Uri Manor1, Sadie Bartholomew2, Gonen Golani3, Eric Christenson4, Michael Kozlov3, Henry Higgs5, James Spudich2, Jennifer Lippincott-Schwartz1. 1. Cell Biology and Metabolism Program, Eunice Kennedy Shriver National Institute of Child Health and Human Development, Bethesda, United States. 2. Department of Biochemistry, Stanford University School of Medicine, Stanford, United States. 3. Department of Physiology and Pharmacology, Tel Aviv University, Tel Aviv, Israel. 4. Unit on Structural and Chemical Biology of Membrane Proteins, Eunice Kennedy Shriver National Institute of Child Health and Human Development, Bethesda, United States. 5. Department of Biochemistry, Geisel School of Medicine, Hanover, United States.
Abstract
Mitochondrial division, essential for survival in mammals, is enhanced by an inter-organellar process involving ER tubules encircling and constricting mitochondria. The force for constriction is thought to involve actin polymerization by the ER-anchored isoform of the formin protein inverted formin 2 (INF2). Unknown is the mechanism triggering INF2-mediated actin polymerization at ER-mitochondria intersections. We show that a novel isoform of the formin-binding, actin-nucleating protein Spire, Spire1C, localizes to mitochondria and directly links mitochondria to the actin cytoskeleton and the ER. Spire1C binds INF2 and promotes actin assembly on mitochondrial surfaces. Disrupting either Spire1C actin- or formin-binding activities reduces mitochondrial constriction and division. We propose Spire1C cooperates with INF2 to regulate actin assembly at ER-mitochondrial contacts. Simulations support this model's feasibility and demonstrate polymerizing actin filaments can induce mitochondrial constriction. Thus, Spire1C is optimally positioned to serve as a molecular hub that links mitochondria to actin and the ER for regulation of mitochondrial division.
Mitochondrial division, essential for survival in mammals, is enhanced by an inter-organellar process involving ER tubules encircling and constricting mitochondria. The force for constriction is thought to involve actin polymerization by the ER-anchored isoform of the formin protein inverted formin 2 (INF2). Unknown is the mechanism triggering INF2-mediated actin polymerization at ER-mitochondria intersections. We show that a novel isoform of the formin-binding, actin-nucleating protein Spire, Spire1C, localizes to mitochondria and directly links mitochondria to the actin cytoskeleton and the ER. Spire1C binds INF2 and promotes actin assembly on mitochondrial surfaces. Disrupting either Spire1C actin- or formin-binding activities reduces mitochondrial constriction and division. We propose Spire1C cooperates with INF2 to regulate actin assembly at ER-mitochondrial contacts. Simulations support this model's feasibility and demonstrate polymerizing actin filaments can induce mitochondrial constriction. Thus, Spire1C is optimally positioned to serve as a molecular hub that links mitochondria to actin and the ER for regulation of mitochondrial division.
Mitochondrial division is a complex process that is essential for survival in mammals (Nunnari and Suomalainen, 2012; Archer, 2014) and is facilitated by the actin cytoskeleton (De Vos et al., 2005; DuBoff et al., 2012; Korobova et al., 2013, 2014; Hatch et al., 2014; Li et al., 2015). Two distinct steps define mitochondrial division - an initial constriction of mitochondrial membranes, followed by final membrane scission (Friedman et al., 2011; Korobova et al., 2013; Murley et al., 2013; Korobova et al., 2014). Scission is mediated by the dynamin-related protein, Drp1, which self-assembles on the surface of the mitochondrial outer membrane into helices that drive final mitochondrial division (Lackner and Nunnari, 2009; Archer, 2014). The initial constriction step narrows the mitochondrial tube diameter, which is necessary for Drp1 helix assembly (Labrousse et al., 1999; Yoon et al., 2001; Legesse-Miller et al., 2003; Ingerman et al., 2005; Friedman et al., 2011; Mears et al., 2011; Murley et al., 2013). This step is independent of Drp1 and occurs at ER-mitochondria intersection zones where ER tubules associate with and wrap around the mitochondrial outer membrane along the plane of mitochondrial division (Friedman et al., 2011; Korobova et al., 2013; Murley et al., 2013; Korobova et al., 2014). Along these zones, actin filaments polymerize, providing the force needed for constriction that floppy ER tubules lack (Korobova et al., 2013, 2014; Hatch et al., 2014).Inverted formin 2 (INF2) is a formin family protein that promotes actin filament polymerization in a regulated fashion (Korobova et al., 2013, 2014). An ER-anchored splice isoform of INF2 (usually referred to as INF2-CAAX) (Chhabra et al., 2009; Korobova et al., 2013) has been shown to facilitate mitochondrial constriction and division via its actin polymerization activity (Korobova et al., 2013). Given INF2, but not actin assembly, is localized throughout the ER, how INF2-mediated actin assembly is specifically triggered at ER-mitochondria intersections to ensure mitochondrial division remains an open central question.Spire proteins are membrane-binding actin-nucleators that interact with and regulate formin proteins (Bosch et al., 2007; Quinlan et al., 2007; Pechlivanis et al., 2009; Kerkhoff, 2011; Pfender et al., 2011; Schuh, 2011; Vizcarra et al., 2011; Zeth et al., 2011; Quinlan, 2013; Montaville et al., 2014). Synergistic promotion of actin assembly by Spire and formin proteins has been implicated in driving a variety of processes ranging from vesicle trafficking to DNA repair in the nucleus (Pfender et al., 2011; Schuh, 2011; Montaville et al., 2014; Belin et al., 2015). In these systems, membrane-associated Spire proteins nucleate actin filaments, which are then further polymerized by formin proteins, ultimately leading to actin-dependent translocation. Given these characteristics of Spire proteins, we set out to investigate whether any Spire proteins could be involved in helping promote INF2- and actin-dependent constriction and division of mitochondria at ER-mitochondria association zones.Vertebrates have two known Spire genes, Spire1 and Spire2. Each Spire protein contains highly conserved domains with specific capabilities, including: four actin-monomer binding WH2 domains necessary for nucleating actin filaments; an mFYVE domain that binds to intracellular membranes and facilitates oligomerization (Kerkhoff, 2011; Dietrich et al., 2013); and an N-terminal KIND domain that serves to bind to and regulate formin proteins (Bosch et al., 2007; Quinlan et al., 2007; Pechlivanis et al., 2009; Kerkhoff, 2011; Pfender et al., 2011; Vizcarra et al., 2011; Zeth et al., 2011; Quinlan, 2013; Montaville et al., 2014). Although no Spire proteins have been shown previously to localize to mitochondria or the ER (Dietrich et al., 2013), here we report a previously uncharacterized alternate splice-isoform of Spire1 (named Spire1C) that localizes to mitochondria, promotes actin assembly on mitochondrial surfaces, and interacts with ER-anchored INF2 to regulate mitochondrial constriction and division. Our results support a model where Spire1C and INF2 coordinately drive actin- and ER-dependent mitochondrial division. They also reveal that Spire1C directly links mitochondria to both the actin cytoskeleton and the ER.
Results
Spire1C's previously uncharacterized alternate exon, ExonC, is highly conserved
We identified and characterized a novel alternate splice-isoform of Spire1 that contains KIND and WH2 domains common to all Spire proteins, as well as a previously uncharacterized unique 58 amino acid alternate exon sequence (ExonC) (Figure 1A and see ‘Materials and methods’ and Figure 1—figure supplements 1–3 for details on Spire1C cloning, probe generation, and sequence information). Because of its alternative ExonC sequence, we named the Spire1 isoform Spire1C (Figure 1A). After determining that Spire1C mRNA was present in multiple mouse tissues (Figure 1—figure supplement 3), we examined its presence and conservation among species. Using the UCSC Genome Browser, we searched for additional DNA or mRNA sequences that contain Spire1C (Kent et al., 2002). When compared to mouse, we found striking identity in ExonC for rat, rabbit, human, dog, elephant, opossum, platypus, and chicken. It is not found in the annotated zebrafish sequence. Compared to our amplified mouse sequence of 58 amino acids, human ExonC differs by 2 residues (96% identical), platypus by 8 residues (86% identical), and chicken by 12 residues (79% identical). Sequence homology is strongest among mammals, but chicken maintains conservation that is unlikely to be solely due to chance. Conservation among species extends beyond the coding exon and into the upstream and downstream intronic regions of the gene, stretching ∼150 bases in the 3′ direction (data not shown). These conserved extensions are likely involved in splicing regulation of the exon. The high level of conservation within and surrounding ExonC suggests that its role is indispensible for the health of the organism.
Figure 1.
The Spire1 alternate exon ExonC is necessary and sufficient for localization to mitochondria.
(A) Full length Spire1C domain structure: The number ranges indicate the amino acid regions of the conserved domains probed in this study. (B) Spire1C localizes to mitochondria. myc-Spire1C: U2OS cells cotransfected with myc-Spire1C and mitoRFP show robust localization of myc-Spire1C to mitochondria. α-ExonC: U2OS cells stained with an antibody raised against ExonC (α-ExonC) and expressing mitoRFP show endogenous Spire1C labeling on mitochondria. GFP-ExonC: U2OS cells cotransfected with GFP-ExonC and mitoRFP show robust targeting of GFP-ExonC to mitochondria. myc-Spire1ΔC: U2OS cells cotransfected with myc-Spire1ΔC and mitoRFP show no specific targeting of myc-Spire1ΔC to mitochondria. All cells were fixed and primary antibodies were counterstained with Alexa-488 secondary antibody before imaging with confocal fluorescence microscopy. Scale bars: 10 μm. Inserts are magnifications of the boxed regions.
DOI:
http://dx.doi.org/10.7554/eLife.08828.003
Spire1C gene amplified from mouse brain cDNA. (A) Initial construct based on NM_194355 was later combined with the sequence based on AK129296 to form full-length Spire1C protein of 802 amino acids with all known exons. (B) Spire1C diagram showing both characterized (red, blue, yellow, and orange) and uncharacterized (purple, green, and black) domains (indicated in the legend on the bottom).
DOI:
http://dx.doi.org/10.7554/eLife.08828.004
(A) Spire1C constructs used in this study. Residue numbers are for the 802 a.a. full-length mouse Spire1C protein. (B) Coomassie-stained gels of purified proteins used for antibody production (pET constructs) and affinity purification (GST constructs).
DOI:
http://dx.doi.org/10.7554/eLife.08828.005
(A) Spire1 ExonC was found to be present in the tissues listed. *PCR from cDNA did not yield conclusive results, but the ExonC-containing gene was originally amplified from mouse brain cDNA. (B) Sequencing results from TOPO pCR2.1 vector using the M13 reverse primer. ExonC sequence is shown in red. (C) Translated protein sequence from red portion in C. (D) Representative immunoblots comparing commercial antibodies to Spire1 used to detect endogenous Spire1 in HeLa and PC12 cell lysates, 25 μg per lane. (E) Affinity purified Spire1 C-terminal antibody and ExonC antisera (both generated in this study) tested on HeLa and PC12 cell lysates, as in (A). Strikingly different protein bands are observed for the same cell type with different antibodies and between cell types with the same antibody. Molecular weight protein markers are the same size for each blot, though the positions vary slightly (as indicated). (F) The Phyre server was used to predict any secondary structural elements in ExonC. Phyre compiles structure predictions from three different algorithms (psipred, jnet, and sspro) to form a consensus prediction and probability for each structural element. Probability ranges from 1–10, with 10 being the most probable. Yellow amino acids are small/polar, green are hydrophobic, red are charged, and purple are aromatic + cysteine.
DOI:
http://dx.doi.org/10.7554/eLife.08828.006
Figure 1—figure supplement 3.
Spire1C contains a previously uncharacterized alternate exon of 58 amino acids.
(A) Spire1 ExonC was found to be present in the tissues listed. *PCR from cDNA did not yield conclusive results, but the ExonC-containing gene was originally amplified from mouse brain cDNA. (B) Sequencing results from TOPO pCR2.1 vector using the M13 reverse primer. ExonC sequence is shown in red. (C) Translated protein sequence from red portion in C. (D) Representative immunoblots comparing commercial antibodies to Spire1 used to detect endogenous Spire1 in HeLa and PC12 cell lysates, 25 μg per lane. (E) Affinity purified Spire1 C-terminal antibody and ExonC antisera (both generated in this study) tested on HeLa and PC12 cell lysates, as in (A). Strikingly different protein bands are observed for the same cell type with different antibodies and between cell types with the same antibody. Molecular weight protein markers are the same size for each blot, though the positions vary slightly (as indicated). (F) The Phyre server was used to predict any secondary structural elements in ExonC. Phyre compiles structure predictions from three different algorithms (psipred, jnet, and sspro) to form a consensus prediction and probability for each structural element. Probability ranges from 1–10, with 10 being the most probable. Yellow amino acids are small/polar, green are hydrophobic, red are charged, and purple are aromatic + cysteine.
DOI:
http://dx.doi.org/10.7554/eLife.08828.006
The Spire1 alternate exon ExonC is necessary and sufficient for localization to mitochondria.
(A) Full length Spire1C domain structure: The number ranges indicate the amino acid regions of the conserved domains probed in this study. (B) Spire1C localizes to mitochondria. myc-Spire1C: U2OS cells cotransfected with myc-Spire1C and mitoRFP show robust localization of myc-Spire1C to mitochondria. α-ExonC: U2OS cells stained with an antibody raised against ExonC (α-ExonC) and expressing mitoRFP show endogenous Spire1C labeling on mitochondria. GFP-ExonC: U2OS cells cotransfected with GFP-ExonC and mitoRFP show robust targeting of GFP-ExonC to mitochondria. myc-Spire1ΔC: U2OS cells cotransfected with myc-Spire1ΔC and mitoRFP show no specific targeting of myc-Spire1ΔC to mitochondria. All cells were fixed and primary antibodies were counterstained with Alexa-488 secondary antibody before imaging with confocal fluorescence microscopy. Scale bars: 10 μm. Inserts are magnifications of the boxed regions.DOI:
http://dx.doi.org/10.7554/eLife.08828.003
Construction of the complete Spire1C protein sequence as explained in detail in the ‘Materials and methods’.
Spire1C gene amplified from mouse brain cDNA. (A) Initial construct based on NM_194355 was later combined with the sequence based on AK129296 to form full-length Spire1C protein of 802 amino acids with all known exons. (B) Spire1C diagram showing both characterized (red, blue, yellow, and orange) and uncharacterized (purple, green, and black) domains (indicated in the legend on the bottom).DOI:
http://dx.doi.org/10.7554/eLife.08828.004
Constructs used to probe Spire1 function.
(A) Spire1C constructs used in this study. Residue numbers are for the 802 a.a. full-length mouseSpire1C protein. (B) Coomassie-stained gels of purified proteins used for antibody production (pET constructs) and affinity purification (GST constructs).DOI:
http://dx.doi.org/10.7554/eLife.08828.005
Spire1C contains a previously uncharacterized alternate exon of 58 amino acids.
(A) Spire1 ExonC was found to be present in the tissues listed. *PCR from cDNA did not yield conclusive results, but the ExonC-containing gene was originally amplified from mouse brain cDNA. (B) Sequencing results from TOPO pCR2.1 vector using the M13 reverse primer. ExonC sequence is shown in red. (C) Translated protein sequence from red portion in C. (D) Representative immunoblots comparing commercial antibodies to Spire1 used to detect endogenous Spire1 in HeLa and PC12 cell lysates, 25 μg per lane. (E) Affinity purified Spire1 C-terminal antibody and ExonC antisera (both generated in this study) tested on HeLa and PC12 cell lysates, as in (A). Strikingly different protein bands are observed for the same cell type with different antibodies and between cell types with the same antibody. Molecular weight protein markers are the same size for each blot, though the positions vary slightly (as indicated). (F) The Phyre server was used to predict any secondary structural elements in ExonC. Phyre compiles structure predictions from three different algorithms (psipred, jnet, and sspro) to form a consensus prediction and probability for each structural element. Probability ranges from 1–10, with 10 being the most probable. Yellow amino acids are small/polar, green are hydrophobic, red are charged, and purple are aromatic + cysteine.DOI:
http://dx.doi.org/10.7554/eLife.08828.006
Spire1C's ExonC is necessary and sufficient for localization to mitochondria
When cells were transfected with a myc-tagged Spire1C construct, the protein showed extensive co-distribution with the mitochondrial marker mitoRFP (Figure 1B, myc-Spire1C). A polyclonal antibody generated against a peptide containing the unique 58 amino acids in ExonC (Figure 1B and Figure 1—figure supplements 1–3) also showed extensive mitochondria-specific labeling within cells (Figure 1B, α−ExonC) (see Figure 1—figure supplements 2, 3 and ‘Materials and methods’ for additional information on α-ExonC). Testing the role of ExonC in mitochondrial targeting of Spire1C, we found that a GFP-tagged ExonC fusion protein robustly localized to mitochondria in expressing cells (Figure 1B, GFP-ExonC). By contrast, a myc-tagged Spire1C construct lacking ExonC never showed specific mitochondrial localization (Figure 1B, myc-Spire1ΔC). These results suggest that Spire1C is an endogenously expressed mitochondria-associated protein that targets to mitochondria via its ExonC domain.
Spire1C localizes to the mitochondrial outer membrane with its formin- and actin-binding domains facing the cytoplasm
To examine whether Spire1C distributes on the surface or interior of mitochondria we compared the distribution of GFP-ExonC (marking Spire1C) with mitoRFP (marking the mitochondrial matrix) using structured illumination microscopy (SIM), which gives a twofold resolution improvement over conventional confocal imaging (Allen et al., 2014). GFP-ExonC labeling on mitochondria surrounded that of mitoRFP labeling (Figure 2A), suggesting Spire1C localizes to the periphery of mitochondria, most likely on the mitochondrial outer membrane.
Figure 2.
Spire1C localizes to the mitochondrial outer membrane with its formin and actin binding domains facing the cytoplasm.
(A) ExonC localizes to the peripheral region of mitochondria. Left: structured iIllumination microscopy (SIM) image of a U2OS cell transfected with GFP-ExonC and mitoRFP reveals localization of GFP-ExonC to the periphery of mitochondria. Right: Magnification of boxed region on left. The insert on the lower right corner is a fluorescence intensity linescan of the rectangular boxed region indicating the inversely related profiles of GFP-ExonC vs mitoRFP. Scale bar: 10 μm. (B) Illustration of the principle of the fluorescence protease protection (FPP) assay performed on mitochondrial outer membrane (MOM) proteins. If a fluorescent protein tag faces the cytoplasm (green circle), it is degraded by trypsin and its fluorescence is depleted. If the protein tag faces the interior of the mitochondria (blue triangle), it is protected from trypsin in the cytoplasm, and thus its fluorescence remains after trypsin addition. An intermembrane space (IMS) marker, OMI-mCherry, serves as a control to verify that the mitochondrial outer membrane has not been permeabilized by the digitonin treatment, and furthermore to confirm that trypsin is not degrading proteins in the IMS. (C) Schematic of the constructs used in our FPP assays. (D) Cells cotransfected with OMI-mCherry and GFP-Spire1C (N-terminal GFP tag, left) or GFP-ExonC (N-terminal GFP-tag, middle) were treated with 20 μM digitonin and 4 mM trypsin. In both cases OMI-mCherry fluorescence remained, whereas the N-terminal GFP tags were mostly depleted within 60 s after trypsin treatment. In contrast, in cells transfected with ExonC-GFP (C-terminus GFP tag), GFP fluorescence remains unchanged after 60 s of trypsin treatment. Scale bar: 10 μm. (E) GFP-Spire1C laterally diffuses along the mitochondrial outer membrane. A small region of a mitochondrion labeled with GFP-Spire1C was photobleached (white boxed region). The rapid, directional recovery from the unbleached region into the bleached region (see also Figure 2—figure supplement 2) suggests GFP-Spire1C is stably associated with and laterally diffuses along the mitochondrial outer membrane. (F) GFP-Spire1C does not readily exchange with the cytoplasm or neighboring mitochondria since photobleaching of an entire mitochondrion resulted in very low fluorescence recovery over the same period of time as in (E). Scale bar: 1 μm.
DOI:
http://dx.doi.org/10.7554/eLife.08828.007
(A) After partial bleaching of mitochondria labeled with GFP-Spire1C, rapid fluorescence recovery occurs in a directional fashion. The fluorescence intensity in the region closest to the unbleached region (green rectangle) increases more rapidly than the fluorescence intensity in the region farther away (red rectangle) from the unbleached region. Scale bar: 2 μm. (B) Graph of the fluorescence intensity of the green and red regions in (A) shows the differential rate of recovery over time for each region.
DOI:
http://dx.doi.org/10.7554/eLife.08828.008
Spire1C localizes to the mitochondrial outer membrane with its formin and actin binding domains facing the cytoplasm.
(A) ExonC localizes to the peripheral region of mitochondria. Left: structured iIllumination microscopy (SIM) image of a U2OS cell transfected with GFP-ExonC and mitoRFP reveals localization of GFP-ExonC to the periphery of mitochondria. Right: Magnification of boxed region on left. The insert on the lower right corner is a fluorescence intensity linescan of the rectangular boxed region indicating the inversely related profiles of GFP-ExonC vs mitoRFP. Scale bar: 10 μm. (B) Illustration of the principle of the fluorescence protease protection (FPP) assay performed on mitochondrial outer membrane (MOM) proteins. If a fluorescent protein tag faces the cytoplasm (green circle), it is degraded by trypsin and its fluorescence is depleted. If the protein tag faces the interior of the mitochondria (blue triangle), it is protected from trypsin in the cytoplasm, and thus its fluorescence remains after trypsin addition. An intermembrane space (IMS) marker, OMI-mCherry, serves as a control to verify that the mitochondrial outer membrane has not been permeabilized by the digitonin treatment, and furthermore to confirm that trypsin is not degrading proteins in the IMS. (C) Schematic of the constructs used in our FPP assays. (D) Cells cotransfected with OMI-mCherry and GFP-Spire1C (N-terminal GFP tag, left) or GFP-ExonC (N-terminal GFP-tag, middle) were treated with 20 μM digitonin and 4 mM trypsin. In both cases OMI-mCherry fluorescence remained, whereas the N-terminal GFP tags were mostly depleted within 60 s after trypsin treatment. In contrast, in cells transfected with ExonC-GFP (C-terminus GFP tag), GFP fluorescence remains unchanged after 60 s of trypsin treatment. Scale bar: 10 μm. (E) GFP-Spire1C laterally diffuses along the mitochondrial outer membrane. A small region of a mitochondrion labeled with GFP-Spire1C was photobleached (white boxed region). The rapid, directional recovery from the unbleached region into the bleached region (see also Figure 2—figure supplement 2) suggests GFP-Spire1C is stably associated with and laterally diffuses along the mitochondrial outer membrane. (F) GFP-Spire1C does not readily exchange with the cytoplasm or neighboring mitochondria since photobleaching of an entire mitochondrion resulted in very low fluorescence recovery over the same period of time as in (E). Scale bar: 1 μm.DOI:
http://dx.doi.org/10.7554/eLife.08828.007
GFP-Spire1C laterally diffuses on the mitochondrial outer membrane.
(A) After partial bleaching of mitochondria labeled with GFP-Spire1C, rapid fluorescence recovery occurs in a directional fashion. The fluorescence intensity in the region closest to the unbleached region (green rectangle) increases more rapidly than the fluorescence intensity in the region farther away (red rectangle) from the unbleached region. Scale bar: 2 μm. (B) Graph of the fluorescence intensity of the green and red regions in (A) shows the differential rate of recovery over time for each region.DOI:
http://dx.doi.org/10.7554/eLife.08828.008To confirm Spire1C's mitochondrial outer membrane localization, we employed a fluorescence protease protection (FPP) assay (Lorenz et al., 2006), which can determine a protein's membrane topology (Figure 2B). GFP was fused to the N-terminus of Spire1C (GFP-Spire1C), the N-terminus of ExonC (GFP-ExonC), or to the C-terminus of ExonC (ExonC-GFP) (Figure 2C). The constructs were then co-expressed in cells with OMI-mCherry, a mitochondrial intermembrane space (IMS) protein (Muñoz-Pinedo et al., 2006). Thereafter, the plasma membrane of the cells was gently permeabilized with digitonin, followed by treatment with trypsin to extinguish cytoplasmic GFP fluorescence. Because mitochondrial membranes are not permeabilized by digitonin treatment, we reasoned that only if the fluorescent tag from these constructs faced the cytoplasm would their fluorescence be abolished by the trypsin. Both GFP-Spire1C and GFP-ExonC lost nearly all their fluorescence within 60 seconds of trypsin treatment. By contrast, fluorescence from ExonC-GFP was protected, similar to that seen for co-expressed OMI-mCherry, which as a mitochondrial IMS protein should be insensitive to trypsin (Muñoz-Pinedo et al., 2006) (Figure 2D; Videos 1–3). These results suggest that the WH2 and KIND domains of Spire1C face the cytoplasm (since both reside N-terminal to ExonC) (Figure 2C), a topology where they could participate in formin-binding and actin-nucleation activity. The data further suggest that the C-terminus of ExonC is not exposed to the cytoplasm. This raises the possibility that ExonC is embedded in the outer membrane, either as a transmembrane or hairpin protein.
A U2OS cell coexpressing GFP-Spire1C (N-terminus tag) and OMI-mCherry displays rapid loss of GFP fluorescence signal after the addition of 10 μM digitonin and 4 mM trypsin, whereas mCherry fluorescence persists, indicating that trypsin is degrading the GFP tag on the N-terminus of Spire1C in the cytoplasm, but not OMI-mCherry, which resides in the mitochondria intermembrane space (IMS).
Scale bar: 10 μm.DOI:
http://dx.doi.org/10.7554/eLife.08828.009
A U2OS cell coexpressing GFP-ExonC (N-terminus tag) and OMI-mCherry displays rapid loss of GFP fluorescence signal after the addition of 10 μM digitonin and 4 mM trypsin, whereas mCherry fluorescence persists, indicating that trypsin is degrading the GFP tag on the N-terminus of Spire1C in the cytoplasm, but not OMI-mCherry, which resides in the mitochondria IMS.
Scale bar: 10 μm.DOI:
http://dx.doi.org/10.7554/eLife.08828.010
A U2OS cell coexpressing ExonC-GFP (C-terminus tag) and OMI-mCherry displays no loss of GFP fluorescence signal after the addition of 10 μM digitonin and 4 mM trypsin, indicating the GFP tag on the C-terminus of ExonC is protected within the mitochondrial lumen.
Scale bar: 10 μm.DOI:
http://dx.doi.org/10.7554/eLife.08828.011In support of this notion, transmembrane domain prediction software (Claros and von Heijne, 1994) indicated that residues 26–46 within ExonC form an α-helix characteristic of prokaryotic transmembrane domains. Secondary structure prediction software PHYRE (Kelley and Sternberg, 2009) also predicted a second α-helix within ExonC (Figure 1—figure supplement 3). Interestingly, when we expressed a full-length Spire1C construct with GFP fused to the C-terminus (Spire1C-GFP), the protein remained mostly cytoplasmic and no longer properly localized to mitochondria (data not shown). The protein also rapidly escaped cells treated with digitonin, suggesting it was not able to target efficiently to mitochondria. Taken together, our data suggests that Spire1C is a mitochondrial outer membrane protein, possibly with a hairpin conformation given ExonC's two predicted α-helix domains (Figure 1—figure supplement 3).We next performed photobleaching experiments to investigate the dynamics of Spire1C's association with mitochondrial membranes. Photobleaching of a portion of a mitochondrial element that expressed GFP-Spire1C resulted in rapid recovery of fluorescence, with replenishment arising first in regions close to the bleach site and later at regions further away (Figure 2E and Figure 2—figure supplement 1), similar to that seen for GFP-tagged proteins that feely diffuse along membranes (Cole et al., 1996). In contrast, very little recovery during the same time period occurred when an entire mitochondrial element expressing GFP-Spire1C was photobleached (Figure 2F). Thus, Spire1C appears to diffuse laterally along mitochondrial membranes, rather than rapidly bind and dissociate from the membrane, further supporting the idea of Spire1C being a mitochondrial outer membrane protein.
Figure 2—figure supplement 1.
GFP-Spire1C laterally diffuses on the mitochondrial outer membrane.
(A) After partial bleaching of mitochondria labeled with GFP-Spire1C, rapid fluorescence recovery occurs in a directional fashion. The fluorescence intensity in the region closest to the unbleached region (green rectangle) increases more rapidly than the fluorescence intensity in the region farther away (red rectangle) from the unbleached region. Scale bar: 2 μm. (B) Graph of the fluorescence intensity of the green and red regions in (A) shows the differential rate of recovery over time for each region.
DOI:
http://dx.doi.org/10.7554/eLife.08828.008
Spire1C promotes actin assembly on mitochondrial surfaces
Given that Spire proteins can nucleate actin via their highly conserved WH2-repeat domain (Quinlan et al., 2005; Loomis et al., 2006; Salles et al., 2009), we next investigated whether overexpression of Spire1C promotes actin assembly on mitochondria. In non-transfected cells, only low levels of actin co-localized with mitochondria, without any apparent specificity (Figure 3 and Figure 3—figure supplement 1, control). Upon Spire1C overexpression, however, actin accumulated to high levels specifically on mitochondria (Figure 3 and Figure 3—figure supplement 1, Spire1C overexpression). This actin enrichment on mitochondrial surfaces was not dependent on Spire's formin-binding KIND domain, since overexpression of Spire1C lacking the KIND domain (Spire1CΔKIND) still induced actin enrichment on mitochondrial surfaces (Figure 3, Spire1CΔKIND overexpression). In contrast, actin enrichment on mitochondria was muted upon overexpression of Spire1C mWH2 (Figure 3 and Figure 3—figure supplement 1, Spire1C mWH2 overexpression), which contains mutations in its WH2 domains that block Spire-mediated actin nucleation (Loomis et al., 2006; Salles et al., 2009) (see ‘Materials and methods’). These results demonstrated that Spire1C promotes actin assembly on mitochondria, most likely through Spire1C's ability to nucleate actin filaments.
Figure 3.
Spire1C promotes actin assembly on mitochondrial surfaces.
Overexpression of Spire1C causes actin accumulation on mitochondria. Control: SIM image of a Cos7 cell expressing mitoEmerald and stained with phalloidin-568 to visualize actin shows low amounts of overlap between mitochondria and actin (Mander's: 0.43 ± 0.020, ncells = 26). Spire1C overexpression: A Cos7 cell expressing mitoEmerald and overexpressing myc-Spire1C and stained with phalloidin-568 reveals significantly increased actin accumulation on mitochondria (Mander's: 0.64 ± 0.066, ncells = 19, p < 0.05) compared to control cells. GFP-Spire1CΔKIND: A Cos7 cell overexpressing the formin-binding deficient GFP-Spire1CΔKIND stained with phalloidin-568 reveals significant accumulation of actin on mitochondria compared to control cells (Mander's: 0.55 ± 0.017, ncells = 18, p < 0.05). A Cos7 cell overexpressing GFP-Spire1C mWH2 displays no increased accumulation of actin (Mander's: 0.41 ± 0.040, ncells = 15, p = 0.32) compared to control cells. Scale bar: 5 μm.
DOI:
http://dx.doi.org/10.7554/eLife.08828.012
control (α-ExonC): SIM image of a U2OS cell stained with phalloidin-488 and α-Spire1C to visualize endogenous Spire1C localization relative to actin shows very low amounts of overlap between mitochondria and actin. myc-Spire1C (α-myc): A U2OS cell overexpressing myc-Spire1C, stained with anti-myc and phalloidin-488 reveals increased actin accumulation on mitochondria compared to non-transfected cells. myc-Spire1C mWH2 (α-myc): A U2OS cell overexpressing the actin-nucleation deficient myc-Spire1C mWH2 labeled with anti-myc and phalloidin-488 reveals muted accumulation of actin on mitochondria compared to wild-type myc-Spire1C overexpression. Scale bars: 15 μm. The yellow-boxed regions are magnified underneath each image. All cells were counterstained with Alexa-568 secondary antibody.
DOI:
http://dx.doi.org/10.7554/eLife.08828.013
Figure 3—figure supplement 1.
Spire1C promotes actin assembly near mitochondria in a WH2-dependent fashion.
control (α-ExonC): SIM image of a U2OS cell stained with phalloidin-488 and α-Spire1C to visualize endogenous Spire1C localization relative to actin shows very low amounts of overlap between mitochondria and actin. myc-Spire1C (α-myc): A U2OS cell overexpressing myc-Spire1C, stained with anti-myc and phalloidin-488 reveals increased actin accumulation on mitochondria compared to non-transfected cells. myc-Spire1C mWH2 (α-myc): A U2OS cell overexpressing the actin-nucleation deficient myc-Spire1C mWH2 labeled with anti-myc and phalloidin-488 reveals muted accumulation of actin on mitochondria compared to wild-type myc-Spire1C overexpression. Scale bars: 15 μm. The yellow-boxed regions are magnified underneath each image. All cells were counterstained with Alexa-568 secondary antibody.
DOI:
http://dx.doi.org/10.7554/eLife.08828.013
Spire1C promotes actin assembly on mitochondrial surfaces.
Overexpression of Spire1C causes actin accumulation on mitochondria. Control: SIM image of a Cos7 cell expressing mitoEmerald and stained with phalloidin-568 to visualize actin shows low amounts of overlap between mitochondria and actin (Mander's: 0.43 ± 0.020, ncells = 26). Spire1C overexpression: A Cos7 cell expressing mitoEmerald and overexpressing myc-Spire1C and stained with phalloidin-568 reveals significantly increased actin accumulation on mitochondria (Mander's: 0.64 ± 0.066, ncells = 19, p < 0.05) compared to control cells. GFP-Spire1CΔKIND: A Cos7 cell overexpressing the formin-binding deficient GFP-Spire1CΔKIND stained with phalloidin-568 reveals significant accumulation of actin on mitochondria compared to control cells (Mander's: 0.55 ± 0.017, ncells = 18, p < 0.05). A Cos7 cell overexpressing GFP-Spire1C mWH2 displays no increased accumulation of actin (Mander's: 0.41 ± 0.040, ncells = 15, p = 0.32) compared to control cells. Scale bar: 5 μm.DOI:
http://dx.doi.org/10.7554/eLife.08828.012
Spire1C promotes actin assembly near mitochondria in a WH2-dependent fashion.
control (α-ExonC): SIM image of a U2OS cell stained with phalloidin-488 and α-Spire1C to visualize endogenous Spire1C localization relative to actin shows very low amounts of overlap between mitochondria and actin. myc-Spire1C (α-myc): A U2OS cell overexpressing myc-Spire1C, stained with anti-myc and phalloidin-488 reveals increased actin accumulation on mitochondria compared to non-transfected cells. myc-Spire1C mWH2 (α-myc): A U2OS cell overexpressing the actin-nucleation deficient myc-Spire1C mWH2 labeled with anti-myc and phalloidin-488 reveals muted accumulation of actin on mitochondria compared to wild-type myc-Spire1C overexpression. Scale bars: 15 μm. The yellow-boxed regions are magnified underneath each image. All cells were counterstained with Alexa-568 secondary antibody.DOI:
http://dx.doi.org/10.7554/eLife.08828.013
Spire1C modulates mitochondrial fission via its formin-binding KIND and actin-nucleating WH2-repeat domains
Given that actin assembly has been shown to play an important role in regulating mitochondrial fission (De Vos et al., 2005; DuBoff et al., 2012; Korobova et al., 2013, 2014; Hatch et al., 2014; Li et al., 2015), the observation that Spire1C localizes to mitochondria and promotes actin assembly on mitochondrial surfaces raised the possibility that Spire1C plays a role in mitochondrial fission. To test this directly, we assessed the effect of Spire1C overexpression, mutation and depletion on mitochondrial morphology, length, and fission. While all cells in all conditions in this study displayed a combination of fragmented and tubular mitochondria, overexpression of Spire1C resulted in a significant shift towards fragmented mitochondria compared to control cells (Figure 4A, +Spire1C). In contrast, overexpression of Spire1C mWH2 or Spire1CΔKIND resulted in a shift towards tubular mitochondria (Figure 4A). Depletion of Spire1C using shRNA also resulted in a shift towards tubular mitochondria (Figure 4B). To quantify these changes, we measured mitochondrial lengths in each of these conditions, and found that Spire1C overexpression resulted in shorter mitochondria on average, whereas mutation or depletion of Spire1C resulted in longer mitochondria (Figure 4C, left graph, and Figure 4—figure supplement 1), resembling the effect of disrupting mitochondrial fission due to the depletion of Drp1 or INF2 from cells (Bleazard et al., 1999; Labrousse et al., 1999; Wakabayashi et al., 2009; Korobova et al., 2013, 2014; Hatch et al., 2014). To determine whether these morphological changes were a result of altered mitochondrial fission dynamics, we counted the number of mitochondrial fission events in each of these conditions. We found that fission events increased in frequency when cells were overexpressing Spire1C, whereas overexpression of Spire1C mWH2 or Spire1CΔKIND decreased the frequency of fission events (Figure 4C, right graph). Similarly, shRNA-mediated knockdown of Spire1C decreased the frequency of fission events (Figure 4C, right graph). Taken together, our results show Spire1C promotes mitochondrial fission via Spire1C's actin-nucleating and formin-binding capabilities.
Figure 4.
Spire1C promotes mitochondrial fission via its formin-binding KIND and actin-nucleating WH2 domains.
(A) U2OS cells overexpressing Spire1C display shorter mitochondria (second panel, 2.2 ± 0.5 μm, nmitochondria = 211, ncells = 14, p < 0.0001), whereas cells overexpressing Spire1C mWH2 (third panel, 6.2 ± 1.52 μm, nmitochondria = 332, ncells = 15, p < 0.0001) or Spire1CΔKIND (fourth panel, 9.0 ± 1.50 μm, nmitochondria = 232, ncells = 16, p < 0.0001) display longer, more tubulated mitochondria compared to control cells (first panel, 3.57 ± 0.45 μm, nmitochondria = 322, ncells = 34). Scale bar: 10 μm. (B) Cells transfected with mitoEmerald (and neighboring non-transfected cells) stained with α-ExonC (upper row) showed robust colocalization of mitoEmerald and α-ExonC, with a mixture of tubulated and fragmented mitochondria. Cells cotransfected with Spire1 shRNA and mitoEmerald with no detectable α-ExonC labeling (lower row) display long, tubulated mitochondria (6.1 ± 1.26 μm, nmitochondria = 222, ncells = 17). All primary antibodies were counterstained with Alexa-568 secondary antibody. Scale bar: 15 μm. (C) Left: Average mitochondrial lengths for control cells and cells overexpressing Spire1C, Spire1C mWH2, Spire1 shRNA or Spire1CΔKIND. Right: Average number of mitochondrial fission events in one cell in a timespan of 10 min for control (ncells = 17), Spire1C overexpressing (ncells = 10, p < 0.0001), Spire1C mWH2 overexpressing (ncells = 12, p < 0.0001), Spire1 knockdown (ncells = 25, p < 0.0001) and Spire1CΔKIND overexpressing (ncells = 22, p < 0.0001) cells. At least 3 separate experiments were performed for all conditions. Error bars represent standard error of the mean.
DOI:
http://dx.doi.org/10.7554/eLife.08828.014
Histogram showing distribution of frequencies of mitochondrial lengths for each of the conditions shown in the bar graphs in Figure 4.
DOI:
http://dx.doi.org/10.7554/eLife.08828.015
Figure 4—figure supplement 1.
Distribution of mitochondrial lengths measured in each condition.
Histogram showing distribution of frequencies of mitochondrial lengths for each of the conditions shown in the bar graphs in Figure 4.
DOI:
http://dx.doi.org/10.7554/eLife.08828.015
Spire1C promotes mitochondrial fission via its formin-binding KIND and actin-nucleating WH2 domains.
(A) U2OS cells overexpressing Spire1C display shorter mitochondria (second panel, 2.2 ± 0.5 μm, nmitochondria = 211, ncells = 14, p < 0.0001), whereas cells overexpressing Spire1C mWH2 (third panel, 6.2 ± 1.52 μm, nmitochondria = 332, ncells = 15, p < 0.0001) or Spire1CΔKIND (fourth panel, 9.0 ± 1.50 μm, nmitochondria = 232, ncells = 16, p < 0.0001) display longer, more tubulated mitochondria compared to control cells (first panel, 3.57 ± 0.45 μm, nmitochondria = 322, ncells = 34). Scale bar: 10 μm. (B) Cells transfected with mitoEmerald (and neighboring non-transfected cells) stained with α-ExonC (upper row) showed robust colocalization of mitoEmerald and α-ExonC, with a mixture of tubulated and fragmented mitochondria. Cells cotransfected with Spire1 shRNA and mitoEmerald with no detectable α-ExonC labeling (lower row) display long, tubulated mitochondria (6.1 ± 1.26 μm, nmitochondria = 222, ncells = 17). All primary antibodies were counterstained with Alexa-568 secondary antibody. Scale bar: 15 μm. (C) Left: Average mitochondrial lengths for control cells and cells overexpressing Spire1C, Spire1C mWH2, Spire1 shRNA or Spire1CΔKIND. Right: Average number of mitochondrial fission events in one cell in a timespan of 10 min for control (ncells = 17), Spire1C overexpressing (ncells = 10, p < 0.0001), Spire1C mWH2 overexpressing (ncells = 12, p < 0.0001), Spire1 knockdown (ncells = 25, p < 0.0001) and Spire1CΔKIND overexpressing (ncells = 22, p < 0.0001) cells. At least 3 separate experiments were performed for all conditions. Error bars represent standard error of the mean.DOI:
http://dx.doi.org/10.7554/eLife.08828.014
Distribution of mitochondrial lengths measured in each condition.
Histogram showing distribution of frequencies of mitochondrial lengths for each of the conditions shown in the bar graphs in Figure 4.DOI:
http://dx.doi.org/10.7554/eLife.08828.015
Disrupting the Spire1C KIND domain decreases ER-mitochondria overlaps
Since ER tubules have been implicated in mitochondrial constriction and division (Friedman et al., 2011; Korobova et al., 2013; Murley et al., 2013; Korobova et al., 2014), we investigated whether Spire1C influences ER-mitochondria association. Upon overexpression of Spire1C or Spire1C mWH2, we observed no significant change in ER-mitochondrial overlap or crossover sites of ER tubules and mitochondria compared to control cells (Figure 5A,B). However, in cells overexpressing Spire1CΔKIND, we observed a significant decrease in ER-mitochondria overlap, as well as a decrease in the number of ER tubules crossing over mitochondria (Figure 5A,B). This suggested that the KIND domain of Spire1C might play a role in regulating the extent of ER-mitochondria intersections within cells, and that Spire1CΔKIND-mediated disruption of mitochondrial fission (see Figure 4C, right panel) could be due to a reduction in ER-mediated mitochondrial constriction in these cells (Friedman et al., 2011; Korobova et al., 2013; Murley et al., 2013).
Figure 5.
Spire1CΔKIND overexpression reduces the amount of ER-mitochondria overlap.
(A) Confocal images of cells expressing Ii33-mCherry and overexpressing GFP-Spire1C (second row) or GFP-Spire1C mWH2 (third row), but not GFP-Spire1CΔKIND (fourth row), display significant overlap of mitochondria with ER, similar to control cells expressing mitoEmerald. The images on the right-hand side show a magnified view of the boxed region in the merge image, with overlapping pixels in displayed in white. Scale bar: 15 μm. (B) Bar graph representing the average number of ER-mitochondria intersections per cell. We were able to resolve an average of 14.3 ± 3.5 intersections in control cells (ncells = 12). GFP-Spire1C overexpressing cells had 14.7 ± 1.93 (ncells = 15) ER-mitochondria intersections per cell. GFP-Spire1C mWH2 expressing cells had an average of 14.7 ± 1.62 (ncells = 11) ER-mitochondria intersections per cell. Spire1CΔKIND expressing cells had 6.8 ± 1.33 (ncells = 14, p < 0.05) ER-mitochondria intersections per cell.
DOI:
http://dx.doi.org/10.7554/eLife.08828.016
Spire1CΔKIND overexpression reduces the amount of ER-mitochondria overlap.
(A) Confocal images of cells expressing Ii33-mCherry and overexpressing GFP-Spire1C (second row) or GFP-Spire1C mWH2 (third row), but not GFP-Spire1CΔKIND (fourth row), display significant overlap of mitochondria with ER, similar to control cells expressing mitoEmerald. The images on the right-hand side show a magnified view of the boxed region in the merge image, with overlapping pixels in displayed in white. Scale bar: 15 μm. (B) Bar graph representing the average number of ER-mitochondria intersections per cell. We were able to resolve an average of 14.3 ± 3.5 intersections in control cells (ncells = 12). GFP-Spire1C overexpressing cells had 14.7 ± 1.93 (ncells = 15) ER-mitochondria intersections per cell. GFP-Spire1C mWH2 expressing cells had an average of 14.7 ± 1.62 (ncells = 11) ER-mitochondria intersections per cell. Spire1CΔKIND expressing cells had 6.8 ± 1.33 (ncells = 14, p < 0.05) ER-mitochondria intersections per cell.DOI:
http://dx.doi.org/10.7554/eLife.08828.016
The Spire1C KIND domain directly interacts with ER-anchored INF2 to promote mitochondrial fission
One way the KIND domain of Spire1C could affect ER-mediated mitochondrial division is by binding to ER-anchored INF2. To test this possibility, we performed in vitro GST pull-down assays. We found that the C-terminal half of INF2 (INF2-CT), but not the N-terminal half (INF2-NT), associated with a GST-tagged Spire1C KIND domain, but not GST alone (Figure 6A). Addition of the N-terminal half of INF2 (INF2-NT) inhibited the interaction between Spire1C KIND and INF2-CT in our GST pulldown assays (Figure 6A; last well), suggesting that INF2's ability to self-interact (Chhabra and Higgs, 2006; Ramabhadran et al., 2012, 2013) can regulate its association with Spire1C. We further confirmed the interaction between Spire1C's KIND domain and INF2 using fluorescence anisotropy (Ramabhadran et al., 2013) (Figure 6B), which showed a specific interaction between Spire1C's KIND domain and INF2. Taken together, these data demonstrate that the Spire1C KIND domain directly binds to INF2.
Figure 6.
Spire1C and inverted formin 2 (INF2) directly interact and work together to regulate mitochondrial fission.
(A) INF2-CT directly binds to Spire1-KIND in vitro. GST pull-down assays in actin polymerization buffer, containing combinations of the following: 20 μM GST or GST-Spire1 KIND bound to glutathione-sepharose beads; 1 μM INF2-CT; and 10 μM INF2-NT. Co-incubation of the GST-Spire1 KIND domain pulls down INF2-CT (third to last lane), but not INF2-NT (second to last lane). INF2-CT pulldown is inhibited by the addition of the INF2-NT (last lane). STDS lane represents 0.2 μM INF2-CT. (B) Fluorescence anisotropy binding curve of purified INF2-CT (20 nM) labeled with tetramethylrhodamine succinimide mixed with varying concentrations of Spire1 KIND or bovine serum albumin reveals a direct interaction between Spire1 KIND and INF2-CT. (C) Cells overexpressing a constitutively active INF2 mutant (INF2 A149 alone, ncells = 16, nmitochondria = 232) display very short, fragmented mitochondria compared to control cells (p < 0.0001). Cells overexpressing A149 and Spire1C (+Spire1C, ncells = 14, nmitochondria = 461) or Spire1C mWH2 (+Spire1C mWH2, ncells = 20, nmitochondria = 377) similarly display very short mitochondria. In contrast, cells overexpressing A149 and Spire1CΔKIND display longer, more tubulated mitochondria (+Spire1CΔKIND, ncells = 18, nmitochondria = 379, p < 0.0001). (D) Cells overexpressing Spire1C and treated with scrambled siRNA display shorter, more fragmented mitochondria (+scramble siRNA, ncells = 20, nmitochondria = 434, p < 0.05). In contrast, cells overexpressing Spire1C and treated with INF2 siRNA display significantly longer, more tubulated mitochondria (Spire1C + INF2 siRNA, ncells = 22, nmitochondria = 627, p < 0.0001). Scale bars: 5 μm. (E) Bar graph displaying average mitochondria lengths for each of the conditions in this figure. Error bars represent standard error of the mean.
DOI:
http://dx.doi.org/10.7554/eLife.08828.017
Spire1C and inverted formin 2 (INF2) directly interact and work together to regulate mitochondrial fission.
(A) INF2-CT directly binds to Spire1-KIND in vitro. GST pull-down assays in actin polymerization buffer, containing combinations of the following: 20 μM GST or GST-Spire1 KIND bound to glutathione-sepharose beads; 1 μM INF2-CT; and 10 μM INF2-NT. Co-incubation of the GST-Spire1 KIND domain pulls down INF2-CT (third to last lane), but not INF2-NT (second to last lane). INF2-CT pulldown is inhibited by the addition of the INF2-NT (last lane). STDS lane represents 0.2 μM INF2-CT. (B) Fluorescence anisotropy binding curve of purified INF2-CT (20 nM) labeled with tetramethylrhodamine succinimide mixed with varying concentrations of Spire1 KIND or bovine serum albumin reveals a direct interaction between Spire1 KIND and INF2-CT. (C) Cells overexpressing a constitutively active INF2 mutant (INF2 A149 alone, ncells = 16, nmitochondria = 232) display very short, fragmented mitochondria compared to control cells (p < 0.0001). Cells overexpressing A149 and Spire1C (+Spire1C, ncells = 14, nmitochondria = 461) or Spire1C mWH2 (+Spire1C mWH2, ncells = 20, nmitochondria = 377) similarly display very short mitochondria. In contrast, cells overexpressing A149 and Spire1CΔKIND display longer, more tubulated mitochondria (+Spire1CΔKIND, ncells = 18, nmitochondria = 379, p < 0.0001). (D) Cells overexpressing Spire1C and treated with scrambled siRNA display shorter, more fragmented mitochondria (+scramble siRNA, ncells = 20, nmitochondria = 434, p < 0.05). In contrast, cells overexpressing Spire1C and treated with INF2 siRNA display significantly longer, more tubulated mitochondria (Spire1C + INF2 siRNA, ncells = 22, nmitochondria = 627, p < 0.0001). Scale bars: 5 μm. (E) Bar graph displaying average mitochondria lengths for each of the conditions in this figure. Error bars represent standard error of the mean.DOI:
http://dx.doi.org/10.7554/eLife.08828.017We next tested whether disrupting Spire1C's interaction with INF2 inhibits mitochondrial fission. To test this hypothesis, we first asked whether removing the KIND domain from Spire1C blocks the increase in mitochondrial division associated with overexpressing a constitutively active INF2 mutant, INF2 A149 (Korobova et al., 2013, 2014). Consistent with previous reports (Korobova et al., 2013, 2014), we found that overexpressing INF2 A149 resulted in significant shortening of mitochondria (Figure 6C,E; A149 alone). Similarly, co-overexpression of INF2 A149 and Spire1C or INF2 A149 and Spire1C mWH2 resulted in very short, fragmented mitochondria (Figure 6C,E +Spire1C or +Spire1C mWH2). By contrast, overexpression of INF2 A149 and Spire1CΔKIND significantly disrupted INF2 A149-mediated mitochondrial fragmentation (Figure 6C, +Spire1CΔKIND). These results suggest that while Spire1C actin-nucleating activity may be unnecessary for mitochondrial fission when INF2 is constitutively active, INF2 binding to the Spire1C KIND domain is necessary for INF2 to maximally induce mitochondrial fission. In further confirmation of the hypothesis that Spire1C and INF2 jointly work to drive mitochondrial fission, we found that siRNA-mediated knockdown of INF2 disrupted Spire1C-mediated upregulation of mitochondrial fission (Figure 6D). Taken together, the results suggest that Spire1C interacts with INF2 via Spire1C's KIND domain, and that this interaction promotes mitochondrial fission.
Spire1C promotes ER-mediated mitochondrial constriction in an INF2-dependent fashion
Mitochondrial fission would be co-dependent on Spire1C and INF2 if Spire1C's interaction with INF2 drives ER-mediated mitochondrial constriction. To test this hypothesis, we employed confocal fluorescence imaging of ER and mitochondria to examine mitochondrial constriction sites in cells co-expressing the ER marker Ii33-mCherry and different variants of Spire1C. Mitochondria constriction was visible at sites of ER-mitochondria crossover slightly more frequently in cells overexpressing Spire1C compared to cells not overexpressing the construct (Figure 7A,B, Spire1C, see arrows for ER-mediated mitochondrial constrictions, and arrowheads for ER-mitochondria intersections that didn't result in constrictions). Notably, cells overexpressing Spire1C mWH2 displayed significantly fewer mitochondrial constrictions at ER-mitochondria intersections (Figure 7A,B, Spire1C mWH2). Similarly, cells overexpressing Spire1CΔKIND showed a decrease in the frequency of constrictions at ER-mitochondria intersections (Figure 7A,B, Spire1CΔKIND). RNA-mediated Spire1C knockdown also resulted in decreased constrictions (Figure 7A,B, Spire1C shRNA). Finally, overexpressing Spire1C in cells treated with INF2 siRNA showed a significant reduction in mitochondrial constrictions (Figure 7A,B, INF2 siRNA + Spire1C). Taken together, our results suggest that Spire1C and INF2 work together to promote mitochondrial division by driving ER-mediated mitochondrial constriction, and that this process is dependent on Spire1C's ability to nucleate actin filaments on mitochondrial surfaces, as well as the ability for Spire1C and INF2 to interact via the Spire1C KIND domain.
Figure 7.
Spire1C overexpression enhances mitochondrial constriction via its WH2 and KIND domains in cooperation with INF2.
(A) Representative confocal images of U2OS cells expressing Ii33-mCherry in order to visualize ER tubules crossing over mitochondria in cells expressing mitoEmerald (first row) or overexpressing GFP-Spire1C (second row), GFP-Spire1C mWH2 (third row), GFP-Spire1CΔKIND (fourth row), or GFP-Spire1C while treated with INF2 siRNA (fifth row). Arrows indicate ER-mitochondria intersection points associated with mitochondrial constriction. Arrowheads indicate ER-mitochondria intersections not resulting in mitochondrial constriction. Scale bar: 1 μm. (B) Bar graphs representing the average percentage of ER-mitochondria intersections associated with mitochondrial constriction for each construct used. In cells expressing mitoEmerald, 55.2 ± 5.5% (nintersections = 172, ncells = 12) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In GFP-Spire1C overexpressing cells, 71.5 ± 4.5% (nintersections = 221, ncells = 15, p < 0.05) of ER-mitochondria intersections resulted in mitochondrial constriction. In GFP-Spire1C mWH2 overexpressing cells, 24.1 ± 2.4% (nintersections = 162, ncells = 11, p < 0.01) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In Spire1C knockdown cells, 37.2 ± 5.7% (nintersections = 123, ncells = 11, p < 0.001) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In GFP-Spire1CΔKIND overexpressing cells, 29.5 ± 4.7% (nintersections = 95, ncells = 14, p < 0.01) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In GFP-Spire1C overexpressing cells treated with INF2 siRNA, 27.5 ± 5.3% (nintersections = 178, ncells = 16, p < 0.01) of ER-mitochondria intersections appeared to result in mitochondrial constriction.
DOI:
http://dx.doi.org/10.7554/eLife.08828.018
Spire1C overexpression enhances mitochondrial constriction via its WH2 and KIND domains in cooperation with INF2.
(A) Representative confocal images of U2OS cells expressing Ii33-mCherry in order to visualize ER tubules crossing over mitochondria in cells expressing mitoEmerald (first row) or overexpressing GFP-Spire1C (second row), GFP-Spire1C mWH2 (third row), GFP-Spire1CΔKIND (fourth row), or GFP-Spire1C while treated with INF2 siRNA (fifth row). Arrows indicate ER-mitochondria intersection points associated with mitochondrial constriction. Arrowheads indicate ER-mitochondria intersections not resulting in mitochondrial constriction. Scale bar: 1 μm. (B) Bar graphs representing the average percentage of ER-mitochondria intersections associated with mitochondrial constriction for each construct used. In cells expressing mitoEmerald, 55.2 ± 5.5% (nintersections = 172, ncells = 12) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In GFP-Spire1C overexpressing cells, 71.5 ± 4.5% (nintersections = 221, ncells = 15, p < 0.05) of ER-mitochondria intersections resulted in mitochondrial constriction. In GFP-Spire1C mWH2 overexpressing cells, 24.1 ± 2.4% (nintersections = 162, ncells = 11, p < 0.01) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In Spire1C knockdown cells, 37.2 ± 5.7% (nintersections = 123, ncells = 11, p < 0.001) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In GFP-Spire1CΔKIND overexpressing cells, 29.5 ± 4.7% (nintersections = 95, ncells = 14, p < 0.01) of ER-mitochondria intersections appeared to result in mitochondrial constriction. In GFP-Spire1C overexpressing cells treated with INF2 siRNA, 27.5 ± 5.3% (nintersections = 178, ncells = 16, p < 0.01) of ER-mitochondria intersections appeared to result in mitochondrial constriction.DOI:
http://dx.doi.org/10.7554/eLife.08828.018
Simulations indicate that pressure from actin polymerization and actomyosin contraction forces are sufficient for driving mitochondrial constriction
Given the above experimental results, we used in silico simulations to test a potential model in which forces mediated by the actin cytoskeleton induce mitochondrial constriction. In this scenario, actin filament polymerization within the gap between the ER tubule surrounding the mitochondria and the mitochondrial outer membrane (Figure 8A) results in localized pressure that drives mitochondrial constriction to diameters required for Drp1 helix formation (Korobova et al., 2013). This pressure could originate either from forces exerted by actin polymerization against the mitochondrial outer membrane (Korobova et al., 2013), or by myosin-II dimer mediated contraction of actin filaments lying between the ER and mitochondrial membranes (Hatch et al., 2014; Korobova et al., 2014), or by a concerted action of these two complementary mechanisms.
Figure 8.
Putative model for how mitochondrial Spire1C and ER-anchored INF2 could mediate mitochondrial constriction via actin filament assembly.
(A) Spire1C:actin complexes on mitochondria associate with INF2 on the ER. Actin filaments nucleated by Spire1C are elongated by the actin polymerization activity of INF2. The actin filament elongation activity exerts pressure on the mitochondrial outer membrane, thereby driving constriction of the latter. Tethering complexes may play a role in maintaining association between ER and mitochondrial membranes. Myosin-II dimers and the related contractile actin ring, which may also be involved in mitochondrial constriction, are not shown for simplicity. (B) Computational results showing mitochondrial shapes resulting from deformation by constricting pressure P developed by the actin polymerization and/or actin contractile based mechanisms (see also Figure 8—figure supplement 1, Figure 8—source data 1, and ‘Materials and methods’ for more information). The mitochondrial constriction site was modeled as a tubular membrane of about 680 nm length and with initial radius R = 230 nm. The dark blue strip in the middle represents the 50 nm wide zone of the pressure application. The images correspond to 3° of the mitochondria constriction characterized by cross-sectional radii r in the narrowest place of 145 nm, 110 nm and 65 nm. The corresponding values of the pressure P, the required numbers of the polymerizing actin filaments, N, and the required tensions in the actin contractile ring, γ, are presented in Figure 8—figure supplement 1 and Figure 8—source data 1.
DOI:
http://dx.doi.org/10.7554/eLife.08828.019
DOI:
http://dx.doi.org/10.7554/eLife.08828.020
(A) The cross-sectional radius in the narrowest place of the mitochondria shape, r, as a function of the pressure, P, exerted on the limited region in the middle of the constriction region (see Figure 8 of the main text). The radius, r, and the pressure, P, are presented in the universal dimensionless forms, r/R, and PR/2κ, where R is the initial (preceding the deformation) mitochondrial radius and κ is the membrane bending modulus. The dashed lines indicate the specific deformations presented in Figure 8 of the main text. (B) The number of the actin filaments, N, and the tension in the actin contractile ring, γ, providing the pressure as functions of the resulting mitochondria deformation. The deformation is quantified by r/R (see (A) for definition).
DOI:
http://dx.doi.org/10.7554/eLife.08828.021
Putative model for how mitochondrial Spire1C and ER-anchored INF2 could mediate mitochondrial constriction via actin filament assembly.
(A) Spire1C:actin complexes on mitochondria associate with INF2 on the ER. Actin filaments nucleated by Spire1C are elongated by the actin polymerization activity of INF2. The actin filament elongation activity exerts pressure on the mitochondrial outer membrane, thereby driving constriction of the latter. Tethering complexes may play a role in maintaining association between ER and mitochondrial membranes. Myosin-II dimers and the related contractile actin ring, which may also be involved in mitochondrial constriction, are not shown for simplicity. (B) Computational results showing mitochondrial shapes resulting from deformation by constricting pressure P developed by the actin polymerization and/or actin contractile based mechanisms (see also Figure 8—figure supplement 1, Figure 8—source data 1, and ‘Materials and methods’ for more information). The mitochondrial constriction site was modeled as a tubular membrane of about 680 nm length and with initial radius R = 230 nm. The dark blue strip in the middle represents the 50 nm wide zone of the pressure application. The images correspond to 3° of the mitochondria constriction characterized by cross-sectional radii r in the narrowest place of 145 nm, 110 nm and 65 nm. The corresponding values of the pressure P, the required numbers of the polymerizing actin filaments, N, and the required tensions in the actin contractile ring, γ, are presented in Figure 8—figure supplement 1 and Figure 8—source data 1.
Figure 8—figure supplement 1.
Computational results of simulations of mitochondrial constriction mediated by actin polymerization and actin constriction mechanisms.
(A) The cross-sectional radius in the narrowest place of the mitochondria shape, r, as a function of the pressure, P, exerted on the limited region in the middle of the constriction region (see Figure 8 of the main text). The radius, r, and the pressure, P, are presented in the universal dimensionless forms, r/R, and PR/2κ, where R is the initial (preceding the deformation) mitochondrial radius and κ is the membrane bending modulus. The dashed lines indicate the specific deformations presented in Figure 8 of the main text. (B) The number of the actin filaments, N, and the tension in the actin contractile ring, γ, providing the pressure as functions of the resulting mitochondria deformation. The deformation is quantified by r/R (see (A) for definition).
DOI:
http://dx.doi.org/10.7554/eLife.08828.021
DOI:
http://dx.doi.org/10.7554/eLife.08828.019
Specific values of the system parameters and the computational results for the three specific extents of mitochondrial constriction presented in Figure 8, Figure 8—figure supplement 1, and discussed in the main text.
DOI:
http://dx.doi.org/10.7554/eLife.08828.020
Computational results of simulations of mitochondrial constriction mediated by actin polymerization and actin constriction mechanisms.
(A) The cross-sectional radius in the narrowest place of the mitochondria shape, r, as a function of the pressure, P, exerted on the limited region in the middle of the constriction region (see Figure 8 of the main text). The radius, r, and the pressure, P, are presented in the universal dimensionless forms, r/R, and PR/2κ, where R is the initial (preceding the deformation) mitochondrial radius and κ is the membrane bending modulus. The dashed lines indicate the specific deformations presented in Figure 8 of the main text. (B) The number of the actin filaments, N, and the tension in the actin contractile ring, γ, providing the pressure as functions of the resulting mitochondria deformation. The deformation is quantified by r/R (see (A) for definition).DOI:
http://dx.doi.org/10.7554/eLife.08828.021To substantiate this, we created a simulation of mitochondrial constriction in response to a localized pressure generated by the above-mentioned mechanisms (Figure 8B, Figure 8—figure supplement 1, and Figure 8—source data 1). We modeled the constriction site of the mitochondrial outer membrane as a membrane tubule whose resistance to deformations is characterized by a bending modulus of 8 × 10−20 Joules, typical for a lipid bilayer (Helfrich, 1973). The pressure deforming the membrane tubule was applied in the middle of the constriction zone along a strip of 50-nm thickness, corresponding to that of a typical ER tubule, while the computed shapes of the mitochondria constriction region corresponded to those of three different constriction events imaged with electron tomography (Friedman et al., 2011) (Figure 8B). The computed pressure values required for generation of these 3 degrees of mitochondrial constriction (Figure 8—figure supplement 1 and Figure 8—source data 1) enabled us to calculate the numbers of polymerizing actin filaments, Nf, or the tension, γm, which has to be developed within the actin contractile system. Assuming that the force developed by one polymerizing actin filament is about 1 pN (Footer et al., 2007), the estimated filament number, Nf, varies between 10–20. The actomyosin tension values, γm, range from 2 to 3 pN. The obtained estimations for both Nf and γm are perfectly reasonable physiologically, which supports the feasibility of the suggested mechanisms. Thus, our results and model are fully consistent with previous studies suggesting that tightly regulated actin assembly at ER-mitochondria intersection sites facilitates mitochondrial membrane scission by Drp1 (Friedman et al., 2011; Korobova et al., 2013, 2014; Murley et al., 2013; Hatch et al., 2014; Li et al., 2015).
Discussion
A key event in the mitochondrion's life cycle is its division into distinct mitochondrial elements. Prior work studying this process demonstrated that division occurs at sites where ER wraps around mitochondria (Friedman et al., 2011; Murley et al., 2013), with the ER providing a platform for actin polymerization mediated by the ER-anchored formin INF2 (Korobova et al., 2013, 2014; Hatch et al., 2014). This actin meshwork is proposed to provide the force that drives mitochondrial constriction prior to Drp1-mediated mitochondrial division. Missing from this picture has been a molecular player that regulates INF2-mediated actin polymerization, ensuring that polymerization occurs specifically at ER-mitochondria contact sites to drive mitochondrial constriction and division. Here, we demonstrate that Spire1C, a novel mitochondrial outer membrane protein, can serve this role by both binding to INF2 as well as by acting as an actin-nucleator.Spire proteins are membrane-binding actin-nucleators that interact with and regulate formin proteins (Bosch et al., 2007; Quinlan et al., 2007; Pechlivanis et al., 2009; Pfender et al., 2011; Schuh, 2011; Vizcarra et al., 2011; Quinlan, 2013). Given this, Spire proteins are potential candidates for regulating the actin polymerization activity of INF2 on mitochondrial membranes. In searching for such a protein, we identified a specific isoform of Spire1, Spire1C, which resides on mitochondria and interacts with INF2. Spire1C is distinct from other Spire proteins in having mitochondrial outer membrane localization. This localization is a result of Spire1C's unique ExonC domain, which serves as a mitochondria-targeting sequence. Spire1C undergoes lateral diffusion on the mitochondrial outer membrane, and is oriented with its formin-binding and actin-nucleating domains facing the cytoplasm. Spire1C promotes actin assembly on mitochondrial outer membranes; when Spire1C is overexpressed a massive buildup of actin around mitochondria is observed. The actin buildup is dependent on Spire1C's actin-nucleating WH2 domain, but not its formin-binding KIND domain. Therefore, Spire1C's canonical actin-nucleating domain drives actin accumulation on mitochondria independently of its interactions with formin proteins.Given Spire1C's ability to assemble actin filaments on mitochondrial membranes, we examined whether modulating Spire1C's activity could affect mitochondrial lengths or their division rates, and we found that it can. Overexpressing Spire1C increases mitochondrial division rates while depleting Spire1C has the opposite effect, causing mitochondria to become highly elongated. Because the increased fission seen in cells overexpressing Spire1C depends not only on Spire1C's actin-nucleating WH2 domain but also its formin-binding KIND domain, we reasoned that Spire1C-mediated mitochondrial fission also depended on formin proteins. Given INF2's previously established role as a formin protein involved in ER-mediated mitochondrial constriction and division (Korobova et al., 2013, 2014; Hatch et al., 2014), we hypothesized that Spire1C could be working together with INF2. We postulated that Spire1C could be promoting mitochondrial division by interacting with ER-anchored INF2, in order to enable mitochondria to come into close proximity with the ER so that actin-nucleation by Spire1C could enhance actin assembly mediated by INF2. Supporting this possibility, we found in GST pulldown and fluorescence anisotropy assays that the Spire1C KIND domain directly binds to INF2. In cells overexpressing Spire1C lacking its KIND domain-mediated INF2-binding activity (Spire1CΔKIND) or its actin-nucleating activity (Spire1C mWH2), ER-mitochondria associations leading to mitochondrial constrictions were significantly decreased. Moreover, overexpressing Spire1CΔKIND prevented mitochondria from dividing in cells expressing a constitutively active INF2 mutant (INF2 A149) that normally induces dramatic mitochondrial fission (Korobova et al., 2013, 2014). Finally, Spire1C overexpression in cells lacking INF2 failed to induce mitochondrial fission.All these observations suggest a model in which mitochondrial Spire1C and ER-anchored INF2 conspire to mediate mitochondrial constriction via actin filament assembly. In this scheme, Spire1C:actin complexes on mitochondria associate with INF2 on the ER, acting together with other ER-mitochondria tethering complexes (Rowland and Voeltz, 2012) to draw the two organelles together. This results in the ER wrapping around the mitochondria. Once this occurs, actin filaments nucleated by Spire1C are elongated by the actin polymerization activity of INF2, similar to the ‘rocket launcher’ mechanism shown for other actin nucleating and formin proteins (Breitsprecher et al., 2012). Because INF2 can both polymerize and sever actin filaments, a complex meshwork of actin grows between the ER and mitochondria, which may be further impacted by myosin-II dimer recruitment (Hatch et al., 2014; Korobova et al., 2014) as well as perhaps other actin-regulatory proteins such as cofilin or Arp2/3 (Derivery et al., 2009; Liu et al., 2009; Li et al., 2015). The growing actin meshwork between the ER and mitochondria then exerts pressure on the mitochondrial outer membrane causing its constriction. Our computational modeling of this process confirmed that polymerizing actin filaments from this meshwork has sufficient force to bend and constrict the mitochondrial membrane once the filaments abut the mitochondria surface.Clearly, further work is needed to clarify the mechanism by which Spire1C and INF2 facilitate mitochondrial division. First, a better understanding of how Spire1C and INF2 interact with and regulate one another's activities during mitochondrial constriction is required. The relatively low affinity between Spire1C's KIND domain and INF2 detected in our assays, if applicable to living cells, is consistent with Spire1C:INF2 dissociation once INF2 begins to elongate actin filaments. Second, as several proteins are known to tether ER-mitochondrial membranes (Rowland and Voeltz, 2012), the role of these proteins in promoting or disrupting Spire1C's interaction with INF2 also needs to be studied. Such interactions may underlie differences in the mode of mitochondrial division seen in cells undergoing apoptosis, mitophagy, mitosis, or in response to toxins such as LLO from Listeria (Chan, 2012; Hoppins and Nunnari, 2012; Youle and van der Bliek, 2012; Stavru et al., 2013). Finally, the precise organization of the actin meshwork responsible for constricting mitochondria needs to be characterized at higher resolution. This will help determine whether the actin meshwork constricts mitochondria by myosin-mediated contraction, by elongating filaments pushing, or by a combination of both.While we have focused on Spire1C's role in mitochondrial constriction, the establishment of Spire1C as a mitochondrial outer membrane protein suggests that Spire1C is optimally positioned to serve as a molecular hub that links mitochondrial dynamics to the actin cytoskeleton as well as to the ER. While our appreciation of the role of actin in mitochondrial division is rapidly growing (De Vos et al., 2005; Korobova et al., 2013, 2014; Hatch et al., 2014; Li et al., 2015), there are other important functions for actin in mitochondrial dynamics, such as mitochondrial motility in neurons (Hollenbeck and Saxton, 2005; Pathak et al., 2010), mitochondrial partitioning prior to cell division in fibroblasts (Quintero et al., 2009; Rohn et al., 2014), and perhaps also the partitioning of mitochondrial DNA (Boldogh et al., 2003, 2004; Reyes et al., 2011). This list is almost certainly not exhaustive; there may yet be other known and unknown roles for the actin cytoskeleton in mitochondrial biology, and vice versa. Interestingly, Spire1C directly interacts with the tail domain of myosin Va (data not shown), an actin-binding motor protein that has been shown to be involved in both mitochondrial and ER movement in neurons (Wagner et al., 2011). In other cellular systems myosin Vb, Rab11a, and Spire proteins cooperate to drive actin-based vesicle movements and dynamics (Schuh, 2011; Montaville et al., 2014)—perhaps similar mechanisms exist for mitochondrial movements. Along these lines, it is interesting to note that Rab11a has also been implicated in mitochondrial dynamics (Landry et al., 2014)—exploring these findings in the context of Spire1C function may provide new insight towards mitochondrial movements and dynamics, and perhaps the relationship between actin-dependent motility and actin-dependent fission. Finally, the recent discovery of a role for the ER in mediating endosomal constriction and division raises the possibility that endosomal isoforms of Spire (Kerkhoff, 2006; Liu et al., 2009) are playing a similar role in promoting ER/actin/INF2-mediated endosomal fission. In fact, results from previous studies suggest that overexpression of the endosomal Spire2 protein lacking its KIND domain may result in endosome elongation (Dietrich et al., 2013), which would be analogous to what we have observed for Spire1CΔKIND overexpression and mitochondria.In conclusion, our identification and characterization of Spire1C as an ER- and actin-binding mitochondrial outer membrane protein opens the door for novel avenues towards understanding the regulation of myriad roles of actin, mitochondria, and the ER in cellular function and disease (Rappold et al., 2014).
Materials and methods
Cell culture and transfections
U2OS and Cos-7 cells were purchased from ATCC (Manassas, VA). U2OS cells stably expressing GFP-INF2 was described in Chhabra et al. (2009). All cells were grown in DMEM (Invitrogen, Carlsbad, CA) with 10% fetal bovine serum. For imaging, fibronectin coated coverslips ranging between 168 and 172 μm (for fixed cell imaging) or #1.5 LabTek chambers (for live cell imaging) were incubated with 10 μg/ml of fibronectin in PBS at 37°C for 30 min prior to plating the cells. Transient transfections were performed using FuGene 6 (Promega, Madison, WI) according to the manufacturer's recommendations. For overexpression experiments, 1 μg of DNA per coverslip was used. For minimal perturbation while imaging ER and mitochondria, 50 ng of DNA was used as described in Friedman et al. (2011). For siRNA transfections, cells were treated as in Korobova et al. (2013). Briefly, U2OS cells stably expressing GFP-INF2 (Chhabra et al., 2009) were plated on 6-well plates, treated with 63 pg of siRNA per well, and analyzed 72 hr post-transfection. siRNA or shRNA-mediated knockdown was confirmed by loss of GFP-INF2 or GFP-Spire1C fluorescence.
Plasmids and siRNA oligonucleotides
Ii33-mCherry was a generous gift from P Satpute (National Institutes of Health, Bethesda, MD). MitoEmerald and mitoRFP were gifts from A Rambold (National Institutes of Health, Bethesda, MD). Spire1C was amplified from mouse brain cDNA using the sequence of NM_194355 as a reference. We expected to obtain a sequence yielding protein corresponding to GI 37595748, however, it contained an additional 58 residues (ExonC). Thorough examination of all available mammalianSpire1 isoforms revealed at least 3 alternatively-spliced exons, which we refer to as exons A (majority of KIND domain), B (protein sequence AVRPLSMSHSFDLS), and C (protein sequence VPRITGVWPRTPFRPLFSTIQTASLLSSHPFEAAMFGVAGAMYYLFERAFTSRWKPSK).To obtain a full-length Spire1C construct, we amplified the mouseSpire1 gene AK129296, which contains the full KIND domain through the first 3 WH2 domains, along with NM_194355, which contains a partial KIND domain and ExonC without Exon B. A series of amplifications of partial gene sequences was then performed to obtain versions of mouseSpire1 that were ± each of exons A, B, and C (Figure 1—figure supplement 1). Each variant of the Spire1 gene was cloned into the AscI and PacI sites of modified pCS2+ vectors containing epitope tag sequences adjacent to the multiple cloning site, creating Spire1C constructs with either N-terminal 6x-myc or fluorescent protein tags. For the FPP assay and knockdown experiments, humanSpire1C ORF XM_005258122 (acquired from Genscript USA Inc., Piscataway Township, NJ) was cloned into the pEGFP-C1/pmApple-C1 and pEGFP-N1/pmApple-N1 vectors (Clontech) using the XhoI-BamHI and NheI-AgeI restriction sites, respectively. A nucleation-deficient mutant of Spire1C (Spire1C mWH2) was generated by utilizing internal PstI and AfeI restriction sites in the Spire1C gene. A sequence of 822 nucleotides of the Spire1C gene between internal PstI and AfeI sites was synthesized (Genscript USA Inc.) that contained alanines in place of the key hydrophobic residues required for nucleation in all four WH2 domains (Quinlan et al., 2005; Loomis et al., 2006; Quinlan et al., 2007). Insertion of the alanine-mutated WH2 domains was confirmed with DNA sequencing. All primers used are shown below along with the WH2 mutant insertion.
Figure 1—figure supplement 1.
Construction of the complete Spire1C protein sequence as explained in detail in the ‘Materials and methods’.
Spire1C gene amplified from mouse brain cDNA. (A) Initial construct based on NM_194355 was later combined with the sequence based on AK129296 to form full-length Spire1C protein of 802 amino acids with all known exons. (B) Spire1C diagram showing both characterized (red, blue, yellow, and orange) and uncharacterized (purple, green, and black) domains (indicated in the legend on the bottom).
DOI:
http://dx.doi.org/10.7554/eLife.08828.004
Primers for spire1 gene amplification and plasmid constructionPrimer 1 GCGCGGCGCGCCATGGAACTGCATACATTTCTGACCAAAATTAAGAGPrimer 2 GCGCTTAATTAATCAGATCTCGTTGATAGTCCGTTCTGAAGPrimer 3 GAGCAGGCGCGCCATGGCCAATACCGTGGAGGCTGPrimer 4 GGCGTTAATTAATCTAGTCTGCTCCGTCTAATTTCTTCPrimer 5 GACGGCGCGCCATGGCGCAGCCCTCCAGPrimer 6 GGCGTTAATTAATCTAGTCTGCTCCGTCTAATTTCTTCPrimer 7 CCATGTGCTCCAGGAAGAAGCCPrimer 8 CTGCCTTCCAAGCCATACTCTACTCTACAll primers are 5′ to 3′. AscI or PacI restriction sites are underlined.
The entire amino acid sequence of Spire1C is below
MAQPSSPGGEGPQLGAAGGPRDALSLEEILRLYNQPINEEQAWAVCFQCCGSLRAAAARRQPHRRVRSAAQIRVWRDGAVTLAPAAAAAAEGEPPPASGQLGYSHCTETEVIESLGIIIYKALDYGLKENEERELSPPLEQLIDQMANTVEADGSKDEGYEAADEGPEDEDGEKRSISAIRSYQDVMKICAAHLPTESEAPNHYQAVCRALFAETMELHTFLTKIKSAKENLKKIQEMEKGDESSTDLEDLKNADWARFWVQVMRDLRNGVKLKKVQQRQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVMVNGDVPPRLKKSAHEVILDFIRSRPPLNPVSARKLKPTPPRPRSLHERILEEIKAERKLRPVPEEIRRSRLAVRPLSMSHSFDLSDVTTPEPKNVGESSMVNGGLTSQTKENGLSAAQQGSAQRKRLLKAPTLAELDSDEEEKSLHKSTSSSSASPSLYEDPVLEAMCSRKKPPKFLPISTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSLVPRITGVWPRTPFRPLFSTIQTASLLSSHPFEAAMFGVAGAMYYLFERAFTSRWKPSKEEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDVYTALKKGKLCFCCRTRRFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESCSRSEKPSTSHHRPLRSIARFSTKSRSVDKDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSAGPSEYCPSERTINEIKIND domainWH2 domains (mutated to alanine to make nucleation deficient)Alternate exon BAlternate ExonCSpire boxmFYVE domainSpire1 shRNA constructs were generated by cloning the sequences into Clontech's pSingle-tTS-shRNA vectors using the HindIII/XhoI restriction sites. The sequences cloned into the vector to knockdown Spire1C were 5′-TCGAGGGATTAGACGTAGCAGATTATTCAAGAG ATAATCTGCTACGTCTAATCTTTTTTACGCGTA-3′ (Spire1C 3′ UTR, used for fixed cell imaging) and 5′-TCGAGGCGAATAATCTCCTGACTAATTCAAGAGATTAGTCAGGAGATTATTCGTTTTTTACGCGTA-3′ (Spire1C ORF, used for live cell imaging). Oligonucleotides for humanINF2 siRNA were previously described in Korobova et al. (2013). Briefly, the sequence used to knockdown INF2 was 5′-ACAAAGAAACTGTGTGTGA-3′, and as a control, Silencer Negative Control #1 (Ambion) was used.
Amplification of alternate ExonC DNA from mouse tissue panel
Oligos flanking ExonC were designed to amplify the spire1C gene. A mouse tissue cDNA panel (Clontech, Mountain View, CA) was used as a template for amplification using Primers 7 and 8. Amplified DNA containing ExonC was ∼400 bp, while DNA lacking this exon was ∼200 bp. Multiple oligomer sets were utilized to eliminate non-specific amplification while capturing as many on-target amplifications as possible. PCR reactions were run on a 2% agaorse gel, and bands of the appropriate size were excised from the gel and purified using a QIAquick gel extraction kit (Qiagen, Germantown, MD). Purified DNA was cloned into the pCR II-TOPO vector using the TOPO-TA cloning kit (Invitrogen). Sequence analysis was used to confirm the sequence of the amplified and inserted DNA.
Plasmids for antibody generation
The Spire1C gene was amplified from mouse cDNA as described above. Vectors used for protein purification include a modified avidin-6x his-MBP-TEV-3x FLAG-Precision construct under the P1 promoter, as well as a modified pGEX vector for N-terminal GST fusion proteins. All vector backbones were gifts of Dr. Aaron Straight and are described in Figure 1—figure supplement 2.
Figure 1—figure supplement 2.
Constructs used to probe Spire1 function.
(A) Spire1C constructs used in this study. Residue numbers are for the 802 a.a. full-length mouse Spire1C protein. (B) Coomassie-stained gels of purified proteins used for antibody production (pET constructs) and affinity purification (GST constructs).
DOI:
http://dx.doi.org/10.7554/eLife.08828.005
Antibody production and affinity purification
ExonC and the C-terminal 50 residues of mouseSpire1 were cloned into the avi-his-MBP-TEV-3xFLAG-precision vector described above or a modified pGEX vector (for N-terminal GST fusion proteins) using standard techniques (Figure 1—figure supplement 2). Avi-his-MBP-TEV-3xFLAG-precision constructs were expressed and purified as described above with the following modifications. For avi-his-MBP-TEV-3xFLAG-precision constructs, protein was purified over Ni-NTA resin, and the eluate was further purified on an S-200 gel filtration column, followed by a HiTrap Q column to remove any contaminating DNA. Protein samples were sent to Cocalico Biologicals and injected into rabbits to produce antisera.GST fusion proteins were used for affinity column construction for affinity purification of antibodies. These proteins were purified by using single colonies of transformed Rosetta (DE3) cells to inoculate 400 ml Terrific Broth (TB; Invitrogen) cultures containing 100 μg/ml carbenicillin, 34 μg/ml chloramphenicol, which was grown overnight at 37°C. This culture was diluted into 2 l of fresh TB with antibiotics and grown to an O.D. of 0.8–0.9, at which time it was moved to 23°C. After 1 hr at 23°C, cultures were induced with 0.5 mM isopropyl β-D-1-thiogalactopyranoside for 3–4 hr and harvested as described for purification of avi-his-MBP-TEV-3xFLAG-Precision proteins above. Cells were thawed in lysis buffer (50 mM Tris, 1 M NaCl, 1 mM EDTA, 1 mM DTT, and protease inhibitor cocktail, pH 7.8), sonicated, and lysates were centrifuged for 30 min at 125,000×g 4°C. Supernatant was applied to hydrated glutathione resin (2 ml bed volume per liter culture), protein bound for 1 hr at 4°C, and resin was washed extensively with lysis buffer. Protein was eluted with elution buffer (50 mM Tris, 150 mM NaCl, 1 mM EDTA, 20 mM reduced glutathione, 1 mM DTT, and protease inhibitor cocktail, pH 7.8) and loaded onto a HiTrapQ anion exchange column. A salt gradient of 150 mM to 1 M was used for protein elution.
Affinity column construction
Spire1 affinity columns were made using GST-fusion proteins following the method of Finan et al. (2011). Proteins were coupled to Affi-Gel 10 by washing with 5 resin/column vol (CV) of 0.2 M glycine, pH 2 and quickly equilibrating with PBS. Antisera was filtered through a 0.2 μm filter and flowed over the column continuously overnight. The column was washed with 50 CV wash buffer (PBS with 500 mM NaCl and 0.1% Tween 20), followed by 2.5 CV 0.2× PBS. Antibody was eluted with 1 CV 0.2 M glycine, pH 2 directly into 1 M Tris, pH 8.5 to neutralize the solution. Concentration of elution fractions was checked on a Nanodrop spectrophotometer using the IgG setting. The column was washed with 20 CV PBS, the antisera was re-filtered, and the purification process was repeated to isolate additional antibody. Fractions with an O.D. > 0.2 were pooled, dialyzed into PBS containing 50% glycerol, and stored at −20°C. Antisera to ExonC yielded no IgG after affinity purification. Instead, whole antisera were used for subsequent experiments to probe ExonC function and localization.
Antibody characterization
Two rabbit polyclonal antibodies described above and three commercially available antibodies were used for examining expression patterns of Spire1 protein in various cell types. The antibodies discussed are: (1) Rabbit polyclonal anti-Spire1 C-term (affinity-purified), (2) Rabbit polyclonal anti-Spire1 ExonC (whole antisera), (3) Sigma mouse monoclonal anti-Spire1, (4) Abcam (Cambridge, UK) mouse monoclonal anti Spire1, and (5) Abnova (Taipei, Taiwan) rabbit antisera to Spire1. Notably, all of the commercially-available antibodies were targeted to residues 482–584 of the Spire1 isoform lacking ExonC (NP_064533), and thus could only detect non-ExonC containing isoforms.Western blots were performed with 5–50 μg cell lysate and antibodies/antisera was tested at various concentrations, temperatures, and lengths of time for best conditions. Optimized conditions for all antibodies used in this work are described below. HRP-conjugated goat anti-rabbit secondary antibody was used at 1:20,000 in all cases.
GST pulldown assay
Spire-KIND (amino acids 1–234) was expressed as a GST fusion protein in bacteria, and purified on glutathione-sepharose (GE Biosciences, Buckinghamshire, UK) followed by Superdex200 gel filtration (GE Biosciences) of the glutathione-eluted GST-fusion protein. GST-KIND or GST alone was re-bound to glutathione-sepharose in binding buffer (50 mM KCl, 1 mM MgCl2, 1 mM EGTA, 10 mM Hepes-HCl pH 7.4, 1 mM DTT, 0.02% thesit (Sigma, St. Louis, MO), 10 μg/ml aprotinin, 2 μg/ml leupeptin, 0.5 mM benzamidine). INF2-CT (amino acids 469–1249, containing FH1, FH2 and C-terminal regions) and INF2-NT (amino acids 1–420, containing DID and dimerization region) were purified as described (Ramabhadran et al., 2012). Proteins were mixed at 20 μM GST protein, 1 μM INF2-CT and 10 μM INF2-NT in binding buffer and incubated overnight, then quickly washed once in binding buffer. Proteins in glutathionesepharose-bound pellet were resolved by SDS-PAGE.
Anisotropy binding assay
INF2 C-term (human CAAX variant, amino acids 941–1249) was expressed in bacteria, purified and labeled on its N-terminal amine with tetramethylrhodamine succinimide as described (Ramabhadran et al., 2013). Labeled INF2-C-term (20 nM) was mixed with varying concentrations of Spire-KIND or bovine serum albumin (BSA) in 10 mM Hepes pH 7.4, 50 mM KCl, 1 mM MgCl2, 1 mM EGTA, 1 mM DTT, 0.5 mM Thesit detergent (nonaethylene glycol monododecyl ether) at 23°C for 1 hr before reading fluorescence anisotropy in an M-1000 fluorescence plate reader (Tecan Inc) at 530 nm excitation and 585 nm emission.
Immunofluorescence
Cells were washed in phosphate buffered saline (PBS; pH 7.4) then fixed with 4% paraformaldehyde for 30 min. Cells were then permeabilized with 0.1% Triton X-100 for 30 min before being blocked overnight with 4% BSA at 4°C. The next day, cells were incubated with primary antibody for 2 hr, rinsed three times with PBS for 10 min each, then incubated with secondary antibodies (Invitrogen) for 1 hr, rinsed three times with PBS for 10 min each, then counterstained with phalloidin (Invitrogen) for 30 min, then rinsed with PBS three times, then mounted using ProLong Gold antifade reagent.
Confocal imaging
Confocal images were acquired with an Apochromat 63× 1.4 NA objective lens (Carl Zeiss, Jena, Germany) on a Marinas spinning disk confocal imaging system (Intelligent Imaging Innovations, Denver, CO) using an EM charge-coupled device camera (Evolve; Photometrics, Tucson, AZ), or a 100× Apo TIRF 1.49 NA objective (Nikon Instruments, Tokyo, Japan) on a Yokogawa CSU-X1 spinning disk system using an EM charge-coupled device camera (Evolve; Photometrics). Cells were imaged in HEPES-buffered growth media. Confocal z-stacks were taken using 200 nm steps. Images were deconvoluted using Slidebook 6. Individual 16-bit tiff image files were exported, then processed using ImageJ.
Photobleaching of GFP-Spire1C in specific cellular regions
GFP-Spire1C photobleaching experiments presented in Figure 2 and Figure 2—figure supplement 1 were carried out on a Marianas spinning disc confocal microscope equipped with a Mosaic Digital Illumination System. The laser power entering the Mosaic was 9 mW. Image acquisition and photobleaching of GFP-Spire1C (including region selection and 405 laser exposure control) were carried out using Slidebook 6 software.
SIM imaging
SIM imaging of fixed cells was performed using an ELYRA SIM (Carl Zeiss) with an Apochromat 63× 1.4 NA oil objective lens. Five angles of the excitation grid with five phases each were acquired for each channel and each z-plane, which were spaced at 110 nm each. SIM processing was performed using the SIM module of the Zeiss Zen software package. 16-bit grayscale tiffs were subsequently exported to ImageJ for quantification and processing into rendered colored images. Channels in maximum projection images were aligned in the xy-plane using maximum projection images of fluorescent beads.
Image processing and analysis
All image analysis and processing was performed using ImageJ. Mitochondria lengths were measured manually by first setting the scale according to pixel size, drawing a line along the length of the mitochondria, then using ImageJ's ‘measure’ function. Colocalization analysis and rendering was performed using the colocalization plugin included in the MacBiophotonics ImageJ plugin bundle (http://rsb.info.nih.gov/ij/plugins/mbf/index.html). When calculating Pearson's values, the mitochondria channel was used as a mask for colocalization. ER-mitochondria intersection sites were visually identified as regions where ER tubules could be clearly visualized crossing mitochondria—these regions were always in the periphery of the cell, significantly restricting the total number of intersections that could be reliably identified. Mitochondria constriction sites were visually identified as regions defined by relative narrowing of mitochondria diameter or reduced fluorescence. Magnifications of boxed regions were generated using ImageJ. Color images of merged 16-bit tiffs exported from the microscope were generated using the ImageJ ‘merge channels’ function. Statistical analysis was performed using Excel (Microsoft, Redmond, Washington). p-values were determined using the unpaired Student's t-test or ANOVA, as appropriate.
Modeling
The deformed shapes of the membrane tubule representing the constriction site of the mitochondrial outer membrane were determined by minimizing the energy of the membrane bending upon the condition of a given pressure P acting on a limited region in the middle of the tube (Figure 8B).The value of the bending energy, F, was determined bywhere κ = 8 × 10−20 Joule is the lipid bilayer bending modulus, J is the local total curvature of the membrane surface changing along the membrane surface and equal at each point to the sum of the local principal curvatures (Helfrich, 1973; Spivak, 1979). The integration in Equation 1 is performed over the whole surface of the deformed tubule.The boundary conditions for the energy minimization consisted in the requirements that at the tubule left and right edges (i) the tubule cross-sectional radius, r, remains equal to its initial (preceding the deformation) value r = R, and (ii) the tubule profile remains parallel to the tubule axis. While the tubule length L = 680 nm was required to remain constant during the deformation, the tubule surface area was free to change. This means that the membrane lateral tension was taken to be zero, which guaranteed that the membrane bending energy was the sole contribution to the membrane elastic energy.The energy minimization and the shape determination for each pressure value were performed using Brakke's ‘Surface Evolver’ program (Brakke, 1992).eLife posts the editorial decision letter and author response on a selection of the published articles (subject to the approval of the authors). An edited version of the letter sent to the authors after peer review is shown, indicating the substantive concerns or comments; minor concerns are not usually shown. Reviewers have the opportunity to discuss the decision before the letter is sent (see review process). Similarly, the author response typically shows only responses to the major concerns raised by the reviewers.Thank you for submitting your work entitled “A mitochondria-anchored isoform of the actin-nucleating Spire protein regulates mitochondrial division” for peer review at eLife. Your submission has been favorably evaluated by Vivek Malhotra (Senior editor) and three reviewers, one of whom, Pekka Lappalainen, is a member of our Board of Reviewing Editors. One of the three reviewers, Liza Pon, has also agreed to share her identity.The reviewers have discussed the reviews with one another and the Reviewing editor has drafted this decision to help you prepare a revised submission.Previous studies revealed that constriction of mitochondria, which precedes Drp1-mediated mitochondrial fission, occurs at sites of close contact between ER and mitochondria, and is driven in part by INF2-mediated actin polymerization. Here Manor et al. show that a specific splice-variant of an actin nucleating protein Spire (named Spire1C) localizes to the mitochondria outer membrane through a specific a-helical motif encoded by its alternate exon C. Importantly, they demonstrate that Spire1C promotes actin filament assembly at the mitochondrial surfaces and modulates mitochondrial fission through its actin-binding WH2 domains and its KIND domain, which specifically binds to INF2 formin. Collectively, these studies provide evidence that Spire1C and INF2 cooperate to form mitochondria-ER intersections, and to promote efficient actin filament assembly specifically at these sites.The majority of the data presented in the manuscript are convincing and the study provides fundamentally important new insights into the mechanisms of mitochondrial fission. However, there are few important issues that should be addressed to confirm the conclusions presented and to further strengthen this study.Essentials revisions:1) Most of the studies presented are based on Spire1C over-expression. The authors should thus perform the mitochondrial fission (Figure 4C) and ‘mitochondrial constriction’ assays (Figure 7) also on Spire1C knockdown cells. The effects of Spire RNAi should also be verified with an additional shRNAi construct, or the authors could try to rescue the phenotype of Spire RNAi cells. Together, these experiments would perhaps also reconcile some inconsistencies in the data. For example, while cell quantification suggests that Spire1C overexpression induces mitochondrial fragmentation (Figure 4), the images presented in the manuscript (e.g. in Figure 5) either show normal or even elongated mitochondria.2) The lipid specificity assay (shown in Figure 2–figure supplement 1) is not particularly convincing and should be omitted from the manuscript. Lipid specificity of a transmembrane protein (or a hydrophobic protein motif that penetrates into the acyl chain region of the bilayer) cannot be studied using lipid strips, where the individual lipid molecules are most likely not organized into a proper bilayer. Thus, if the authors wish to examine lipid specificity of ExonC, they should instead perform proper vesicle co-flotation or co-sedimentation assays.3) The authors should provide better controls for the protease sensitivity assay. This assay would benefit from analysis of a protease sensitive IMS protein to confirm that the protease treatment conditions used degrades OM protein without affecting the integrity of the OM. Furthermore, based on the sequence analysis (presented in Figure 1–figure supplement 3) ExonC is predicted to consist of two a-helices, which both are long enough (15-20 residues) to span the mitochondrial outer membrane. Would it be possible that these helices could either make a ‘hairpin’, which spans the outer membrane twice, or that this region would instead just ‘horizontally’ penetrate into the acyl-chain region of the mitochondrial outer membrane without spanning the entire bilayer? To provide stronger support for the conclusions presented, the authors should repeat the assay with a C-terminal GFP-fusion of full-length Spire1C (to confirm that the C-terminus of full-length Spire1C indeed does not face the cytosol as proposed in the current version of the manuscript).1) Most of the studies presented are based on Spire1C over-expression. The authors should thus perform the mitochondrial fission (Figure 4C) and ‘mitochondrial constriction’ assays (Figure 7) also on Spire1C knockdown cells. The effects of Spire RNAi should also be verified with an additional shRNAi construct, or the authors could try to rescue the phenotype of Spire RNAi cells. Together, these experiments would perhaps also reconcile some inconsistencies in the data. For example, while cell quantification suggests that Spire1C overexpression induces mitochondrial fragmentation (Figure 4), the images presented in the manuscript (e.g. in Figure 5) either show normal or even elongated mitochondria.We have performed additional experiments using Spire knockdown cells (using two different shRNA constructs), and added the fission and constriction data to the manuscript (Figure 4C and Figure 7A), all of which is consistent with our other data.With regards to apparent inconsistencies in mitochondrial phenotype in Spire1C overexpressing cells: We found that in all conditions there was a range of mitochondrial lengths within each cell, as well as between cells. While the average mitochondrial lengths significantly changed depending on Spire or INF2 activities, nearly every cell has some mitochondria that are very short, and at least a couple that are longer. For the sake of clarity in some of our experiments (for example the FRAP data in Figure 2, actin accumulation on mitochondria in Figure 3, or the ER-mitochondria intersection data in Figure 5), we used cells with longer mitochondria in order to be able to make measurements as necessary (i.e. photobleaching only a small segment of very short mitochondria is nearly impossible, measuring ER-mitochondria intersections in cells where all the mitochondria are already fragmented is similarly impossible, and actin around fragmented mitochondria is more difficult to detect than on tubulated mitochondria where a continuous line of actin accumulation is more easily detectable within the already large amount of F-actin throughout the cytoplasm). In order to clarify our data in this regard, we have added as a supplemental figure a histogram showing the distribution of mitochondrial lengths for each condition (Figure 4–figure supplement 1).2) The lipid specificity assay (shown in Figure 2–figure supplement 1) is not particularly convincing and should be omitted from the manuscript. Lipid specificity of a transmembrane protein (or a hydrophobic protein motif that penetrates into the acyl chain region of the bilayer) cannot be studied using lipid strips, where the individual lipid molecules are most likely not organized into a proper bilayer. Thus, if the authors wish to examine lipid specificity of ExonC, they should instead perform proper vesicle co-flotation or co-sedimentation assays.We agree that co-flotation and/or co-sedimentation assays would better establish the lipid specificity of ExonC. This will require many more experiments that go beyond the scope of this work. Therefore, we have removed the lipid dot blot and will attempt to establish ExonC’s lipid specificity in a future study.3) The authors should provide better controls for the protease sensitivity assay. This assay would benefit from analysis of a protease sensitive IMS protein to confirm that the protease treatment conditions used degrades OM protein without affecting the integrity of the OM. Furthermore, based on the sequence analysis (presented in Figure 1–figure supplement 3) ExonC is predicted to consist of two a-helices, which both are long enough (15-20 residues) to span the mitochondrial outer membrane. Would it be possible that these helices could either make a ‘hairpin’, which spans the outer membrane twice, or that this region would instead just ‘horizontally’ penetrate into the acyl-chain region of the mitochondrial outer membrane without spanning the entire bilayer? To provide stronger support for the conclusions presented, the authors should repeat the assay with a C-terminal GFP-fusion of full-length Spire1C (to confirm that the C-terminus of full-length Spire1C indeed does not face the cytosol as proposed in the current version of the manuscript).We think the reviewers may have overlooked our control protein in the protease protection assay in making his/her statement “this assay would benefit from analysis of a protease sensitive IMS protein to confirm that the protease treatment conditions used degrades OM protein without affecting the integrity of the OM.” By definition, if our treatment conditions are not affecting the integrity of the OM, then any IMS protein would not be affected. This is exactly why we used the OMI-mCherry construct as a control in all of our experiments. OMI-mCherry localizes to the IMS – if the OM was being degraded by our digitonin treatment, then OMI-mCherry would escape into the cytoplasm. Similarly, if the OM was degraded enough that trypsin was able to digest proteins in the IMS, then OMI-mCherry would be depleted upon addition of trypsin. In none of our experiments did we observe depletion of OMI-mCherry mitochondrial fluorescence, indicating that the OM was indeed intact in all of our experimental conditions.We agree that it is important to be careful not to make any claims about the C-terminus of Spire1C being in the IMS, since our FPP assay only informs us that the C-terminal region of ExonC (which is in the middle of the full-length Spire protein) is protected from trypsinization. While our FPP assay leaves us confident that the C-terminus of ExonC is protected from the cytoplasm, we were unable to draw any conclusions from these assays as to the localization of the Spire1C C-terminus. While the secondary protein structure prediction software PHYRE identifies two putative alpha-helices within ExonC, only one of those helices was predicted to be a transmembrane domain by predictive software, so we chose not to postulate that there are two transmembrane domains in ExonC. However, we agree that the hairpin model the reviewers have proposed is just as likely to be correct, and is furthermore appealing since this would allow for the C-terminal domain of Spire1C to interact with other cytoplasmic proteins.We agree that an additional FPP assay using a C-terminus GFP-tagged Spire1C construct would ideally clarify the topology of the Spire1C C-terminus. In order to address the reviewers’ comments, we performed an additional FPP assay using a new Spire1C-GFP construct with GFP on the C-terminus. Unfortunately, when we expressed this construct, the protein no longer localized properly to mitochondria, instead displaying a mostly cytoplasmic localization pattern (with barely detectable accumulation on mitochondria). Due to this disrupted localization pattern, we were unable to draw any conclusions from an FPP assay; upon addition of digitonin, all of the GFP fluorescence was almost immediately depleted, even without subsequent addition of trypsin. While this result may give some clue as to how Spire1C localizes to the OM, many more experiments that go beyond the scope of this work would have to be performed in order to determine what this result is telling us. Thus, we have mentioned these latest findings in the text, and modified our interpretation of our FPP data to include the likely possibility that Spire1C’s ExonC localizes in a hairpin or horizontal fashion on the outer leaflet of the outer mitochondrial membrane.
Source
Species
Type
Target region
IB dilution
Time
Temperature
IF dilution
Sigma
mouse
monoclonal
482–584 of NP_064533; ‘last 100 a.a.’; flanks (but does not contain) z′
Authors: Yoshihiro Adachi; Kie Itoh; Tatsuya Yamada; Kara L Cerveny; Takamichi L Suzuki; Patrick Macdonald; Michael A Frohman; Rajesh Ramachandran; Miho Iijima; Hiromi Sesaki Journal: Mol Cell Date: 2016-09-15 Impact factor: 17.970
Authors: Camila Lopez-Crisosto; Christian Pennanen; Cesar Vasquez-Trincado; Pablo E Morales; Roberto Bravo-Sagua; Andrew F G Quest; Mario Chiong; Sergio Lavandero Journal: Nat Rev Cardiol Date: 2017-03-09 Impact factor: 32.419
Authors: Abdel Aouacheria; Stephen Baghdiguian; Heather M Lamb; Jason D Huska; Fernando J Pineda; J Marie Hardwick Journal: Neurochem Int Date: 2017-04-28 Impact factor: 3.921
Authors: Balajikarthick Subramanian; Justin Chun; Chandra Perez-Gill; Paul Yan; Isaac E Stillman; Henry N Higgs; Seth L Alper; Johannes S Schlöndorff; Martin R Pollak Journal: J Am Soc Nephrol Date: 2020-01-10 Impact factor: 10.121
Authors: Elianne P Bulthuis; Merel J W Adjobo-Hermans; Peter H G M Willems; Werner J H Koopman Journal: Antioxid Redox Signal Date: 2018-11-29 Impact factor: 8.401