflet of the plasma membrane of mammalian cells, and the movement of this DAG pool to the inner leaflet can be reduced by the presence of sphingomyelin in the outer leaflet.29,30 These studies demonstrate that the distribution of DAG in cells can be asymmetrical and regulated by its surrounding environment.

Sources of PA and DAG in Budding Yeast

De novo synthesis of PA is initiated by two sequential acylations of glycerol 3-phosphate (G3-P) using acyl-CoA as acyl donor. G3-P acyltransferases catalyze the acylation at position sn-1 producing lysophosphatidic acid (LysoPA). LysoPA is further acylated at the sn-2 position by a separate acyltransferase to produce PA. Alternatively, the pathway can be initiated by acylation of dihydroxyacetone phosphate (DHAP), which requires an extra step for the reduction of 1-acyl DHAP to LysoPA. PA can be either (i) dephosphorylated to produce DAG for the synthesis of phosphatidylcholine (PC) and phosphatidylethanolamine (PE) through the Kennedy pathway or for the synthesis of triacylglycerol for energy storage or (ii) converted to cytidine diphosphate (CDP)-DAG for the synthesis of PI as occurring in all eukaryotic cell types and for the synthesis of phosphatidylserine (PS) in yeast.9 PS can in turn be decarboxylated to PE, and PE can be sequentially methylated to produce PC. The endoplasmic reticulum (ER) is the main organelle where de novo synthesis of PA and DAG takes place. It is known that PA made in the ER is transported into mitochondria for the synthesis of mitochondrial lipids phosphatidylglycerol and cardiolipin. The recently identified lipid transfer complex Ups1Mdm35 mediates this movement and is conserved from yeast to humans.31,32 In addition to ER contact sites, mitochondria also interact with the vacuole (yeast lysosome) through the newly discovered vacuole and mitochondria patch complex.33 Mitochondria depend on having one of these contact sites, as the deficiency of one causes expansion of the other, and deletion of both is lethal.33 Lipid droplets (LDs) originate from the ER and are also known to closely interact with mitochondria as well as peroxisomes.34 Interestingly, the complete biosynthetic pathway to make PA from G3-P or DHAP associates with LDs,35–37 opening the possibility that the enzymes of this route could piggyback on LDs to reach mitochondria. Vacuoles on the other hand could provide a source of PA and DAG from glycerolipid turnover as this organelle is known to host phospholipases (PI-phospholipase C [PLC] and PC-PLD)19,33 and to breakdown LDs (Fig. 1).38
Figure 1

PA and DAG distribution in yeast. PA and DAG font size reflects abundance of pools of these lipids in different cellular compartments, based on data obtained by combined subcellular fractionation and lipidomics approaches (Table 2). Relevant contact sites between organelles for PA/DAG conversion or transport are highlighted with a green star. Arrows involved in PA/DAG conversions reflect the presence of associated enzymatic activities in that compartment: (1) Nuclear vacuolar junction, presence of PA phosphatase Pah1 and endoplasmic reticulum (ER) localized Dgk1; (2) Vacuole, presence of PA phosphatase Dpp1 and phospholipases. It is not clear if Dgk1 localizes to the vacuole; (3) Golgi, presence of PA phosphatase Lpp1. Large pool of DAG is produced by complex sphingolipid biosynthesis; (4) Plasma membrane/actin patches (blue lines), presence of PA phosphatase App1; (5) PA transport into mitochondria is mediated by Ups1-Mdm35. Putative sources of mitochondrial PA are denoted by a question mark.

Abbreviations: CDP-DAG, CDP-diacylglycerol; Cer, ceramide; DAG, diacylglycerol; ER, endoplasmic reticulum; IM, inner membrane; LD, lipid droplet; MAM, mitochondria-associated membrane; OM, outer membrane; PA, phosphatidic acid; PI, phosphatidylinositol; PL, phospholipid; Px, peroxisome; SLs, sphingolipids; TAG, triacylglycerol; vCLAMP, vacuole and mitochondria patch.

An additional DAG pool that results from synthesis of complex SLs is located in the Golgi apparatus. The yeast pathway consumes PI and ceramide made in the ER, while producing inositol-based complex SLs and DAG in the Golgi. It has been proposed that this pool of DAG regulates the G1-to-S transition and proliferation of yeast cells.39 Interestingly, this biosynthetic pathway has the potential of controlling the balance between DAG and ceramide pools, which are two bioactive lipids with antagonistic effects on cell proliferation.40 Ceramide is made in the ER and transported to the Golgi by mechanisms involving vesicular and nonvesicular transport,41 but is not clear if DAG produced in the Golgi is traded in this process. Involvement of DAG in Golgi-to-ER transport through the formation of COPI vesicles has been described in mammalian cells.42 The importance of this pool of DAG is underscored by the essential role of the PI/PC transfer protein Sec14, which regulates protein secretion and DAG homeostasis in the Golgi.43,44 While DAG levels are high in the Golgi (10 mol%) and decrease along the secretory pathway, PA is gradually enriched, displaying moderate abundance in the Golgi (2 mol%) and reaching its maximum concentration at the plasma membrane (10 mol%) (Fig. 1).45 The PA pool detected along the secretory pathway is probably the result of PL turnover catalyzed mainly by Spo14, the yeast phospholipase D (PLD) that generates PA from PC,46 which has been shown to localize to endosomes and plasma membrane in this organism.47,48 It is worth noting that a pathway dependent on PL-remodeling enzymes generates PA in the Golgi of mammalian cells.49 Although these enzymes are conserved in S. cerevisiae, their potential contribution to a Golgi-localized PA pool in yeast has not been studied.

PA and DAG Interconversion

The dephosphorylation of PA to form DAG and the conversion of DAG to PA are catalyzed by the enzymatic activities of phosphatidate phosphatases (PAPs) and DAG kinases, respectively. Investigations conducted in yeast by Carman et al have been at the vanguard of the identification of genes coding for these critical enzymes that control PA and DAG balance in eukaryotes.13,50,51 Four PAP enzymes have been identified to date in yeast. Two integral membrane PAPs are localized to the vacuole (Dpp1) and Golgi (Lpp1), while the other two (Pah1 and App1) are soluble enzymes recruited to membranes to access PA.50,51 Association of Pah1 with membranes is highly regulated through phosphorylation and plays a critical role in the de novo glycerolipid biosynthetic pathway.9,50 Pah1 has been detected at the nucleus–vacuole (NV) junction,52 vacuolar membrane,53 and in the nucleus.54 App1 is the latest PAP discovered, proposed to play a role in endocytosis due to its association with cortical actin patches.51 In contrast to the many PAP isoforms, only one DAG kinase (Dgk1) localized mainly to the ER has been identified in yeast.13 The presence of such array of enzymes in all these cellular compartments further supports the existence of distinct PA and DAG pools at these locations (Fig. 1).

PA and DAG Effector Proteins of Budding Yeast

Although PA and DAG are alike in the fact that they are nonbilayer-forming lipids that introduce negative curvature in cellular membranes, recruitment of proteins by these signaling lipids is notoriously different. An outstanding difference among PA and DAG effector proteins is the conservation of their lipid-binding domains. In the case of DAG, a conserved binding module known as C1 domain (protein kinase C homology 1)55 mediates its specific recognition, while PA-binding proteins do not have a conserved primary amino acid sequence for lipid recognition (Table 3), making it exceptionally difficult to identify them using bioinformatics approaches.
Table 3

Sequence of binding domains used to visualize pools of PA and DAG in yeast.

PROTINREF
PA binding
Opi1 basic domain [109–138]KRQKLSRAIAKGKDNLKEYKLNMSIESKKR 11
Spo20[51–91] (no consensus)MDNCSGSRRRDRLHVKLKSLRNKIHKQLHPNCRFDDATKTSDDKC 73
DAG binding
C1-PKCδpKCδC1ApKCδC1BConsensus 102, 103

Notes: Minimum sequence that binds PA is in bold, while amino acids that have been shown to be directly involved in PA recognition are underlined. Helical wheel representations of the amphipathic helices were obtained using EMBOSS-Pepwheel.101 The C1δ used in this review is shown. The light and dark gray shades in the tandem C1 domain indicate the sequence of the C1A and C1B regions, respectively. Amino acids conserved in the C1 domains of PKC isoforms α, β, γ, ε, ζ, and θ are highlighted in red.

The conserved DAG-binding module consists of a cysteine-rich zinc finger-like domain, first identified in rat PKCγ.56 Mutagenesis and deletion studies have demonstrated that the C1 domain is essential for DAG binding.2,3,57 Most proteins have two C1 domains, namely C1A and C1B (Table 3), while some can have up to three.55 Each C1 domain generally consists of approximately 50 amino acid residues,55 and to date close to 60 different C1 domains have been identified in proteins ranging from lipid and protein kinases to scaffolding proteins.58 Structural studies revealed that C1 domains are composed of a helix folded around two Zn2+ ions and two antiparallel β-sheets, forming two flexible loops that generate a binding pocket into which DAG is inserted.59 It has been proposed that DAG recruits effector proteins by altering their surface nature and by stabilizing membrane-inserted states rather than by inducing conformational changes.59 The only yeast protein that contains a C1 domain is the yeast ortholog of the mammalian PKC named Pkc1, but the competence of this enzyme to bind DAG still remains controversial.60,61 In great contrast to DAG, the phosphomonoester of the PA headgroup is the first key characteristic of PA that aids in protein-binding specificity.15 Over 20 PA-binding proteins have been described in mammalian, yeast, and plant cells.62,63 In general, the identified PA-binding regions of PA effectors usually contain clustered basic, positively charged amino acid residues. One exception to this requirement of basic residues is the ABI1 plant protein phosphatase 2C-like protein.64 Effector proteins containing amino acids with primary amines, such as lysine and arginine, can act as hydrogen bond donors, while the phosphomonoester of PA acts as a hydrogen bond acceptor, as proposed by the electrostatic/hydrogen bond switch theory.65 In this model, hydrogen bonding results in the destabilization of the proton of the phosphate headgroup causing the proton to dissociate, therefore increasing the negative charge of PA from −1 to −2.15,65 Because of this unique hydrogen-bonding property, it is speculated that PA has the ability to sense changes in physiological pH of cellular compartments, thereby altering the affinity of PA effector proteins.66 The pKa of the phosphomonoester is between 6.9 and 7.9, meaning that the phosphate headgroup can be either protonated or deprotonated, depending on its localization and cellular conditions, such as pH and calcium concentration.15,67 According to the electrostatic/hydrogen bond switch model, PA-binding proteins will have an overall higher affinity for deprotonated, more negatively charged PA than the protonated form.65,66 The overall charge of PA will change as pH increases or decreases, which in turn will be detected by PA effectors to fine-tune biological outcomes. This phenomenon gives PA a unique signaling function and has been proposed to operate in the case of the yeast transcriptional repressor Opi1 (see Opi1 section).68,69 PA can be considered the only cone-shaped anionic lipid in the cell, differentiating it from other anionic lipids such as PS and PI (Table 1). Exposed hydrophobic residues on effector proteins would be able to insert into the membrane bilayer in the space created between the lipid headgroups.62,69 This penetration would contribute not only to increased binding but also to acyl chain recognition by the PA effector protein.23 The two most studied PA-binding proteins in yeast are Opi1 and Spo20 (Table 3). Interestingly, the PA-binding sequences for both of these proteins have a possible overlap with a nuclear localization signal, which suggests that nuclear traffic and PA recognition may be coupled.62

Opi1

Opi1 is a transcriptional repressor, which is normally held at the cytoplasmic leaflet of the ER membrane when cells are grown in the absence of inositol.11 Cooperative binding to PA and the ER membrane protein Scs2 is responsible for Opi1 association with the ER. Upon addition of inositol, synthesis of PI is induced via the CDP-DAG pathway, which consumes PA. This results in depletion of the initial pool of PA in the ER.11 As PA levels decrease, Opi1 is no longer retained at the ER membrane and translocates to the nucleus. Once in the nucleus, Opi1 represses the Ino2/4 transcriptional activator complex,70 which controls the expression of more than 30 genes, many of them involved in glycerolipid metabolism and inositol biosynthesis.11,70 A region of 30 residues containing 11 lysines and arginines in the N-terminal domain of Opi1 was found to be critical in binding PA (Table 3).11 Using point mutations to alanine, six of these basic residues were identified to have the strongest effect on PA binding, most likely because of electrostatic interactions.11 In addition, it has recently been shown that Opi1 preferentially binds shorter chain and more saturated PA species.23 This finding indicates that not only the headgroup but also the acyl chains of PA are critical in the binding of Opi1 to the ER membrane. It is hypothesized that the headgroup recognition is only the first level of interaction between PA and effector proteins. The second level is due to the cone shape of PA to allow for the insertion and subsequent interaction with the acyl chains.15,23 A member of the Opi1 transcription factor family in the yeast Yarrowia lipolytica, Yas3, has also been recently identified to bind to PA.71 Yas3 and Opi1 share only partial sequence similarity in their PA-binding region; however, basic amino acid residues were also identified in Yas3 to be critical for PA binding.71 The binding of Opi1 to PA provides further support of the PA electrostatic/hydrogen bond switch-binding model.15 Under standard growth conditions, yeast cells maintain a close to neutral (~7.0) cytosolic pH, however cytoplasmic acidification can be induced in response to starvation.72 Under conditions of cytosolic acidification, it was found that many lipid metabolic genes were repressed.68 This was shown to be caused by decreased Opi1 binding to PA, leading to the proposal that decreased pH alters the protonation state of PA, resulting in a reduced lipid–protein binding and nuclear translocation.68 Further support to the hypothesis of PA acting as a pH biosensor and a regulator of lipid synthesis in response to nutrient availability69 came from recent investigations showing that membrane recruitment of Pah1 is also regulated by changes in cytosolic pH in response to growth signals.52

Spo20

Spo20 is a meiosis-specific subunit of the t-target soluble N-ethylmaleimide sensitive factor attachment protein receptor (t-SNARE) complex, which is involved in the fusion of vesicles for the formation of the prospore membrane during yeast sporulation.73 Under standard growth conditions, Spo20 is localized to the nucleus; however, once the sporulation cascade begins, it translocates to the plasma membrane, likely by binding to PA.73 A stretch of 40 amino acids, Spo20[51-91] (Table 3) containing both hydrophobic and basic residues were predicted to form an amphipathic α-helix, which positively regulates Spo20 by binding to PA.73 Within this helix, the following five residues were identified to be critical for PA binding: a leucine residue that is also required for Spo20 activity and four basic residues (Table 2).73 For proper function, Spo20 requires an active Spo14.73 This specific pool of PA generated by this PLD appears to be required to properly localize Spo20 during sporulation.74 This involvement of PA in the regulation of membrane fusion interactions has been identified in multiple independent studies in both mammalian and yeast cells.63

Visualizing PA and DAG Pools in Yeast

Opi1, Spo20, and their PA-binding domains fused to green fluorescent protein (GFP) have been extensively used to track PA pools in yeast.13,68,73,75 GFP–Spo20[51-91] localizes to the plasma membrane and nucleus in actively growing cells.73,75 In addition, this PA-binding reporter localizes to aberrant enlarged perinuclear ER when yeast or bacterial DAG kinase is overproduced.13,73 The localization of this fluorescent probe was shown to be altered in conditions of cytosolic acidification.68 On the other hand, full-length Opi1 associates with the perinuclear ER when cells are grown in the absence of inositol, but this localization is dependent not only on its PA-binding domain but also on binding to Scs2.69 In contrast to full-length Opi1, and similar to GFP–Spo20[51-91], the basic domain of Opi1 fused to GFP localizes to the plasma membrane in addition to the ER. Therefore, the PA pool located in the plasma membrane could be considered the predominant PA pool in yeast, and cooperative binding to both PA and Scs2 is needed for Opi1 association with the ER membrane. Interestingly, cytosol acidification altered the distribution of both GFP–Spo20[51-91] and Opi1–GFP.11,68 Recent work by Kohlwein et al revealed additional differences in the localization of Opi1 and the Spo20-based reporter to domains of the nuclear ER that are responsible for LD assembly.75 While Opi1 was enriched in these domains upon incubation of yeast with oleate, no such enrichment was detected for the GFP–Spo20[51-91] probe.75 Differences in the recognition of PA acyl chains between these PA-binding reporters could explain their dissimilar behavior.23,75 It should also be noted that recent studies suggest that while Spo20-based membrane sensors respond to small variations of PA, this interaction is greatly influenced by the membrane environment.76 Furthermore, it has been recently postulated that differences in surface tension or membrane curvature can drive the spatial segregation of proteins containing amphipathic helices, such as Opi1 and Spo20, independent of changes in PA.77 Many DAG-sensing probes have been developed to monitor DAG signaling in mammalian cells. Several C1 domains have been fused to fluorescent proteins that can sense DAG in cells.78,79 To our surprise, no record of the use of such tools for tracking DAG pools in live yeast cells could be found in the literature, aside from vacuolar fusion in vitro assays.20 Similar to mammalian PKCs, yeast Pkc1 has a C1 domain; however, its responsiveness to DAG still needs to be conclusively determined. Localization of Pkc1 fused to GFP has been monitored in live yeast cells.80,81 Pkc1–GFP showed a dynamic spatiotemporal localization at the sites of polarized growth.80 Interestingly, the C1 domain of Pkc1 was sufficient for its peripheral localization to buds and bud neck, suggesting that membrane association is probably mediated by recognition of a lipid component that could be DAG.81 In a recent study, several mammalian PKC isoforms were heterologously expressed in a yeast mutant deficient in Pkc1.82 Among all PKCs tested, PKCδ was the only one able to suppress the phenotype displayed by the lack of Pkc1 in relation to the control of the DNA integrity checkpoint.82 The C1 domain of PKCδ (C1δ) is in fact very well characterized and known to bind DAG with high affinity and has been successfully used as a probe fused to GFP in order to monitor DAG in live cells.83–86 We have recently cloned C1δ into a centromeric yeast expression vector under a constitutive promoter for in vivo visualization of DAG pools. Localization of C1δ–GFP was first monitored in different wild-type strains commonly used by the yeast community, grown under standard conditions (Fig. 2). The main localization of this DAG-binding reporter in actively growing cells was the vacuolar membrane, further confirmed by colocalization with FM4-64, which is a fluorescent dye that gets confined to this compartment after entering cells via endocytosis (Fig. 2).87 This localization is consistent with studies done using similar probes to show that DAG localizes to the membrane of isolated vacuoles from yeast cells.19,20 In fact, DAG has been identified as one of the regulatory lipids required for yeast homotypic vacuole fusion.20 Importantly, no changes in vacuolar morphology of wild-type cells due to expression of C1δ–GFP were detected (data not shown). In addition to vacuolar membrane localization, the C1δ probe also associated with the plasma membrane of daughter cells and at the bud neck (Fig. 2). This resembles the localization of yeast Pkc1,80,81 suggesting that this enzyme may indeed be recognizing a unique DAG pool important for polarized growth. In contrast to GFP–Spo20[51-91], C1δ–GFP did not show nuclear localization as determined by colocalization analysis using the nucleolar marker Sik1-RFP (Fig. 3). We then decided to challenge the validity of using this DAG-binding reporter in yeast, by testing if its localization would change in conditions where lipid homeostasis and levels of DAG are known to be altered. Cells lacking the four enzymes responsible for the final step in the synthesis of triglycerides in yeast, namely DAG acyltransferase Dga1, the transacylase Lro1, and the steryl acyltransferases Are1 and Are2 (4Δ quadruple mutant),88–93 accumulate DAG and have defects in both nuclear and peripheral ER membrane organization.52,89 Localization of the C1δ–GFP probe drastically changed when expressed in 4Δ quadruple mutant cells, clearly revealing its association with the expanded nuclear and cortical ER in addition to the vacuolar membrane (Fig. 4). Additionally, the polarized distribution of C1δ–GFP to the plasma membrane of buds and daughter cells significantly decreased in the quadruple mutant (Fig. 4). These results further support the use of C1δ–GFP as a valuable tool to track cytosolic accessible pools of DAG in yeast.
Figure 2

C1δ–GFP localization in wild-type yeast. The tandem C1A–C1B domains of PKCδ (Table 2) fused to GFP (C1δ–GFP)102 were cloned into the p416-GPD (CEN, URA3) vector for constitutive expression in yeast. Wild-type cells (BY4741 and W303-1A) carrying this plasmid were grown to mid-log phase in synthetic defined selective medium at 30°C. For vacuolar membrane staining, cells were incubated with 16 μM FM4-64 (Molecular Probes®) for 15 minutes at 30°C and allowed to grow for an additional 30 minutes before the preparation of slides for imaging immediately after. Cells were imaged live using a Zeiss Imager Z.1 epifluorescence microscope. Arrows point to the nonvacuolar GFP signal detected in the plasma membrane of the bud, while arrowheads point to the bud neck. Scale bar = 2 μm.

Abbreviation: DIC, differential interference contrast.

Figure 3

Comparison of PA and DAG distribution in yeast. Wild-type yeast (BY4741) cells expressing the nucleolar protein Sik1 fused to RFP from the endogenous locus104 was transformed with plasmids carrying C1δ–GFP (CEN, URA3) or GFP–Spo20[51–91] (2 μ, URA3; kindly provided by Neiman et al)73 for the detection of DAG or PA, respectively. Transformants were grown to mid-log phase in synthetic defined selective medium at 30°C. Cells were imaged live using a Zeiss Imager Z.1 epifluorescence microscope. Arrows point to the nonvacuolar GFP signal detected in the plasma membrane of the bud. Scale bar = 2 μm.

Abbreviation: DIC, differential interference contrast.

Figure 4

Changes in the cellular distribution of DAG in cells that lack triglyceride biosynthetic enzymes. (A) A mutant yeast strain lacking the genes coding for Dga1, Lro1, Are1, and Are2 (quadruple mutant, kindly provided by Athenstaedt)93 and its isogenic wild type (BY4741) were transformed with a plasmid carrying C1δ–GFP (CEN, URA3) for the detection of DAG pools. Transformants were grown to mid-log phase in synthetic defined selective medium at 30°C. Cells were imaged live using a Zeiss Imager Z.1 epifluorescence microscope. (B) Inverted color image of the overlay displayed in (A), highlighting the details of the nonvacuolar (magenta) signal associated with the C1δ–GFP probe in wild-type and quadruple mutants. Arrowhead points to the GFP signal detected in the plasma membrane of the bud in wild-type cells, while arrows indicate nonvacuolar GFP signal associated with enlarged ER in mutant cells. Scale bar = 2 μm.

Abbreviation: DIC, differential interference contrast.

Concluding Remarks

A comparison of the cellular distribution map for PA and DAG based on the use of fluorescent reporters revealed unique compartments demarked by the presence of each of these lipids, with the vacuolar membrane emerging as a large reservoir of DAG. It is important to keep in mind that GFP–Spo20[51-91] and C1δ–GFP detect pools of PA and DAG that are facing the cytosolic leaflet of the membranes in the compartments identified but may not have access to PA or DAG metabolically trapped due to channeling within biosynthetic systems. In addition, GFP–Spo20[51-91] localizes to the nucleus, so it could potentially bind to PA of the nuclear envelope localized to the leaflet facing the nucleoplasm. In contrast to the even distribution of PA along the plasma membrane of both daughter and mother cells in actively growing (log phase) conditions, DAG displayed a polarized distribution, enriched in buds and bud neck-associated plasma membrane. The polarized DAG distribution was lost in cells with impaired TAG synthesis (4Δ quadruple mutant), which are known to have growth defects leading to the loss of cell viability when reaching the stationary phase of growth.89 It would be interesting to investigate if the DAG pool detected at the plasma membrane of buds is derived from TAG breakdown. The region where the nuclear envelope juxtaposes with the vacuolar membrane has been named NV junction.94 The structural components of this ER contact site are well characterized and have been shown to control selective microautophagy.95 When nutrients are scarce, NV junctions can expand and proliferate, triggering the degradation of portions of the nucleus in the vacuole.95 The NV junction is a place where Pah1 and Dgk1 may alternate localization and where the PA/DAG ratio could emerge as a critical parameter that integrates ER biosynthetic and vacuolar catabolic lipid pathways. This could also be a critical region for the biogenesis of LDs as we frequently see a LD located at each corner of the NV junction in actively growing cells in the presence of glucose.36 Both PA and DAG are nonbilayer-forming lipids that contribute negative curvature to membranes. Therefore, it is not obvious how changes in the PA/DAG ratio would affect the intrinsic curvature. The most evident consequence of altering a PA/DAG balance is that it would impact the negative surface potential of the membrane and the recruitment of effector proteins. In addition, it could have implications on the asymmetric distribution of these lipids, as the conversion of PA to DAG would allow movement of this lipid precursor to the other leaflets of the membrane. Consistent with this rationale is the idea that phosphorylation of DAG would then lock PA on one leaflet of the membrane. Further investigations using these and new tools that could distinguish between PA and DAG pools in each leaflet of a bilayer in vivo, combined with the power of yeast genetics, should aid in addressing these questions and hypotheses.
  104 in total

1.  Diacylglycerol-induced membrane targeting and activation of protein kinase Cepsilon: mechanistic differences between protein kinases Cdelta and Cepsilon.

Authors:  Robert V Stahelin; Michelle A Digman; Martina Medkova; Bharath Ananthanarayanan; Heather R Melowic; John D Rafter; Wonhwa Cho
Journal:  J Biol Chem       Date:  2005-03-15       Impact factor: 5.157

2.  Control of astrocyte Ca(2+) oscillations and waves by oscillating translocation and activation of protein kinase C.

Authors:  F Codazzi; M N Teruel; T Meyer
Journal:  Curr Biol       Date:  2001-07-24       Impact factor: 10.834

3.  Global analysis of the yeast lipidome by quantitative shotgun mass spectrometry.

Authors:  Christer S Ejsing; Julio L Sampaio; Vineeth Surendranath; Eva Duchoslav; Kim Ekroos; Robin W Klemm; Kai Simons; Andrej Shevchenko
Journal:  Proc Natl Acad Sci U S A       Date:  2009-01-27       Impact factor: 11.205

4.  Osh proteins regulate COPII-mediated vesicular transport of ceramide from the endoplasmic reticulum in budding yeast.

Authors:  Kentaro Kajiwara; Atsuko Ikeda; Auxiliadora Aguilera-Romero; Guillaume A Castillon; Satoshi Kagiwada; Kentaro Hanada; Howard Riezman; Manuel Muñiz; Kouichi Funato
Journal:  J Cell Sci       Date:  2013-11-08       Impact factor: 5.285

5.  Intramitochondrial transport of phosphatidic acid in yeast by a lipid transfer protein.

Authors:  Melanie Connerth; Takashi Tatsuta; Mathias Haag; Till Klecker; Benedikt Westermann; Thomas Langer
Journal:  Science       Date:  2012-10-04       Impact factor: 47.728

6.  Activation of calcium and phospholipid-dependent protein kinase by diacylglycerol, its possible relation to phosphatidylinositol turnover.

Authors:  A Kishimoto; Y Takai; T Mori; U Kikkawa; Y Nishizuka
Journal:  J Biol Chem       Date:  1980-03-25       Impact factor: 5.157

7.  A comparison of the membrane binding properties of C1B domains of PKCgamma, PKCdelta, and PKCepsilon.

Authors:  Sonia Sánchez-Bautista; Senena Corbalán-García; Angel Pérez-Lara; Juan C Gómez-Fernández
Journal:  Biophys J       Date:  2009-05-06       Impact factor: 4.033

Review 8.  Lipids of mitochondria.

Authors:  Susanne E Horvath; Günther Daum
Journal:  Prog Lipid Res       Date:  2013-09-02       Impact factor: 16.195

Review 9.  Metabolism and regulation of glycerolipids in the yeast Saccharomyces cerevisiae.

Authors:  Susan A Henry; Sepp D Kohlwein; George M Carman
Journal:  Genetics       Date:  2012-02       Impact factor: 4.562

Review 10.  Putting the pH into phosphatidic acid signaling.

Authors:  John J H Shin; Christopher J R Loewen
Journal:  BMC Biol       Date:  2011-12-02       Impact factor: 7.431

View more
  6 in total

1.  Arf1 directly recruits the Pik1-Frq1 PI4K complex to regulate the final stages of Golgi maturation.

Authors:  Carolyn M Highland; J Christopher Fromme
Journal:  Mol Biol Cell       Date:  2021-03-31       Impact factor: 4.138

2.  Stepwise gating of the Sec61 protein-conducting channel by Sec63 and Sec62.

Authors:  Samuel Itskanov; Katie M Kuo; James C Gumbart; Eunyong Park
Journal:  Nat Struct Mol Biol       Date:  2021-01-04       Impact factor: 15.369

3.  The molecular recognition of phosphatidic acid by an amphipathic helix in Opi1.

Authors:  Harald F Hofbauer; Michael Gecht; Sabine C Fischer; Anja Seybert; Achilleas S Frangakis; Ernst H K Stelzer; Roberto Covino; Gerhard Hummer; Robert Ernst
Journal:  J Cell Biol       Date:  2018-06-25       Impact factor: 10.539

4.  The MoPah1 phosphatidate phosphatase is involved in lipid metabolism, development, and pathogenesis in Magnaporthe oryzae.

Authors:  Juan Zhao; Peng Sun; Qiping Sun; Renjian Li; Ziting Qin; Gan Sha; Yaru Zhou; Ruiqing Bi; Haifeng Zhang; Lu Zheng; Xiao-Lin Chen; Long Yang; Qiang Li; Guotian Li
Journal:  Mol Plant Pathol       Date:  2022-02-21       Impact factor: 5.663

5.  Excess diacylglycerol at the endoplasmic reticulum disrupts endomembrane homeostasis and autophagy.

Authors:  Dan Li; Shu-Gao Yang; Cheng-Wen He; Zheng-Tan Zhang; Yongheng Liang; Hui Li; Jing Zhu; Xiong Su; Qingqiu Gong; Zhiping Xie
Journal:  BMC Biol       Date:  2020-08-28       Impact factor: 7.431

Review 6.  Beyond Lipid Signaling: Pleiotropic Effects of Diacylglycerol Kinases in Cellular Signaling.

Authors:  Jae Ang Sim; Jaehong Kim; Dongki Yang
Journal:  Int J Mol Sci       Date:  2020-09-18       Impact factor: 5.923

  6 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.