| Literature DB >> 26779117 |
Silvia Leon1, Manuel Tena-Sempere2.
Abstract
Reproduction is essential for perpetuation of the species and, hence, is controlled by a sophisticated network of regulatory factors of central and peripheral origin that integrate at the hypothalamic-pituitary-gonadal (HPG) axis. Among the central regulators of reproduction, kisspeptins, as major stimulatory drivers of gonadotropin-releasing hormone (GnRH) neurosecretion, have drawn considerable interest in the last decade. However, the dynamic, if not cyclic (in the female), nature of reproductive function and the potency of kisspeptins and other stimulatory signals of the HPG axis make tenable the existence of counterbalance inhibitory mechanisms, which may keep stimulation at check and would allow adaptation of reproductive maturation and function to different endogenous and environmental conditions. In this context, discovery of the gonadotropin-inhibitory hormone (GnIH) in birds, and its mammalian homolog, RFRP, opened up the exciting possibility that this inhibitory signal might operate centrally to suppress, directly or indirectly, GnRH/gonadotropin secretion, thus reciprocally cooperating with other stimulatory inputs in the dynamic regulation of the reproductive hypothalamic-pituitary unit. After more than 15 years of active research, the role of GnIH/RFRP in the control of the HPG axis has been documented in different species. Yet, important aspects of the physiology of this system, especially regarding its relative importance and actual roles in the control of key facets of reproductive function, remain controversial. In the present work, we aim to provide a critical review of recent developments in this area, with special attention to studies in rodent models, using pharmacological tools and functional genomics. In doing so, we intend to endow the reader with an updated view of what is known (and what is not known) about the physiological role of GnIH/RFRP signaling in the control of mammalian reproduction.Entities:
Keywords: GnIH; GnRH; NPFF receptors; RF9; RFRP; gonadotropins; kisspeptin
Year: 2016 PMID: 26779117 PMCID: PMC4700143 DOI: 10.3389/fendo.2015.00189
Source DB: PubMed Journal: Front Endocrinol (Lausanne) ISSN: 1664-2392 Impact factor: 5.555
RFRP peptides identified in mammals, with bird (quail) sequence provided for comparison.
| Species | Peptide | Sequence | Reference |
|---|---|---|---|
| Mouse | RFRP-1 | VPHSAAN | ( |
| RFRP-3 | NMEAGTRSHFPS | ||
| Rat | RFRP-1 | VPHSAAN | ( |
| RFRP-3 | ANMEAGTMSHFPS | ( | |
| Human | RFRP-1 | MPHSFAN | ( |
| RFRP-3 | VPN | ||
| Bovine | RFRP-1 | SLTFEEVKDWAPKIKMNKPVVNKMPPSAAN | ( |
| RFRP-3 | AMAHLPLRLGKNREDSLSRWVPN | ( | |
| Ovine | RFRP-1 | SLTFEEVKDWGPKIKMNTPAVNKMPPSAAN | ( |
| RFRP-3 | VPN | ||
| Hamster (Siberian) | RFRP-1 | SPAPANKVPHSAAN | ( |
| RFRP-3 | TLSRVPS | ||
| Hamster (Syrian) | RFRP-1 | SPAPANKVPHSAAN | ( |
| RFRP-3 | ILSRVPS | ||
| Quail | GnIH | SIKPSAY | ( |
| GnIH-RP-1 | SLNFEEMKDWGSKNFMKVNTPTVNKVPNSVAN | ( | |
| GnIH-RP-2 | SSIQSLLN | ( |
.
a, terminal amide group (characteristic of RF-amide motif).
Figure 1In (A), a schematic representation of the cascade of proteolytic processing events necessary to generate a RF-amide mature peptide from a precursor protein is shown. Precursor proteins posses N-terminal regions that contain abundant hydrophobic residues, which form the signal peptide sequence. On the other hand, the precursor proteins contain a RFGR/K motif, in which R/K is a basic amino acid residue and G is an amide donor; cleavage of this area forms the terminal RF-amide signature. In (B), the major structural features and sequences are shown of the two major peptides, RFRP-1 and RFRP-3, encoded by the RFRP gene. For RFRP-1, complete sequence homology is detected between hamster, mouse, and rat sequences. For RFRP-3, the mouse sequence is presented, which is similar to that of the rat peptide, except for one amino acid residue. Based on Ref. (4, 14) with modifications.
Summary of the reported effects of the administration of RFRP-3 in mammals.
| Species | RFRP-3 | Reference |
|---|---|---|
| Rat | Anti-RFRP ODN treatment in peri-pubertal rats caused a significant increase in plasma LH, but not FSH, levels | ( |
| RFRP-3 administration to peri-pubertal rats caused a significant decrease in plasma LH levels and significant increase in plasma GH levels | ||
| Central (icv) administration of RFRP-3 significantly reduced plasma LH levels and increased circulating GH, but did not alter plasma levels of FSH, thyroid hormone or cortisol | ( | |
| RFRP-3, but not of RFRP-1, analogs had inhibitory effects on LH and/or FSH levels | ( | |
| RFRP-3 suppressed the pre-ovulatory GnRH/LH surge independently of the prolactin surge | ( | |
| In adult OVX rats, systemic (iv) administration of RFRP-3 lowered plasma LH levels, while icv injections RFRP-3 failed to alter neither the mean levels of LH nor the frequency of the pulsatile LH secretion | ( | |
| In cultured pituitary cells, the suppressive effect of RFRP-3 on LH secretion was not clearly detectable in the absence of GnRH, but in the presence of GnRH, RFRP-3 significantly suppressed LH secretion | ||
| RFRP-3 administration to OVX rats had no detectable effects on basal LH secretion, but inhibited GnRH-stimulated LH secretion | ( | |
| Icv injection of RFRPs increased the plasma levels of ACTH and oxytocin | ( | |
| In adult males, icv injection of RFRP-3 significantly reduced plasma levels of LH and increased GH independently of the time of day; however, it did not alter plasma FSH, thyroid hormone, or cortisol levels | ( | |
| Hamster | In female (OVX) Syrian hamsters, GnIH administration (central or peripheral) rapidly inhibits LH secretion | ( |
| In male Syrian hamsters, acute central injection of RFRP-3 induces c-Fos expression in GnRH neurons and increases LH, FSH, and testosterone secretion | ( | |
| Central (icv) administration of RFRP-1 or RFRP-3 to male Siberian hamsters decreased LH and FSH levels in long-day conditions, but stimulated LH secretion in short-day conditions | ( | |
| Mouse | In electrophysiological studies, an inhibitory effect of RFRP-3 on the excitability of GnRH neurons has been shown in male and female mice | ( |
| RFRP-3 has been shown to lower plasma LH levels | ( | |
| RFRP-3 has been suggested to inhibit testicular steroidogenesis and spermatogenesis, either indirectly through GnRH or by directly influencing germ cell proliferation, survival, and apoptosis | ( | |
| GnIH inhibited follicular development and steroidogenesis in the mouse ovary | ( | |
| Sheep | Peripheral administration of GnIH decreased the amplitude of LH pulses, while GnIH decreased the secretion of LH and FSH | ( |
| Human | RFRP-3 reduced FSH, LH, and forskolin-stimulated progesterone secretion by human granulosa cells | ( |
Summary of the reported effects of RF9 administration on the HPG axis in mammals.
| Species | RF9 | Reference |
|---|---|---|
| Rat | Intravenous treatment with RF9 increased circulating LH levels in ORX male rats, but failed to evoke LH secretion after blockade of GnRH actions | ( |
| Central administration of RF9 evoked a dose-dependent increase of LH and FSH levels in adult male and female rats | ( | |
| Administration of RF9 further augmented the gonadotropin-releasing effects of kisspeptin (duration of responses), and its stimulatory effects were detected despite prevailing suppression of gonadotropin secretion by testosterone or estradiol | ||
| In males, systemic administration of RF9 modestly stimulated LH secretion | ||
| Co-administration of the kisspeptin antagonist, p234, blunted LH responses to RF9 | ( | |
| Mouse | Central (icv) injection of RF9 elicited with robust LH secretory responses in mice | ( |
| LH responses to RF9 were severely blunted in Gpr54 KO mice, with absolute magnitudes that were only one-tenth of WT mice | ( | |
| Central (icv) administration of RF9 induced potent LH responses in ORX mice getting a fixed dose of testosterone, but these were absent in ORX Gpr54 KO mice with similar testosterone replacement | ||
| RF9 blocked the inhibitory effects of NPFF on GnRH neuron pacemaker activity and reversed the inhibitory effects of testosterone on GnRH secretory frequency | ( | |
| Central (icv) administration of RF9 evoked very potent LH secretory responses in mice genetically devoid of NPFF1R | ( | |
| Sheep | Central (icv) and peripheral administration of RF9 induced significant increases in LH plasma concentrations in the ewe, especially in the anestrous season | ( |
Figure 2Schematic diagram of the putative interplay of neurons expressing GnIH/RFRP with key elements of the HPG axis, including pituitary gonadotrophs and hypothalamic GnRH and Kiss1 neurons. A prominent population of GnIH neurons has been identified in the paraventricular nucleus (PVN). On the basis of neuroanatomical studies (e.g., on neuronal projections) and expression analyses (e.g., of receptors), different sites of action of the GnIH/RFRP system have been proposed, as depicted in the scheme. Admittedly, however, the relative importance of the different sites of action might vary between mammalian species. Alike, direct gonadal effects of GnIH/RFRP (not depicted in this scheme) have been proposed also on the basis of experimental data.