Literature DB >> 26561004

Identifying and quantifying two ligand-binding sites while imaging native human membrane receptors by AFM.

Moritz Pfreundschuh1, David Alsteens1, Ralph Wieneke2, Cheng Zhang3,4, Shaun R Coughlin5, Robert Tampé2, Brian K Kobilka3, Daniel J Müller1.   

Abstract

A current challenge in life sciences is to image cell membrane receptors while characterizing their specific interactions with various ligands. Addressing this issue has been hampered by the lack of suitable nanoscopic methods. Here we address this challenge and introduce multifunctional high-resolution atomic force microscopy (AFM) to image human protease-activated receptors (PAR1) in the functionally important lipid membrane and to simultaneously localize and quantify their binding to two different ligands. Therefore, we introduce the surface chemistry to bifunctionalize AFM tips with the native receptor-activating peptide and a tris-N-nitrilotriacetic acid (tris-NTA) group binding to a His10-tag engineered to PAR1. We further introduce ways to discern between the binding of both ligands to different receptor sites while imaging native PAR1s. Surface chemistry and nanoscopic method are applicable to a range of biological systems in vitro and in vivo and to concurrently detect and localize multiple ligand-binding sites at single receptor resolution.

Entities:  

Mesh:

Substances:

Year:  2015        PMID: 26561004      PMCID: PMC4660198          DOI: 10.1038/ncomms9857

Source DB:  PubMed          Journal:  Nat Commun        ISSN: 2041-1723            Impact factor:   14.919


In living cells signalling processes are governed by specific extracellular and intracellular interactions. For example, extracellular ligands binding to cell surface receptors can induce conformational changes that intracellularly transduce signals1. In the cellular membrane, however, hundreds of different, functionally highly versatile receptors are heterogeneously distributed. Furthermore, the functional state of many receptors depends on their dynamic assembly in the cellular membrane, which means that the same type of receptor can bind a ligand strongly, weakly or not at all23. Moreover, because cell surface receptors can often bind a number of different ligands there is a pertinent need to image individual receptors distributed in cellular membranes and to simultaneously quantify their interaction with several ligands. However, so far there is no high-resolution (<3 nm) microscopic method that can achieve this. Such a method would be a valuable tool to characterize the diversity of ligands binding to native membrane receptors and to systematically investigate factors contributing to the functional diversity of receptors. Force–distance curve-based atomic force microscopy (FD-based AFM) combines high-resolution imaging and single-molecule force spectroscopy45. While imaging a biological sample FD-based AFM approaches and retracts the AFM tip pixel by pixel. Each approach and retraction cycle is recorded in a FD curve (Supplementary Fig. 1). Analysing the FD curves provides mechanical properties about the biological sample, relating to adhesion, stiffness, deformation, elastic modulus and energy dissipation. Excitingly, functionalization of the AFM tip allows specific (bio-)chemical interactions to be detected and structurally mapped67. FD-based AFM methods using the AFM tip as a multifunctional toolbox have rapidly progressed in the past few years58. The technology is now ready to image native membrane proteins at nanometre resolution and to map their mechanical properties, electrostatic potential and chemical groups91011. Recently, FD-based AFM was introduced to image native protein complexes at high-resolution (≈3 nm) and to structurally map their specific binding sites1213. To be able to detect specific binding sites FD-based AFM requires tethering a ligand to the AFM tip. While contouring the protein complexes this functionalized AFM tip can then simultaneously measure the interactions of the tethered ligand to the protein. Excitingly, it was recently demonstrated that one antibody tethered to the AFM tip can be applied to distinguish between two different interactions with cell surface proteins14. However, so far it was not possible to image individual membrane receptors and to simultaneously detect their specific interactions with more than one ligand. To address this challenge, we thought of imaging G-protein-coupled receptors (GPCRs) and to simultaneously quantify their binding strength to two different ligands. GPCRs are the largest family of membrane receptors and mediate most cellular responses to hormones and neurotransmitters, as well as being responsible for vision, olfaction and taste1151617. Being able to detect the binding of different ligands to individual GPCRs is of particular interest, because GPCRs even of the same type can coexist in different functional states in the cellular membrane and because most GPCRs can bind different ligands at different strength or affinity318. In principle we could have selected various GPCRs, including the human β2-adrenergic receptor, the adenosine receptor, opioid receptor, the histamine receptor or the dopamine receptor for our studies. However, we decided to focus on the human protease-activated receptor 1 (PAR1), which belongs to the class A subfamily of GPCRs and which natively binds to tethered ligands192021. Thus, tethering this ligand to the AFM tip would enable us to mimic a native-like ligand-binding process to a GPCR. PAR1 is activated by thrombin, which cleaves part of its extracellular N-terminal domain22. The newly formed NH2-SFLLRN sequence of the N terminus acts as a tethered thrombin receptor-activating peptide. This thrombin receptor-activating peptide binds intramolecularly to PAR1, inducing a cascade of conformational changes that lead to the association of G-protein subunits. Such activation of PAR1 by the coagulation protease thrombin initiates the binding of G-proteins, triggering signalling cascades to initiate cellular responses that help to orchestrate haemostasis, thrombosis, inflammation and perhaps tissue repair1922. Once activated, GPCRs rapidly phosphorylate, mainly by the action of G-protein-receptor kinases on serine and threonine residues localized on the third intracellular loop and C terminus23. PAR1 phosphorylation triggers the recruitment of arrestins, which promote the dissociation and hence, inactivation of G-protein signalling, a process referred to as desensitization. In the following we introduce FD-based AFM to image human PAR1s in proteoliposomes and to simultaneously detect their extracellular and intracellular interactions with two ligands. As ligands we tether the native SFLLRN peptide (including the thrombin-cleaved N-terminal end) of human PAR1 and a tris-N-nitrilotriacetic acid (tris-NTA) group to the AFM tip. Whereas the SFLLRN peptide can bind to the extracellular ligand-binding pocket of PAR1, the tris-NTA group can bind to a His10-tag engineered to the intracellular C-terminal end of PAR1.

Results

Introducing AFM tips bifunctionalized with two ligands

To detect specific interactions of a biological sample FD-based AFM contours the sample topography while recording for every topographic pixel at least one FD curve (Supplementary Fig. 1). On functionalizing the AFM tip with one ligand it has been shown that FD-based AFM can detect the binding events of the ligand and localize these specific interactions to the topography of the protein12. In our approach we wanted to contour the topography of human PAR1 proteoliposomes and to simultaneously detect the interaction of the sample with two different ligands (Fig. 1a). Thus, to simultaneously detect the binding of PAR1 to extracellular and intracellular ligands by FD-based AFM, we developed a procedure to bifunctionalize the AFM tip with two different ligands (Fig. 1b). One ligand was the native SFLLRN ligand of PAR1. To mimic as closely as possible the native binding of the ligand to PAR1 we left the SFLLRN peptide at the 28-amino acid (aa)-long N-terminal end of thrombin-cleaved PAR1. The other ligand was a tris-NTA group, which in presence of Ni2+ ions can interact with a His10-tag fused to the intracellular C terminus of the receptor (Fig. 1b–c). Whereas the tris-NTA group shows an affinity Kd to bind the His10-tag of ≈10–30 nM, the SFLLRN ligand shows an affinity for binding PAR1 of ≈200–800 nM (refs 24, 25, 26). To separate unspecific from specific interactions both ligands were covalently attached to a previously amino-functionalized AFM tip via a ≈10-nm-long PEG27 spacer2728.
Figure 1

AFM mapping of two different ligand-binding events using a chemically bifunctionalized AFM tip.

(a) Mapping adhesion forces on membrane proteins using FD-based AFM. When recording an AFM topograph an approach (blue) and retraction (red) cycle between AFM tip and biological sample is performed for every pixel of the image. In each cycle, the cantilever deflection (for example, force) and the distance travelled by the AFM tip is monitored and transformed into an approach and retraction FD curve (Supplementary Fig. 1). (b) Bifunctionalization of the AFM tip. The amino-functionalized Si3N4 AFM tip is functionalized by hetero-bifunctional N-hydroxysuccinimide-PEG27-maleimide linkers to which the thiol bearing thrombin receptor-activating peptide (TRAP) and Ni2+-loaded tris-NTA (tris-Ni2+-NTA) are bound. (c) The membrane-embedded PAR1 reveals an intracellular C-terminal His10-tag (green) and an extracellular TRAP (here the native SFLLRN peptide ligand)-binding pocket (red), which can specifically bind the tris-Ni2+-NTA and the SFLLRN ligands, respectively.

Detecting one ligand binding after the other

After bifunctionalizing the AFM tip, we adsorbed PAR1 proteoliposomes to freshly cleaved mica and imaged the sample in buffer solution by FD-based AFM using the bifunctionalized tip (Fig. 2). To first detect only the interaction of the SFLLRN ligand to PAR1, we used imaging buffer lacking Ni2+ ions, which are needed to coordinate the tris-NTA to the His10-tag. We recorded FD-based AFM topographs with 256 × 256 pixels (2.5 × 2.5 μm2) and one approach and one retraction FD curve per pixel. The exemplified topograph precisely showed the lipid membrane with protrusions corresponding to single and assemblies of several PAR1s (Fig. 2a and Supplementary Fig. 2). The single-layered lipid membrane indicated that on adsorption to mica the proteoliposome opened. Analysing the adhesion detected in each FD curve recorded in the topograph allowed to calculate the adhesion map (Fig. 2b). Correlation of this adhesion map with the topograph localized unspecific interactions of the AFM tip with the supporting mica and specific interactions with the receptors. Characteristic adhesive forces arising from specific interactions were detected at tip-sample distances >7 nm, which correlates to the length of the extended PEG27 linker (≈10 nm) and of the 28-aa-long native N-terminal sequence of PAR1 tethering the SFLLRN ligand to the tip (Fig. 2c and Supplementary Note 1). The variation of the distances at which the rupture forces were detected resulted from SFFLRN ligands being attached at different positions to the AFM tip (Supplementary Fig. 3). In rare cases (<5%), rupture forces were detected at distances longer than the linker system, suggesting that the mechanical force applied to the receptor lifted the soft lipid membrane29. Such force curves were excluded from analysis (Supplementary Note 1). As a further control, we validated the extension profile of every single-adhesion peak detected in a FD curve by fitting the polyethylene glycol (PEG)-polypeptide linker system attaching the SFLLRN ligand to the AFM tip (Supplementary Figs 3,4 and 7). The forces of these adhesion peaks ranged from 35 to 80 pN (Fig. 2d), which is the typical force required to separate ligand–receptor bonds30313233. In several controls, we showed that non-functionalized AFM tips, AFM tips functionalized with only the PEG27 spacer and AFM tips functionalized with the scrambled SFLLRN peptide LFRLSN did not detect specific interactions with the supporting mica or with the PAR1 proteoliposome (Supplementary Figs 5 and 6).
Figure 2

Imaging PAR1 proteoliposomes using bifunctionalized AFM tips and mapping the specific binding of SFLLRN or of tris-NTA ligands.

(a–d) Imaging the proteoliposome and mapping the binding of the SFLLRN ligand to PAR1. (a) AFM topograph of a PAR1 proteoliposome recorded with inactivated tris-NTA (tris-NTA(−)) and active SFLLRN (SFLLRN(+)) ligand. To prevent tris-NTA interacting with the His10-tag of PAR1, experiments were conducted in the absence of Ni2+. (b) Adhesion map showing specific rupture forces on the proteoliposome (dashed) imaged in a. (c) FD curves recording specific interactions in b at distances corresponding to the length of the stretched PEG linker tethering the SFLLRN ligand to the AFM tip. (d) Rupture forces of single SFLLRN–PAR1 bonds range from 35 to 80 pN. (e–h) Imaging the proteoliposome and mapping the binding of the tris-NTA ligand to the His10-tag of PAR1. (e) AFM topograph of the PAR1 proteoliposome recorded with activated tris-NTA (tris-NTA(+)) and blocked SFLLRN (SFLLRN(−)) ligand. To promote tris-NTA binding to the His10-tag and to prevent the SFLLRN ligand binding to PAR1 the experiments were conducted in the presence of Ni2+ and the antagonist BMS. (f) Adhesion map showing specific rupture forces on the proteoliposome (dashed) imaged in e. (g) FD curves recording specific interactions in f. (h) Rupture forces of single tris-NTA–His10-tag bonds range from 65 to 140 pN. The encircled positions of AFM topographs and adhesion maps indicate where specific interactions were detected. Topographic heights (a and e) are indicated by colour bars. Rupture force distributions (c,d,g,h) shown at 5 pN bin size. Images were recorded in 300 mM NaCl, 20 mM HEPES, 25 mM MgCl2, pH 7.2 and if stated 2 μM BMS or/and 5 mM NiCl2. Experiments were repeated six times, each time we prepared a new sample and used different functionalized AFM tips. Scale bars, 500 nm (a,e).

After having detected the binding of the extracellular SFLLRN ligand, we wanted to detect only the intracellular His10 tags fused to the C terminus of the receptor. To promote binding of tris-NTA to the His10-tag, we pre-incubated the bifunctionalized AFM tip with 10 mM NiCl2 and added 5 mM NiCl2 to the imaging buffer. To prevent binding of the SFLLRN peptide to PAR1, we added the PAR1 antagonist BMS-200261 (BMS)26 to the buffer solution. Subsequently, FD-based AFM was used to image the same PAR1 proteoliposome as imaged before for SFLLRN binding (Fig. 2e). It is important to note, that the proteoliposome had a slightly different shape due to membrane mobility. Again, the adhesion map showed unspecific interactions of the bifunctionalized AFM tip with the supporting mica and localized specific interactions to PAR1s imaged in the topograph (Fig. 2f). Specific interactions were detected at tip-sample distances >7 nm, which correlated to the length of the stretched bifunctional PEG27 linker and of the stretched C-terminal end of PAR1 to which the His10-tag has been fused (Fig. 2g and Supplementary Fig. 3)2934. As a further control, we validated the extension profile of every single-adhesion peak detected in a FD curve by fitting the PEG27-polypeptide linker system attaching the tris-Ni2+-NTA ligand to the AFM tip (Supplementary Figs 3,4 and 7). The forces of these adhesion peaks ranged from 65 to 250 pN (Fig. 2h), which is the characteristic force required to separate the bond formed between tris-NTA and His10-tag243536.

Blocking specific interactions of the bifunctionalized tip

Next, we tested the specificity of our bifunctionalized AFM tip by blocking all specific interactions to the PAR1 proteoliposome. To do this, we left the antagonist BMS in the buffer solution and removed Ni2+ by adding 10 mM EDTA, and imaged the proteoliposome using FD-based AFM (Supplementary Fig. 8). The functionalized AFM tip showed unspecific interactions with mica and few unspecific interactions with the proteoliposome. Very rarely, force curves (≈1–2 per adhesion map of 256 × 256 (65,536) curves) showed the signature of a ‘specific interaction'. We attributed these interaction events to rupture forces of tip-tethered SFLLRN peptides bound to single PAR1s. For these specific ligand-binding events, one must assume that, having a dissociation constant of ≈425 nM (ref. 26), single PAR1s spontaneously dissociated from the BMS antagonist. Alternatively, in rare cases BMS may have dissociated from PAR1 while the receptor was being mechanically probed by the AFM tip. However, independent of how rare binding cases may have occurred, this experiment nicely highlights that the high-affinity antagonist BMS inhibits binding of the tethered SFLLRN ligand to PAR1 (ref. 13). In summary, these control experiments demonstrate that the antagonist and removal of Ni2+ successfully blocked both ligands tethered to the AFM tip. The experiments further confirm that the AFM tip was functionalized with both ligands.

Simultaneously detecting two different specific interactions

After having shown that the bifunctionalized AFM tip can either detect the His10-tag or the ligand-binding site of PAR1, we wanted to investigate whether we could use the tip to simultaneously detect both specific interactions. Therefore, FD-based AFM topographs were recorded in physiological buffer solution supplemented with 5 mM NiCl2 (Fig. 3a), which allows both ligands of the bifunctionalized tip to detect specific interactions with PAR1. The adhesion map showed specific interactions with ≈43% (n=56) of the PAR1s topographically imaged (Fig. 3b). After imaging the sample three consecutive times, ≈80% of the PAR1 imaged showed specific interactions with the tethered ligands. These interactions were detected at rupture lengths corresponding to the different PEG27-polypeptide linker systems (Fig. 3c). To distinguish between the rupture events of SFLLRN and tris-NTA ligands we set-up a force filter. As measured above, the strength of the SFLLRN–PAR1 bond ranges from 35 to 80 pN, whereas that of the tris-NTAHis10-tag bond ranges from 65 to 250 pN (Fig. 2 and Supplementary Fig. 9). We thus designed the force filter to discard all rupture events between 65 and 80 pN (Fig. 3d,e). Accordingly, adhesive forces <65 pN were allocated to SFLLRN–PAR1 bonds and forces >80 pN to tris-NTAHis10-tag bonds.
Figure 3

Mapping the binding of two different ligands while imaging PAR1 proteoliposomes.

(a) AFM topograph of a PAR1 proteoliposome. Measurements were performed in the presence of Ni2+ to allow both tip-tethered ligands, the tris-NTA and the SFLLRN peptide to interact with PAR1-binding sites. (b) Adhesion map simultaneously recorded with the topograph (a). Adhesion events detected on the proteoliposome (dashed boundary) categorize into three different interaction force scales: 30–65 pN for the extracellular SFLLRN–PAR1 bond (red), 65–80 pN for the force filter applied (blue) and 80–200 pN for the intracellular tris-Ni2+-NTA–His10-tag bond (green). (c) Selected FD curves showing specific adhesion forces; recorded at areas encircled in a,b. (d) Distribution of forces characterizing the rupture of ligand–receptor bonds. Applying a force filter from 65 to 80 pN (blue) discriminates between both types of specific interactions (red versus green). (e) Distribution of rupture forces of SFLLRN–PAR1 (red) and of tris-NTA–His10-tag (green) bonds recorded in three consecutive images of the PAR1 proteoliposome. (f) PAR1 proteoliposome imaged at higher magnification. Specific interaction sites detected after three consecutive recordings were encircled and colour coded for extracellular SFLLRN–PAR1 (red circles) and intracellular tris-NTA–His10-tag (green circles) interactions. The numbers two and three indicate that the specific interactions were detected two or three times, respectively. Topographic heights (a,e) are indicated by colour bars. Rupture force distributions (c,d,f) shown at 5 pN bin size. Images were recorded in 300 mM NaCl, 20 mM HEPES, 25 mM MgCl2, 5 mM NiCl2, pH 7.2. Experiments were repeated six (a,b) or three (f) times, each time using new sample preparations and functionalized AFM tips. Scale bars, 500 nm (a) and 80 nm (f).

To further increase the probability of detecting ligand binding by all receptors we repeatedly imaged the same proteoliposome at a ≈3.5-fold higher magnification, thereby increasing the number of FD curves (pixels) probed per PAR1. After three consecutive recordings, we observed specific ligand-binding events for ≈90% of the PAR1s. On the basis of the strength of the unbinding events detected, we could assign which of the two ligands bound and, as one binds to the extracellular and the other to the intracellular surface of individual PAR1s, determine the orientation of the reconstituted receptors in the membrane. In larger assemblies of PAR1s we could observe receptors in both orientations (Fig. 3f and Supplementary Fig. 10). This is not surprising since membrane proteins reconstituted into symmetric lipid membranes often show mixed orientations. Although being repeatedly imaged some of the PAR1 receptors neither bound the SFLLRN ligand nor tris-NTA (Fig. 3). One may argue that one must simply increase the number of images taken until these receptors bind the ligand. However, GPCRs in the unbound state or ligand-bound state can reside in different functional states or conformations318. Some of these functional states can bind a particular ligand while others cannot. Thus, one may speculate that the PAR1 molecule to which the ligands cannot bind resides in an inactive state. It may be interesting in the future to characterize the parameters (for example, pH, electrolyte, drugs, proteins and lipids) modulating these conformational states similar to what we observed on addition of the antagonist BMS (Fig. 2). Compared with multicolour fluorescence microscopy imaging, our approach shows that even two distinct functional groups/proteins can be detected and localized at separations ≤5 nm. Such differential imaging of membrane receptors binding to different ligands will be a useful tool to investigate the composition and functional state of membrane–protein complexes in their native environment at unprecedented detail (resolution) and information (binding strength).

Discussion

Here we have introduced the high-resolution (≈3 nm) imaging of a native human GPCR, PAR1, embedded in a functionally relevant membrane environment and simultaneously detected the specific binding of two different ligands. To achieve this goal, we bifunctionalized the AFM tip with one ligand interacting with the extracellular binding site of PAR1 and another ligand interacting with the intracellular surface of PAR1. Using FD-based AFM we imaged PAR1 proteoliposomes and localized specific ligand-binding forces to PAR1s. The introduction of a force filter discriminated between the two specific ligand–receptor bonds and enabled us to classify individual receptors according to the ligand bound. In principle our bifunctionalization approach is not restricted to reconstituted membrane receptors and applicable to force probe a wide variety of biological systems and map their interactions with different ligands or chemical groups at the same time. For example, it has been demonstrated that FD-based AFM can be readily applied to detect specific interactions of individual surface receptors in living cells103337. Thus, the here-introduced approach to functionalize the AFM tip with two ligands may be applied to image living cells by AFM and to simultaneously map two different cell surface molecules. We have applied FD-based AFM to image a GPCR and to measure the forces required to rupture single receptor–ligand bonds. At first sight, these forces cannot be directly related to describe the thermodynamic and kinetic properties of the bond. However, theoretical procedures have been recently introduced, which allow extrapolating the parameters from FD-based AFM data to describe these thermodynamic and kinetic properties383940. Therefore, the rupture forces must be determined over a wide range of pulling velocities. Recently, an experimental approach has been introduced, which applies these theories to extract these parameters from FD-based AFM experiments and to reconstruct the ligand-binding free-energy landscape of GPCRs13. It appears to be a matter of time until this and our approach introduced here can be combined to image GPCRs in cellular membranes and to simultaneously determine their free-energy landscape with more than only one ligand. Such a combined approach may help us in the future to learn understanding the conditions at which a GPCR prefers to bind one ligand against the other. We here used our approach to differentiate between two ligands having different binding strengths to PAR1. But how to differentiate between two linkers binding at the same strength to receptors? The force at which a ligand–receptor bond ruptures depends on the loading rate applied31404142. Thus, to overcome such challenge linker systems having mechanically very different properties may be chosen to apply different loading rates to the individual ligand–receptor bonds and thereby to shift the rupture forces of both bonds to different values. Alternatively, however, one may simply use linker systems having very different lengths to discern between the binding of two different ligands. Taking such or similar approaches and together with a better force resolution, one may in the future even consider increasing the number of ligands that can be simultaneously characterized while imaging single receptors in vitro and in vivo.

Methods

Preparation and reconstitution of PAR1

Wild-type PAR1 was generated with an N-terminal FLAG epitope and 10 histidines (His10-tag) at the C-terminal end to facilitate protein purification. The C terminus of PAR1 was truncated after residue Tyr397, and the N terminus started from residue Ala36. This construct was tested in cell-based assays to ensure that signalling still occurred in response to thrombin activation. PAR1 was expressed in Sf9 cells (Expression Systems) using the pFastBac baculovirus system (Invitrogen). To purify PAR1, infected cells were lysed by osmotic shock in low-salt buffer containing 10 mM Tris-HCl (pH 7.5), 1 mM EDTA, 100 nM vorapaxar derivative and 100 μM tris-(2-carboxyethyl)phosphine (TCEP). The vorapaxar derivative generated by reducing the non-aromatic carboncarbon double bond in vorapaxar showed a much faster dissociation rate than vorapaxar in cell-based assays. PAR1 was further extracted from cell membranes with buffer comprised of 20 mM HEPES (pH 7.5), 500 mM NaCl, 1% dodecyl maltoside (DDM), 0.03% cholesterol hemisuccinate (CHS), 0.2% sodium cholate, 15% glycerol, 100 nM vorapaxar derivative and 100 μM TCEP. Cell debris was removed by high-speed centrifugation. From this point on, 1 μM vorapaxar derivative was added to all buffers used for the purification, except for the buffer used for the size-exclusion chromatography. Ni2+-NTA agarose resin was added to the supernatant after homogenization and stirred for 1 h at 4 °C. The resin was then washed three times in batch with buffer comprised of 20 mM HEPES (pH 7.5), 500 mM NaCl, 0.1% DDM, 0.02% CHS and 1 μM vorapaxar derivative, and transferred to a glass column. Bound receptor was eluted with buffer containing 300 mM imidazole and loaded onto an anti-FLAG M1 affinity column. After extensive washing with buffer comprised of 20 mM HEPES (pH 7.5), 500 mM NaCl, 0.1% DDM, 0.02% CHS, 1 μM vorapaxar derivative and 2 mM Ca2+, the receptor was eluted from M1 resin using the same buffer without Ca2+ but with 200 μg ml−1 FLAG peptide and 5 mM EDTA. Size-exclusion chromatography was employed to obtain the final monodisperse receptor preparation. The running buffer contained 20 mM HEPES (pH 7.5), 100 mM NaCl, 0.1% DDM and 0.02% CHS. The flow rate was set at 0.2 ml min−1 to allow enough time for the vorapaxar derivative to dissociate from the receptor. The purified unliganded PAR1 was then reconstituted at 10 μM in liposomes made of 0.5 mg ml−1 phospholipids (1,2-dioleoyl-sn-glycero-3-phosphocholine) and 0.05 mg ml−1 of the cholesterol analogue CHS43. Vorapaxar-bound PAR1 was prepared as described above except that 100 nM vorapaxar, not its derivative, was used for the lysis and solubilization of cell membranes and 1 μM vorapaxar was used in the following Ni2+-NTA, anti-FLAG M1 affinity and size-exclusion chromatography steps.

AFM tip functionalization

To functionalize the Si3N4 tips of the AFM cantilevers (Biolever Mini, Olympus)2844, they were cleaned with ethanol (10 min), dried with filtered N2 and treated with an ultraviolet radiation and ozone cleaner (Jetlight, CA, USA) for 10 min. For the amino-functionalization, AFM tips were immersed in an 8.1 M ethanolamine solution (ethanol in dimethylsulphoxide) for 16 h. Tips were cleaned 3 × 1 min in dimethylsulphoxide and 2 min in ethanol, rinsed with ethanol and dried with filtered N2. For the linker attachment, the tips were immersed in a solution of maleimidePEG27–N-hydroxysuccinimide (1 mg dissolved in 0.5 ml CHCl3) and 30 μl triethylamine for 2 h. Then, tips were cleaned 3 × 10 min in CHCl3 and dried with filtered N2. A volume of 50 μl of 100 μM of each of the SH-group-bearing functional groups was premixed with 2 μl of 1 M EDTA, 5 μl of 1 M HEPES (pH 7.5), 2 μl of 100 mM TCEP hydrochloride and 2 μl of 1 M HEPES (pH 9.0). This mixture was pipetted onto the cantilevers. After a reaction time of 4 h, the cantilevers were washed in PBS (3 × 5 min) and used within 24 h. Tips functionalized with the tris-NTA group were immersed in 5 mM NiCl2 for 10 min before use. The tris-NTA-thiol compound (mercapto propionic acid tris-NTA) was synthesized following published procedures3545. The cysteine bearing peptide (NH2–SFLLRNPNDKYEPFWEDEEKNESGLTEYRGGGGC–COOH) was purchased (GenSript, USA).

PAR1 preparation for AFM imaging

A 300-fold diluted solution in imaging buffer (300 mM NaCl, 20 mM HEPES and 25 mM MgCl2) of PAR1 reconstituted in liposomes was adsorbed to freshly cleaved mica for 1 h. The adsorbed sample was rinsed with the same buffer five times before AFM imaging in imaging buffer.

FD-based AFM

A Multimode8 AFM with a Nanoscope5 controller (Bruker, Santa Barbara, California, USA) was operated in the ‘PeakForceTapping' mode. The AFM was equipped with a 120-μm piezoelectric scanner (J scanner). Rectangular Si3N4 cantilevers with nominal spring constants of ≈0.04–0.08 N m−1 and a resonance frequency of ≈35 kHz in water were chosen (Biolever Mini, Olympus). All AFM experiments were done in imaging buffer solution at room temperature (≈26 °C). Overview images (2–25 μm) were recorded at 2 kHz oscillation frequency, applying an imaging force of 100–200 pN, scanned at 1 line per s, with a vertical oscillation amplitude of 15 nm and a resolution of 512 × 512 pixels. Adhesion maps were recorded by oscillating the functionalized tip at 0.25 kHz, with an amplitude of 30 nm, and applying an imaging force of 100 pN. Topographs of 256 × 256 pixels were recorded scanning 0.125 line per s. The contact time between tip and sample was ≈1 ms, which corresponds to about one quarter of the oscillation cycle.

Data analysis

The force versus time curves of each interaction recognition experiment were saved and exported as ASCII files. The Matlab software was used to translate force versus time curves into FD curves. FD curves showing specific adhesion events were analysed further. FD curves showing adhesion events at distances much longer than that of the linker system (>>30 nm) were discarded from analysis (Supplementary Note 1). Correlation of topograph and adhesion map allowed assigning the specific adhesion events to individual PAR1s. For better visibility pixels detecting adhesion events have been enlarged.

Control experiments

We performed several control experiments to test whether the functionalization of the AFM tip was successful and whether nonspecific interactions were detected with the sample. Therefore, we imaged the proteoliposomes with an unmodified (Si3N4) AFM tip and recorded adhesion maps (Supplementary Fig. 5a–d). Furthermore, we imaged the sample with a PEG27-maleimide functionalized tip having no functional groups attached to the terminal maleimide group (Supplementary Fig. 5e–h) and having the scrambled SFLLRN peptide LFRLSN attached (Supplementary Fig. 6). In addition, we tested ligand binding in the absence and presence of the full antagonist BMS (Supplementary Fig. 8).

Additional information

How to cite this article: Pfreundschuh, M. et al. Identifying and quantifying two ligand-binding sites while imaging native human membrane receptors by AFM. Nat. Commun. 6:8857 doi: 10.1038/ncomms9857 (2015).
  45 in total

1.  Imaging and quantifying chemical and physical properties of native proteins at molecular resolution by force-volume AFM.

Authors:  Izhar Medalsy; Ulf Hensen; Daniel J Muller
Journal:  Angew Chem Int Ed Engl       Date:  2011-10-17       Impact factor: 15.336

2.  Intrinsic rates and activation free energies from single-molecule pulling experiments.

Authors:  Olga K Dudko; Gerhard Hummer; Attila Szabo
Journal:  Phys Rev Lett       Date:  2006-03-15       Impact factor: 9.161

3.  Theory, analysis, and interpretation of single-molecule force spectroscopy experiments.

Authors:  Olga K Dudko; Gerhard Hummer; Attila Szabo
Journal:  Proc Natl Acad Sci U S A       Date:  2008-10-13       Impact factor: 11.205

4.  High-resolution imaging of chemical and biological sites on living cells using peak force tapping atomic force microscopy.

Authors:  David Alsteens; Vincent Dupres; Sami Yunus; Jean-Paul Latgé; Jürgen J Heinisch; Yves F Dufrêne
Journal:  Langmuir       Date:  2012-11-30       Impact factor: 3.882

5.  Interpreting the widespread nonlinear force spectra of intermolecular bonds.

Authors:  Raymond W Friddle; Aleksandr Noy; James J De Yoreo
Journal:  Proc Natl Acad Sci U S A       Date:  2012-08-06       Impact factor: 11.205

6.  Localizing chemical groups while imaging single native proteins by high-resolution atomic force microscopy.

Authors:  Moritz Pfreundschuh; David Alsteens; Manuel Hilbert; Michel O Steinmetz; Daniel J Müller
Journal:  Nano Lett       Date:  2014-05-05       Impact factor: 11.189

7.  Force-induced formation and propagation of adhesion nanodomains in living fungal cells.

Authors:  David Alsteens; Melissa C Garcia; Peter N Lipke; Yves F Dufrêne
Journal:  Proc Natl Acad Sci U S A       Date:  2010-11-08       Impact factor: 11.205

8.  Cholesterol increases kinetic, energetic, and mechanical stability of the human β2-adrenergic receptor.

Authors:  Michael Zocher; Cheng Zhang; Søren G F Rasmussen; Brian K Kobilka; Daniel J Müller
Journal:  Proc Natl Acad Sci U S A       Date:  2012-11-14       Impact factor: 11.205

9.  Ligand-specific interactions modulate kinetic, energetic, and mechanical properties of the human β2 adrenergic receptor.

Authors:  Michael Zocher; Juan J Fung; Brian K Kobilka; Daniel J Müller
Journal:  Structure       Date:  2012-06-28       Impact factor: 5.006

Review 10.  The structure and function of G-protein-coupled receptors.

Authors:  Daniel M Rosenbaum; Søren G F Rasmussen; Brian K Kobilka
Journal:  Nature       Date:  2009-05-21       Impact factor: 49.962

View more
  17 in total

Review 1.  Imaging modes of atomic force microscopy for application in molecular and cell biology.

Authors:  Yves F Dufrêne; Toshio Ando; Ricardo Garcia; David Alsteens; David Martinez-Martin; Andreas Engel; Christoph Gerber; Daniel J Müller
Journal:  Nat Nanotechnol       Date:  2017-04-06       Impact factor: 39.213

2.  Unraveling the Receptor-Ligand Interactions between Bladder Cancer Cells and the Endothelium Using AFM.

Authors:  Vinoth Sundar Rajan; Valérie M Laurent; Claude Verdier; Alain Duperray
Journal:  Biophys J       Date:  2017-03-28       Impact factor: 4.033

3.  Nanomechanical mapping of first binding steps of a virus to animal cells.

Authors:  David Alsteens; Richard Newton; Rajib Schubert; David Martinez-Martin; Martin Delguste; Botond Roska; Daniel J Müller
Journal:  Nat Nanotechnol       Date:  2016-10-31       Impact factor: 39.213

4.  Toxic HypF-N Oligomers Selectively Bind the Plasma Membrane to Impair Cell Adhesion Capability.

Authors:  Reinier Oropesa-Nuñez; Sandeep Keshavan; Silvia Dante; Alberto Diaspro; Benedetta Mannini; Claudia Capitini; Cristina Cecchi; Massimo Stefani; Fabrizio Chiti; Claudio Canale
Journal:  Biophys J       Date:  2018-03-27       Impact factor: 4.033

5.  Lipid-dependent conformational dynamics underlie the functional versatility of T-cell receptor.

Authors:  Xingdong Guo; Chengsong Yan; Hua Li; Wenmao Huang; Xiaoshan Shi; Min Huang; Yingfang Wang; Weiling Pan; Mingjun Cai; Lunyi Li; Wei Wu; Yibing Bai; Chi Zhang; Zhijun Liu; Xinyan Wang; Xiaohui F Zhang; Chun Tang; Hongda Wang; Wanli Liu; Bo Ouyang; Catherine C Wong; Yi Cao; Chenqi Xu
Journal:  Cell Res       Date:  2017-03-24       Impact factor: 25.617

6.  Entry from the Lipid Bilayer: A Possible Pathway for Inhibition of a Peptide G Protein-Coupled Receptor by a Lipophilic Small Molecule.

Authors:  Michael P Bokoch; Hyunil Jo; James R Valcourt; Yoga Srinivasan; Albert C Pan; Sara Capponi; Michael Grabe; Ron O Dror; David E Shaw; William F DeGrado; Shaun R Coughlin
Journal:  Biochemistry       Date:  2018-08-27       Impact factor: 3.162

7.  Endothelial glycocalyx shields the interaction of SARS-CoV-2 spike protein with ACE2 receptors.

Authors:  Marta Targosz-Korecka; Agata Kubisiak; Damian Kloska; Aleksandra Kopacz; Anna Grochot-Przeczek; Marek Szymonski
Journal:  Sci Rep       Date:  2021-06-09       Impact factor: 4.379

8.  Fundamental High-Speed Limits in Single-Molecule, Single-Cell, and Nanoscale Force Spectroscopies.

Authors:  Carlos A Amo; Ricardo Garcia
Journal:  ACS Nano       Date:  2016-07-06       Impact factor: 15.881

9.  Ligand binding pocket of a novel Allatostatin receptor type C of stick insect, Carausius morosus.

Authors:  Burcin Duan Sahbaz; Osman Ugur Sezerman; Hamdi Torun; Necla Birgül Iyison
Journal:  Sci Rep       Date:  2017-01-24       Impact factor: 4.379

10.  Probing Membrane Receptor-Ligand Specificity with Surface- and Tip- Enhanced Raman Scattering.

Authors:  Lifu Xiao; Karen A Bailey; Hao Wang; Zachary D Schultz
Journal:  Anal Chem       Date:  2017-08-22       Impact factor: 6.986

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.