Literature DB >> 26828478

Genome-Wide Identification, Characterization and Expression Analysis of the Chalcone Synthase Family in Maize.

Yahui Han1, Ting Ding2, Bo Su3, Haiyang Jiang4.   

Abstract

Members of the chalcone synthase (CHS) family participate in the synthesis of a series of secondary metabolites in plants, fungi and bacteria. The metabolites play important roles in protecting land plants against various environmental stresses during the evolutionary process. Our research was conducted on comprehensive investigation of CHS genes in maize (Zea mays L.), including their phylogenetic relationships, gene structures, chromosomal locations and expression analysis. Fourteen CHS genes (ZmCHS01-14) were identified in the genome of maize, representing one of the largest numbers of CHS family members identified in one organism to date. The gene family was classified into four major classes (classes I-IV) based on their phylogenetic relationships. Most of them contained two exons and one intron. The 14 genes were unevenly located on six chromosomes. Two segmental duplication events were identified, which might contribute to the expansion of the maize CHS gene family to some extent. In addition, quantitative real-time PCR and microarray data analyses suggested that ZmCHS genes exhibited various expression patterns, indicating functional diversification of the ZmCHS genes. Our results will contribute to future studies of the complexity of the CHS gene family in maize and provide valuable information for the systematic analysis of the functions of the CHS gene family.

Entities:  

Keywords:  chalcone synthase; evolution; expression; genome-wide analysis; maize

Mesh:

Substances:

Year:  2016        PMID: 26828478      PMCID: PMC4783895          DOI: 10.3390/ijms17020161

Source DB:  PubMed          Journal:  Int J Mol Sci        ISSN: 1422-0067            Impact factor:   5.923


1. Introduction

Chalcone synthase (CHS, enzyme commission number: E.C. 2.3.1.74) is an important enzyme which catalyzes the first key step during the progress of flavonoid biosynthesis. CHS condenses three acetate units of malonyl-coenzyme A (malonyl-CoA) with a phenylpropanoid CoA ester (p-coumaroyl-CoA) to generate a chalcone, which is the precursor of various flavonoids [1]. Recent studies about the CHS gene family indicated that generation and loss of genes frequently occurred, and that CHS and non-CHS genes had co-evolved throughout the evolutionary process of angiosperms [2]. The enzyme family is also known as type III polyketide synthases [3], which exist in all the plant species. Members of the CHS family are homodimers of 40–45 kDa subunits, and possess a Cys-His-Asn catalytic triad (CHN) in their active sites [2]. They show similarity in sequences, structures and catalytic principles [3,4]. CHS is a representative of the CHS family. This family also includes other members such as biphenyl synthase [5], 2-pyrone synthase (2-PS) [6], benzalacetone synthase [7], stilbene synthase [8], bibenzyl synthase [9], benzophenone synthase [10], pentaketide chromone synthase [11], octaketide synthase [12] and p-coumaroyltriacetic acid synthase [13]. All these other enzymes have differences from CHS in many aspects, such as the choice of initial substrates, the number of condensation reactions, and the mechanisms by which the resulting intermediates are cyclized and aromatized. Stilbene synthase (STS), which was identified in pines and peanuts, exhibits an identity of >65% with CHS protein sequences and also condenses three acetate units of malonyl-CoA with a phenylpropanoid CoA ester. Unlike CHS, STS cyclizes the intermediate by another pathway, in which CO2 is lost to generate resveratrol, a phytoalexin stilbene. By contrast, 2-PS in gerbera condenses acetyl-CoA with two malonyl-CoA to generate a pyrone, which is converted into antifeedant glucoside metabolites [14]. Therefore, the CHS family together participates in the biosyntheses of various natural products, which play significant roles in flower pigmentation, pollen fertility and protection against UV. CHS genes have been widely studied because of their important functions. A number of aspects on regulation and function of CHS family have been investigated in many plants, including grape [15], Gerbera hybrida [16], apple [17], Oncidium orchid [18], Hypericum sampsonii [10], Arabidopsis [19], Petunia [20] and bean [21]. Two maize CHS genes were previously reported, C2 and Whp [22,23]. Moreover, one anther specific chalcone synthase-like (ASCL) gene (ZmCHSL, NP_001149508) was also reported by Jepson et al. [24]. Products of 15 or even more genes are essential for anthocyanin biosynthesis in maize [25], including CHS gene C2, which probably have a bearing on the production of the anthocyanin pigment [26,27]. The CHS family had also been studied comprehensively in Physcomitrella patens [28]. Recently, the whole genome assembly of maize (Zea mays L. B73) has been completed [29], which made it possible to perform a genome-wide investigation of the CHS family to analyze their evolutionary processes and functional diversification in this species. In our study, we carried out an overall analysis of the CHS family by searching the whole genome of maize. Furthermore, many studies reported that the expression of CHS genes in different plants was induced by a number of biotic and abiotic stress responses [30]. In this study, ZmCHS transcripts were measured and showed enhanced expression after salicylic acid (SA) treatment. Results of this study will provide a new start for the future studies of the functional diversification and evolutionary process of the CHS family in angiosperms.

2. Results

2.1. Identification and Annotation of Chalcone Synthase (CHS) Genes in Maize

Sixty-five candidate CHS protein sequences were identified by querying the maize genome database with the consensus protein sequences of the CHS family. Whereafter, all candidate CHS proteins were investigated for the presence of the Chal_sti_synt_C (PF02797) and Chal_sti_synt_N (PF00195) domains by searching Pfam Datebase [31]. The two domains were predicted to possess molecular function of transferase activity and transferring acyl groups (GO:0016746) according to Gene Ontology [32]. In addition, Chal_sti_synt_N domain possess molecular function of biological process biosynthetic process (GO:0009058). Finally, fifty-one protein sequences were discarded because they lacked the two domains or represented overlapping genes, and 14 non-redundant CHS genes (named ZmCHS01–14) were identified and described (Table 1).
Table 1

The chalcone synthase family genes of maize.

NumberGene NameTranslation ProductMw (Da)Size (aa)pIChromosome
1ZmCHS01GRMZM2G422750_P0343195.594006.334
2ZmCHS02GRMZM2G151227_P0143325.614016.022
3ZmCHS03GRMZM2G175812_P0143006.24025.747
4ZmCHS04AC191551.3_FGP00343065.523965.983
6ZmCHS05GRMZM2G435393_P0143425.833986.283
7ZmCHS06GRMZM2G346095_P0142391.543976.195
8ZmCHS07GRMZM2G009348_P0149692.844728.94
9ZmCHS08GRMZM2G009510_P0144829.174206.084
10ZmCHS09GRMZM2G027130_P0144136.64205.832
11ZmCHS10GRMZM2G114471_P0143556.784055.464
12ZmCHS11GRMZM2G108894_P0145994.514275.357
13ZmCHS12GRMZM2G131529_P0135275.53265.773
14ZmCHS13GRMZM2G477683_P0145574.274218.085
15ZmCHS14GRMZM2G380650_P0242110.413906.921

Mw: molecular mass; pI: isoelectric point.

The chalcone synthase family genes of maize. Mw: molecular mass; pI: isoelectric point.

2.2. Phylogenetic and Structural Analysis of the Putative Maize CHS Proteins

An unrooted phylogenetic tree (Figure 1) was generated by multiple sequence alignment of the protein sequences of all the ZmCHS genes. The ZmCHS genes were classified into four major groups (classes I, II, III and IV) based on the phylogenetic tree, with supported bootstrap values. Subsequently, gene structure (including exons and introns) analysis was done to support the phylogenetic analysis. Additional sequence alignment analysis was conducted to reveal the genetic relationship between the 14 ZmCHSs and C2, Whp and ZmCHSL [22,23,24]. The three gene pairs (ZmCHS01-C2, ZmCHS02-Whp, ZmCHS11-ZmCHSL) showed high identities of 100%, 96.76% and 97.66% respectively in their sequence alignment. Therefore, we confirmed that ZmCHS01 is C2, and ZmCHS02 and ZmCHS11 are likely to be Whp and ZmCHSL, respectively. The schematic structures revealed that most ZmCHS genes exhibited similar gene structures, two exons and one intron. While ZmCHS12 contained only one exon, and ZmCHS10 had multiple exons and introns.
Figure 1

Phylogenetic tree and gene structure of the 14 predicted maize chalcone synthases (CHSs). (A) The unrooted neighbor-joining tree was constructed using the MEGA4.0 program. The bootstrap values, which were produced using 1000 replicates with the pairwise deletion option, are noted at each node; (B) Exon-intron structure was generated using Gene Structure Display Server (GSDS). The exons and introns are indicated by green boxes and gray lines, respectively. The scale at the bottom is in kilobases.

Phylogenetic tree and gene structure of the 14 predicted maize chalcone synthases (CHSs). (A) The unrooted neighbor-joining tree was constructed using the MEGA4.0 program. The bootstrap values, which were produced using 1000 replicates with the pairwise deletion option, are noted at each node; (B) Exon-intron structure was generated using Gene Structure Display Server (GSDS). The exons and introns are indicated by green boxes and gray lines, respectively. The scale at the bottom is in kilobases.

2.3. Conserved Motifs of the Putative ZmCHS Proteins and Sequence Alignment against Other Plant CHSs

Twenty conserved motifs were investigated in the putative CHS proteins of maize (Figure 2). The detailed information of the 20 motifs is listed in Table 2 and also shown in Figure 2. We categorized the 14 ZmCHSs into four classes (Figure 2) according to their phylogenetic relationships. The Chal_sti_synt_C domain was represented by motifs 1 and 8. And the Chal_sti_synt_N domain was represented by motifs 2, 3, 4, 5, 6 and 9 (Table 2). The two domains were highly conserved in almost all of the putative ZmCHS proteins, except that ZmCHS12 lacks part of the Chal_sti_synt_N domain. Motifs 4 and 1 contained Cys164 and His303 and Asn336 respectively of the characteristic catalytic triad (Figure 2, Figure 3 and Table 2). The catalytic triad inherited from the ketoacyl synthase III (KAS III) ancestor [3] is also highly conserved in all of the ZmCHSs (Figure 3). In addition, many motifs were conserved within a subfamily. For example, motif 16 was present in all members of class II. All members of class IV contained conserved motifs 12 and 19. The subfamily-specific motifs might be required for subfamily-specific functions. However, some motifs (motif 1, 2, 4, 5, 6, 7, 8, 10, 11) are distributed in every subfamily. So these motifs might be important for the functions of ZmCHS proteins.
Figure 2

Distribution of 20 conserved motifs in the putative CHS proteins of maize. Motifs in the putative ZmCHS proteins were obtained using the Multiple Em for Motif Elicitation (MEME) web server. The length of each box does not represent the actual size of each motif.

Table 2

Detailed information of the 20 motifs in the putative maize chalcone synthase (CHS) proteins.

MotifWidthBest Possible MatchDomain
150WNDLFWAVHPGGPAILDQVEACLKLQPHKLKASRHVLSEYGNMSSPTVIFChal_sti_synt_C
236EWGRPATDITHLVFCTYSGAHMPGVDWQLASLLGLRChal_sti_synt_N
334NCVYQDEYPDYYFRITKSEHLTDLKEKFKRICHKChal_sti_synt_N
438RTMLYMNGCSGGCAALRVAKDMAENNRGARVLVACAEMChal_sti_synt_N
550IKKRYFHHTEELLREHPEFIDYSMPSLHERQDIMNSAVPELAAAAAQKAIChal_sti_synt_N
631FRPPHEDHPYTLIGQALFGDGAGAVIVGADPChal_sti_synt_N
731VERPIFEMVSASQTMIPDSEHVIDGQLCEDG*
828CEWGVMVGFGPGFTVETMVLHACKKTKKChal_sti_synt_C
921RKWQRADGPATVLAIGTANPPChal_sti_synt_N
1015REIPSLIEENIEQCM*
119VLDELRRRQ*
1229PQEKVVDSYLQESSCDDPDTRAKLQRLCT*
138DAFSPLGI*
1411MAGATVTVEEV*
1511RTLMNKVGIKD*
166LHFNPS*
176IDQFIN*
186VQHWKK*
196INFKLG*
207QIEYSCF*

The detailed information of the 20 motifs are shown in the table, including their width, best possible match sequences, and domains they are contained in; *: represents the motifs that are not included in the domain sequences.

Figure 3

Sequence alignment of ZmCHSs against the other plant CHSs. The first line represents the secondary structure of Medicago sativa chalcone synthase (MsCHS). The blue boxes and red letters represent conserved residues. The red regions represent sequences of strict sequence conservation. The black wave lines and black arrows represent α-helix and β-pleated sheet. The catalytic triad of CHSs, residues connected with CoA-binding and CHS family-specific Pro375 are labeled with blue points, green pentagrams and black quadrangles at the bottom of the sequences, respectively. MsCHS = Medicago sativa (alfalfa) chalcone synthase (P30074); AtCHS = Arabidopsis chalcone synthase (AAB35812.1); PpCHS = Physcomitrella patens chalcone synthase (ABB84527.1).

Distribution of 20 conserved motifs in the putative CHS proteins of maize. Motifs in the putative ZmCHS proteins were obtained using the Multiple Em for Motif Elicitation (MEME) web server. The length of each box does not represent the actual size of each motif. Detailed information of the 20 motifs in the putative maize chalcone synthase (CHS) proteins. The detailed information of the 20 motifs are shown in the table, including their width, best possible match sequences, and domains they are contained in; *: represents the motifs that are not included in the domain sequences. Sequence alignment of ZmCHSs against the other plant CHSs. The first line represents the secondary structure of Medicago sativa chalcone synthase (MsCHS). The blue boxes and red letters represent conserved residues. The red regions represent sequences of strict sequence conservation. The black wave lines and black arrows represent α-helix and β-pleated sheet. The catalytic triad of CHSs, residues connected with CoA-binding and CHS family-specific Pro375 are labeled with blue points, green pentagrams and black quadrangles at the bottom of the sequences, respectively. MsCHS = Medicago sativa (alfalfa) chalcone synthase (P30074); AtCHS = Arabidopsis chalcone synthase (AAB35812.1); PpCHS = Physcomitrella patens chalcone synthase (ABB84527.1). The “gatekeeperphenylalanines connected with CoA-binding at positions 215 and 265 [3] are also conserved. The exceptions to these conservations are ZmCHS04 which contains a lysine substituted for phenylalanine at position 215, and ZmCHS03, -06, -08, -09 and -10 which contain other amino acid residues substituted for phenylalanine at position 265 (Figure 3), which probably led to remarkable functional diversity, such as the choice of the initial substrates. The CHS family-specific Pro375 residues [3] were also maintained in all the ZmCHSs (Figure 3). The secondary structure of the putative maize CHS proteins was analyzed with the secondary structure of Medicago sativa chalcone synthase (MsCHS) as a template using online server PDB and ESpript. An alignment of MsCHS, ZmCHSs and other plant CHSs was also performed using the ClustalW software. All these results indicated that ZmCHSs exhibited high similarity in sequences with MsCHSs and other plant CHSs, suggesting that the CHS family is conserved during the evolutionary process (Figure 3).

2.4. Chromosomal Location, Gene Duplication

A physical map was drawn to show the distribution of ZmCHSs on different chromosomes of maize. The 14 ZmCHSs were located unevenly on chromosome number 1, 2, 3, 4, 5 and 7 (Figure 4). Chromosome 4 contained the largest number of ZmCHSs (four) followed by chromosome 3 (three), and each of chromosomes 2, 5 and 7 contained two ZmCHS genes. Chromosomes 6, 8, 9 and 10 had no CHS genes.
Figure 4

Location of 14 CHS genes on maize chromosomes. The “Chr.” at the top of each bar represent the chromosome number of maize. The location of each CHS gene is indicated by corresponding gene name at the left of corresponding chromosome. The segmental duplicated genes are connected by dashed lines. The scale on the left is in megabases.

Location of 14 CHS genes on maize chromosomes. The “Chr.” at the top of each bar represent the chromosome number of maize. The location of each CHS gene is indicated by corresponding gene name at the left of corresponding chromosome. The segmental duplicated genes are connected by dashed lines. The scale on the left is in megabases. Gene duplication events, including tandem and segmental duplications, are considered as a driving force for the expansion of many gene families during the evolutionary process [33,34]. In this study, two gene pairs (ZmCHS01/02, ZmCHS13/14) were found to be involved in segmental repeats (Figure 4). They shared a similar evolutionary process and were closely related to each other according to their phylogenetic relationships and gene structures (Figure 1). So the two gene pairs were considered as segmental duplications. In contrast, no tandem duplications occurred. To explore the selective constraints among the two pairs of duplicated ZmCHS genes, their ratios of the number of nonsynonymous substitutions per non-synonymous site (Ka) to the number of synonymous substitutions per synonymous site (Ks) (Ka/Ks) were calculated (Table 3). In general, a Ka/Ks ratio of >1 represents positive selection with promoted evolution; a ratio of 1 represents neutral selection and a ratio of <1 represents negative or purifying selection. In our study, Ka/Ks ratios of the two pairs of duplicated CHS genes were <1, indicating that after the gene duplication events, these duplicated ZmCHS genes evolved under purifying selection with narrow functional divergence (Table 3, Figure 5). Because some positive selection might be shielded by strong purifying selection, a sliding-window analysis for each pair of duplicated ZmCHS genes was also carried out in order to obtain the Ka/Ks ratios at different sites of coding sequences. The results suggested that Ka/Ks ratios of the CHS conserved domains including Chal_sti_synt_C domain and Chal_sti_synt_N domain were <1, suggesting negative selection effect (Table 3, Figure 5). We speculated that purifying selection might have contributed for the maintenance of function in maize CHS family to some degree.
Table 3

Ka/Ks analysis for the duplicated ZmCHS paralogs.

Duplicated PairsKaKsKa/KsPurifying Selection
ZmCHS01-ZmCHS020.0150.1550.095Yes
ZmCHS13-ZmCHS140.0270.220.123Yes
Figure 5

Sliding window plots of duplicated CHS genes. The gray blocks, from dark to light, indicate the positions of the Chal_sti_synt_N domain and Chal_sti_synt_C domain, respectively. The window size was 150 bp and the step size was 9 bp.

Ka/Ks analysis for the duplicated ZmCHS paralogs. Sliding window plots of duplicated CHS genes. The gray blocks, from dark to light, indicate the positions of the Chal_sti_synt_N domain and Chal_sti_synt_C domain, respectively. The window size was 150 bp and the step size was 9 bp.

2.5. Microarray Analysis of CHS Expression during Maize Development

The expression patterns of genes are usually related to their function. To obtain the expression patterns of maize CHS genes, the maize microarray data by Sekhon et al. [35] were downloaded and analysed. The expression patterns of the 14 ZmCHS genes in diverse organs at different developmental stages were investigated by cluster expression profiles (Figure 6). The results revealed that the expression patterns of CHS genes were diverse. The majority of the CHS gene family members showed little expression in most maize tissues, including seeds, leaves, endosperm and embryo. The exceptions to this were ZmCHS01/02, which showed elevated levels of constitutive expression in seeds and all stages of leaves development (Figure 6).
Figure 6

Clustering of expression profiles of 14 ZmCHS genes. Different organs/tissues are exhibited below each column. 24H, 24 h after imbibition; DAS, days after sowing; GH, growth hormone; SAM, Shoot apical meristem; V3, Vegetative 3, three fully extended leaves; V5, Vegetative 5, five fully extended leaves; VT, Vegetative tasseling, last branch of the tassel fully emerged; R2, Reproductive 2, 10–14 days after silk emergence; DAP, days after pollination. The names of ZmCHS genes are displayed at the right side of each row. The colour box from blue to orange indicate an increased expression level.

Clustering of expression profiles of 14 ZmCHS genes. Different organs/tissues are exhibited below each column. 24H, 24 h after imbibition; DAS, days after sowing; GH, growth hormone; SAM, Shoot apical meristem; V3, Vegetative 3, three fully extended leaves; V5, Vegetative 5, five fully extended leaves; VT, Vegetative tasseling, last branch of the tassel fully emerged; R2, Reproductive 2, 10–14 days after silk emergence; DAP, days after pollination. The names of ZmCHS genes are displayed at the right side of each row. The colour box from blue to orange indicate an increased expression level.

2.6. Expression Levels of Maize CHS Genes in Response to Salicylic Acid Treatment

Expression of the CHS genes can be stimulated by various biotic and abiotic elicitors including light, infection, mechanical wounding and plant hormones [36,37,38]. Therefore, we examined the expression levels of the ZmCHSs in response to abiotic stress by subjecting maize seedlings to salicylic acid. No expression was detected for four genes (ZmCHS04, -09, -10, -11); therefore, the remaining 10 maize CHS genes were chosen for further qPCR analysis. The result revealed diverse expression patterns following salicylic acid treatment. As shown in Figure 7, the expression levels of the 10 ZmCHSs were compared to untreated plants and were induced or repressed by this stress treatment, albeit some induction was slight. After salicylic acid treatment, the expressions of ZmCHS01, -02, -03, -05, -07 and -12 were highly induced at a relatively early stage (1 h after treatment), while expressions of ZmCHS13 and -14 peaked at 6 h after treatment. We noted that the expression of ZmCHS06 was down-regulated following salicylic acid treatment at all time points. Interestingly, the expression patterns of the segmental duplicated genes (ZmCHS01/02) displayed high similarity after salicylic acid treatment. Analogously, the expression patterns of the other segmental duplicated genes (ZmCHS13/14) exhibited similarity and both peaked at 6 h after treatment.
Figure 7

Expression patterns of 10 ZmCHS genes after salicylic acid treatment. Relative expression levels of ZmCHS genes in response to salicylic acid were examined by qPCR and normalized by the expression of Maize Actin 1 (NM_001136991.1). The y-axis represents the relative expression level and the x-axis represents the time course of stress treatment. Seedlings were sampled at 0, 1, 3, 6, 12, 24, 36 and 48 h after salicylic acid treatment. There were three technical replicates for each of the three biological replicates.

Expression patterns of 10 ZmCHS genes after salicylic acid treatment. Relative expression levels of ZmCHS genes in response to salicylic acid were examined by qPCR and normalized by the expression of Maize Actin 1 (NM_001136991.1). The y-axis represents the relative expression level and the x-axis represents the time course of stress treatment. Seedlings were sampled at 0, 1, 3, 6, 12, 24, 36 and 48 h after salicylic acid treatment. There were three technical replicates for each of the three biological replicates.

3. Discussion

The CHS gene family plays important roles in the growth and development of plants. Most plant genomes contain smaller CHS gene families. For example, in Petunia hybrida, eight complete CHS genes and four partial genes have been cloned and sequenced [39,40]. Six CHS genes were identified in Ipomoea [41]. At least eight CHS members were identified in pea (Pisum sativum) [42]. In this study, 14 CHS genes were identified in maize, which is one of the largest numbers of CHS family members identified in one organism to date, and is approximately consistent with previously reported numbers (15 or more) [25]. It is considered that gene duplications have led to the wide expansion of the gene family during evolutionary process. The genome of maize has gone through several rounds of duplications early in its evolutionary progress [43,44]. Two segmental duplication events were found among the 14 ZmCHS genes. Thus, around 29% of ZmCHS genes arose from the duplicated chromosomal regions. In contrast, no tandemly duplicated genes were found. These results suggested that segmental duplication was the dominating contributor for the expansion of maize CHS family. It was previously reported that there were 13 members encoding active CHS or CHS-like enzymes in physcomitrella patens CHS family [28], indicating that the ancient ancestors of plants already contained many CHS genes. So we speculated that a part of the 10 non-replicated ZmCHS genes might have arisen from the CHS genes of the ancestor moss. In addition, two maize CHS genes (C2 and Whp), and one anther specific chalcone synthase-like (ASCL) gene (ZmCHSL, NP_001149508) were previously reported [22,23,24]. Analysis of the sequence alignment between the 14 genes and C2, Whp and ZmCHSL (NP_001149508) were conducted, and the high identities allowed us to conclude that ZmCHS01 is C2, and ZmCHS02 and ZmCHS11 are likely to be Whp and ZmCHSL, respectively. All ZmCHS genes could be broadly classified into four major classes: Classes I, II, III and IV based on their phylogenetic relationships. The motif distribution by Multiple Expectation Maximization for Motif Elicitation (MEME) was basically consistent with the phylogenetic analysis. The members in the same subfamily usually shared subfamily-specific conserved motifs. Furthermore, the two domains Chal_sti_synt_C and Chal_sti_synt_N, defined by motif distribution, were highly conserved in almost all of the ZmCHS genes, suggesting conserved evolution. Motifs 1 and 4 include the catalytic triad of CHN and are considered to be very important for the catalytic function. The catalytic triad inherited from the KAS III ancestor [3] are highly conserved in all of the ZmCHSs. There are some substitutes at positions Phe215 and Phe265, which are connected with CoA-binding [3]. These substitutions probably resulted in the different choice of the substrate. All the ZmCHSs contain the CHS family-specific Pro375 [3] (Figure 3), indicating the conserved evolution. Furthermore, the sequence alignment of the putative maize CHS proteins with MsCHS and other plant CHSs exhibited high similarity in sequences, suggesting that the CHS family are conserved in different species. The gene structure analysis not only supported the phylogenetic analysis, but also revealed that the CHS genes were highly conserved during the evolutionary process of maize. In this study, most of the CHS genes (12 of 14) contained two exons and one intron, which was consistent with the previously proposed structure comprising two exons and one intron [45]. The gene duplication events also implied the conserved evolution of maize CHS genes. Previous studies suggested that the genome of maize has gone through several rounds of duplication. The duplication included an ancient genome duplication about 50–70 million years ago (Mya) when the grass genomes had not yet diverged, leading to the ancient tetraploid ancestry, another whole genome duplication approximately five Mya after the divergence of sorghum and maize and a recent duplication event [29,46,47,48]. In general, tandem duplications contribute to generate new genes [49]. However, segmental duplications tend to disperse gene copies [49], leading to them evolving slowly [33,50]. In this study, the presence of segmental duplications among the CHS genes indicates that this gene family is conserved and slowly evolving in maize. Gene expression patterns are an important aspect of the study of gene function, and genes with similar expression patterns may have common features, be regulated by the same gene, or possess a common origin [51,52]. High-throughput microarray technology provides a good platform for the study of genome-wide gene expression patterns. The transcription profiles of maize revealed that the gene expression levels were highly diverse among tissues, with a variation ranging from 10% to 744% [35]. In this study, the majority of ZmCHS gene family members showed little expression in most maize tissues, except for ZmCHS01/02. Most ZmCHS genes exhibited variable expression patterns, suggesting functional diversification of ZmCHS genes. In addition, along with multiple functions of CHSs, the expression of these genes might occur under specific environments or is specific to an organ or developmental stage. For example, the expression of certain CHS genes in plants is affected by methyl jasmonate (MeJA), abscisic acid (ABA), salicylic acid (SA) [30] and light [28]. Moreover, many genes exhibited similar expression patterns, which might in turn catalyze similar substrates in the same biochemical pathway. In conclusion, the expression profiling in this study provides an important basis for further studying of expression and biological functions of the CHS gene family in maize. The growth and development of plants is usually threatened by stresses from surroundings, such as drought, low temperature and high salinity during their life cycles. A lot of stress-related genes were induced to adapt to these environmental stresses [53,54]. The CHS family has been demonstrated to be regulated by salicylic acid treatment [30]. However, no CHS genes responding to salicylic acid stress have been reported in maize. Thus, we performed a survey of the expression patterns of the CHS genes in maize under salicylic acid stress. In this study, four CHS genes (ZmCHS04, -09, -10, -11) showed no detectable expression, which was also clearly shown in the heat map. The expression patterns of the other 10 maize CHS genes were investigated under salicylic acid treatments. The results suggested that all ten genes were responsive to salicylic acid treatment. More than half of the genes were highly expressed at a relatively early stage (1 h after treatment), and showed similar expression patterns. This indicated that these genes might execute their functions simultaneously. By contrast, the expression levels of a small number of genes peaked at six h after treatment, indicating that these genes are involved in a late-stage response to salicylic acid. In addition, the down-regulated gene ZmCHS06 might also have specific functions in maize under salicylic acid treatment, such as defense [55]. We hypothesized that most CHS genes play essential roles in response to abiotic stresses such as salicylic acid. This conclusion was supported by the close relationship of ZmCHS to PaCHS, whose expression was also increased after salicylic acid treatment [30]. These results indicated that most CHS genes were induced by salicylic acid and might contribute to the defense against abiotic stresses or disease resistance [55,56,57] in maize. We noted that the two pairs of duplicated genes, ZmCHS01/02 and ZmCHS13/14 had very similar expression patterns in response to salicylic acid treatment. This indicated that the duplicated genes might have redundant functions in response to the abiotic stress. In addition, the Ka/Ks ratios of the two segmental duplication pairs were <1, indicating purifying selection, which confirmed our conclusion that the duplicated CHS genes mainly went through narrow functional divergence after duplication events. In this study, we report our findings on the gene architecture, evolution and expression response to salicylic acid of the CHS genes in maize. In conclusion, the conservation and diversity of the CHS family genes make maize a model system for further studying of the functions, regulation and evolution of the CHS family.

4. Materials and Methods

4.1. Identification and Sequence Analysis of CHS Proteins in Maize

Firstly, we downloaded the complete gene sequences and protein sequences of maize from the database [58], and built a local database using the DNATOOLS software (Savita Shanker, FL, USA). We obtained the conserved domain sequences of the CHS family using Hidden Markov Model (HMM) while searching the Pfam [31]. Subsequently, this conserved domain sequences were employed to search for all CHS proteins in the local protein database using the BlastP program (Savita Shanker, FL, USA) (p-value = 0.001). Pfam and SMART [59] were then used to authenticate each CHS protein, which was key for the identification of the valid CHS proteins. We aligned all the candidate CHS sequences using ClustalW software (Kyoto University Bioinformatics Center, Kyoto, Japan) [60] and excluded potential redundant sequences. Finally the non-redundant CHS genes were obtained for further analysis. In addition, we calculated the molecular mass (Da) and isoelectric point (pI) of every protein using ExPASy (SIB Swiss Institute of Bioinformatics, Lausanne, Switzerland).

4.2. Phylogenetic Analysis

Protein sequence alignment was performed using the Clustal X program (Des Higgins, DUB, Ireland). Then, phylogenetic tree was built using the NJ (neighbor-joining) method with bootstrap 1000 using MEGA 4.0 (Koichiro Tamura, TKY, Japan [61]. According to the phylogenetic relationships, we classified the ZmCHS genes into subfamilies.

4.3. Analysis of Conserved Motifs, Gene Structure and Sequence Alignment

We investigated the conserved motifs in each putative ZmCHS protein using the MEME web sever [62]. The following parameters were set: width of motif is ≥6 and ≤200 and maximum number of motifs to find is 20. In addition, the gene structure analysis, including exon and intron, was performed by comparing the gene sequences with the predicted coding sequences using Gene Structure Display Server (GSDS) [63]. The crystal structure of alfalfa CHS [64] has revealed the configuration of amino acid residues in many active sites. Studies on the structure and function of the MsCHS protein have been thorough and comprehensive. So we used the secondary structure of MsCHS as a template to analyze the secondary structures of maize CHSs using the online server Protein Data Bank (PDB) [65] and ESpript [66]. An alignment of alfalfa CHS, ZmCHSs and other plant CHS proteins was performed using the ClustalW software (Kyoto University Bioinformatics Center, Kyoto, Japan).

4.4. Chromosomal Locations and Gene Duplication

The physical map of the ZmCHS genes was drawn by using MapInspect [67], according to their positions on the chromosomes of maize. The MCScan software [68] was used to identify the duplicated ZmCHS genes. The maize whole-genome sequences were downloaded to our local server and were analyzed using an all-versus-all Basic Local Alignment Search Tool (BLAST) search with an E-value less than 1 × 10−5. Subsequently, the MCScan software was used to analyze the synteny regions [68]. The pairs of genes located in these duplicated regions were considered as segmental duplication gene pairs and were indicated on the physical map.

4.5. Microarray Analysis of CHSs in Maize

Publically available transcriptome data by Sekhon et al. [35] were obtained to examine the expression patterns of ZmCHS genes. The gene expression patterns in roots, seeds, leaves, endosperm and embryo were drawn using R/Bioconductor [69].

4.6. Plant Material and Salicylic Acid Stress Treatment

To measure the expression levels of CHS genes under abiotic stress, the seeds of maize inbred line B73 were grown in the greenhouse at 28 ± 2 °C with a 14 h light/10 h dark photoperiod. After three weeks, the leaves of the maize (five-leaf stage seedlings) were sprayed with 100 mM salicylic acid solution and sampled at 0, 1, 3, 6, 12, 24, 36 and 48 h after treatment. There are three biological replicates for each sample.

4.7. RNA Isolation and Quantitative Real-Time PCR (qPCR) Analysis

The leaves of the maize seedlings sprayed with salicylic acid solution were sampled at 0, 1, 3, 6, 12, 24, 36 and 48 h after treatment for RNA isolation. Total RNA was extracted according to the CTAB method [70]. Then DNaseI (Invitrogen, Shanghai, China) was used to remove residual DNA, followed by reverse-transcription using Moloney Murine Leukemia Virus (M-MLV) reverse transcriptase (Invitrogen, Shanghai, China). The ABI 7300 Real-Time system (Applied Biosystems, Foster, CA, USA) was used to perform the qPCR (quantitative real-time PCR). Primer Express 3.0 software (Applied Biosystems, Foster, CA, USA) was used to design the specific primers for amplifying each ZmCHS gene (Table S1). Each reaction contained a system of 20 µL including 12.5 µL of SYBR Green Master Mix reagent (Applied Biosystems), 400 nM specific primers and 1.5 µL of cDNA. The qPCR reaction conditions were set as follows: 95 °C for 10 min; followed by 40 cycles at 95 °C for 15 s and 60 °C for 1 min. Subsequently, a melting curve was formed to check the specificity of the genes. The qPCR was carried out with three technical replicates for each of the three biological replicates. The expression level of the maize Actin 1 gene was treated as an internal reference. The relative expression level of each gene was calculated as 2 −∆∆ [∆Ct = Ct,Target − Ct,Actin 1; ∆∆Ct = ∆Ct,treatment − ∆Ct,CK (0h)] [71].
  61 in total

1.  p-Coumaroyltriacetic acid synthase, a new homologue of chalcone synthase, from Hydrangea macrophylla var. thunbergii.

Authors:  T Akiyama; M Shibuya; H M Liu; Y Ebizuka
Journal:  Eur J Biochem       Date:  1999-08

2.  Chalcone synthase-like gene in the liverwort, Marchantia paleacea var. diptera.

Authors:  Shuichi Harashima; Hiroyoshi Takano; Kanji Ono; Susumu Takio
Journal:  Plant Cell Rep       Date:  2004-05-28       Impact factor: 4.570

3.  Ancestral grass karyotype reconstruction unravels new mechanisms of genome shuffling as a source of plant evolution.

Authors:  Florent Murat; Jian-Hong Xu; Eric Tannier; Michael Abrouk; Nicolas Guilhot; Caroline Pont; Joachim Messing; Jérôme Salse
Journal:  Genome Res       Date:  2010-09-28       Impact factor: 9.043

4.  Repression and loss of gene expression outpaces activation and gain in recently duplicated fly genes.

Authors:  Todd H Oakley; Bjørn Ostman; Asa C V Wilson
Journal:  Proc Natl Acad Sci U S A       Date:  2006-07-24       Impact factor: 11.205

5.  Improving plant drought, salt, and freezing tolerance by gene transfer of a single stress-inducible transcription factor.

Authors:  M Kasuga; Q Liu; S Miura; K Yamaguchi-Shinozaki; K Shinozaki
Journal:  Nat Biotechnol       Date:  1999-03       Impact factor: 54.908

6.  Structural, functional, and evolutionary analysis of the unusually large stilbene synthase gene family in grapevine.

Authors:  Claire Parage; Raquel Tavares; Stéphane Réty; Raymonde Baltenweck-Guyot; Anne Poutaraud; Lauriane Renault; Dimitri Heintz; Raphaël Lugan; Gabriel A B Marais; Sébastien Aubourg; Philippe Hugueney
Journal:  Plant Physiol       Date:  2012-09-06       Impact factor: 8.340

7.  Structural insight into chain-length control and product specificity of pentaketide chromone synthase from Aloe arborescens.

Authors:  Hiroyuki Morita; Shin Kondo; Satoshi Oguro; Hiroshi Noguchi; Shigetoshi Sugio; Ikuro Abe; Toshiyuki Kohno
Journal:  Chem Biol       Date:  2007-04

Review 8.  Novel flavonoids as anti-cancer agents: mechanisms of action and promise for their potential application in breast cancer.

Authors:  Carlos Martinez-Perez; Carol Ward; Graeme Cook; Peter Mullen; Donald McPhail; David J Harrison; Simon P Langdon
Journal:  Biochem Soc Trans       Date:  2014-08       Impact factor: 5.407

9.  The calcium sensor CBL1 integrates plant responses to abiotic stresses.

Authors:  Verónica Albrecht; Stefan Weinl; Dragica Blazevic; Cecilia D'Angelo; Oliver Batistic; Uner Kolukisaoglu; Ralph Bock; Burkhard Schulz; Klaus Harter; Jörg Kudla
Journal:  Plant J       Date:  2003-11       Impact factor: 6.417

10.  The chalcone synthase multigene family of Petunia hybrida (V30): differential, light-regulated expression during flower development and UV light induction.

Authors:  R E Koes; C E Spelt; J N Mol
Journal:  Plant Mol Biol       Date:  1989-02       Impact factor: 4.076

View more
  29 in total

1.  Organization and evolution of the chalcone synthase gene family in bread wheat and relative species.

Authors:  Anastasia Y Glagoleva; Nikita V Ivanisenko; Elena K Khlestkina
Journal:  BMC Genet       Date:  2019-03-18       Impact factor: 2.797

2.  Genome-wide identification and phylogenetic analysis of the chalcone synthase gene family in rice.

Authors:  Lifang Hu; Haohua He; Changlan Zhu; Xiaosong Peng; Junru Fu; Xiaopeng He; Xiaorong Chen; Linjuan Ouyang; Jianmin Bian; Shiqiang Liu
Journal:  J Plant Res       Date:  2016-11-23       Impact factor: 2.629

3.  Systematic analysis and comparison of the PHD-Finger gene family in Chinese pear (Pyrus bretschneideri) and its role in fruit development.

Authors:  Yunpeng Cao; Yahui Han; Dandan Meng; Muhammad Abdullah; Dahui Li; Qing Jin; Yi Lin; Yongping Cai
Journal:  Funct Integr Genomics       Date:  2018-04-20       Impact factor: 3.410

4.  Genome-wide identification and expression analyses of WRKY transcription factor family members from chickpea (Cicer arietinum L.) reveal their role in abiotic stress-responses.

Authors:  Muhammad Waqas; Muhammad Tehseen Azhar; Iqrar Ahmad Rana; Farrukh Azeem; Muhammad Amjad Ali; Muhammad Amjad Nawaz; Gyuhwa Chung; Rana Muhammad Atif
Journal:  Genes Genomics       Date:  2019-01-12       Impact factor: 1.839

Review 5.  The Research Progress of Chalcone Isomerase (CHI) in Plants.

Authors:  Yan-Chao Yin; Xiao-Dong Zhang; Zhi-Qiang Gao; Ting Hu; Ying Liu
Journal:  Mol Biotechnol       Date:  2019-01       Impact factor: 2.695

6.  Genome-Wide Analysis of Type-III Polyketide Synthases in Wheat and Possible Roles in Wheat Sheath-Blight Resistance.

Authors:  Xingxia Geng; Yihua Chen; Shufa Zhang; Zhen Gao; Shuhui Liu; Qunhui Yang; Jun Wu; Xinhong Chen
Journal:  Int J Mol Sci       Date:  2022-06-28       Impact factor: 6.208

7.  Characterization of the Tomato (Solanum lycopersicum) Pectin Methylesterases: Evolution, Activity of Isoforms and Expression During Fruit Ripening.

Authors:  Bo Wen; Feng Zhang; Xiaozhen Wu; Huan Li
Journal:  Front Plant Sci       Date:  2020-03-03       Impact factor: 5.753

Review 8.  Chalcone synthases (CHSs): the symbolic type III polyketide synthases.

Authors:  Shahzad A Pandith; Salika Ramazan; Mohd Ishfaq Khan; Zafar A Reshi; Manzoor A Shah
Journal:  Planta       Date:  2019-11-27       Impact factor: 4.116

9.  Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).

Authors:  Yunpeng Cao; Yahui Han; Qing Jin; Yi Lin; Yongping Cai
Journal:  Front Plant Sci       Date:  2016-11-24       Impact factor: 5.753

10.  Structural, Evolutionary, and Functional Analysis of the Class III Peroxidase Gene Family in Chinese Pear (Pyrus bretschneideri).

Authors:  Yunpeng Cao; Yahui Han; Dandan Meng; Dahui Li; Qing Jin; Yi Lin; Yongping Cai
Journal:  Front Plant Sci       Date:  2016-12-09       Impact factor: 5.753

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.