Literature DB >> 26112411

Kinetic Investigations of the Role of Factor Inhibiting Hypoxia-inducible Factor (FIH) as an Oxygen Sensor.

Hanna Tarhonskaya1, Adam P Hardy1, Emily A Howe1, Nikita D Loik1, Holger B Kramer2, James S O McCullagh1, Christopher J Schofield1, Emily Flashman3.   

Abstract

The hypoxia-inducible factor (HIF) hydroxylases regulate hypoxia sensing in animals. In humans, they comprise three prolyl hydroxylases (PHD1-3 or EGLN1-3) and factor inhibiting HIF (FIH). FIH is an asparaginyl hydroxylase catalyzing post-translational modification of HIF-α, resulting in reduction of HIF-mediated transcription. Like the PHDs, FIH is proposed to have a hypoxia-sensing role in cells, enabling responses to changes in cellular O2 availability. PHD2, the most important human PHD isoform, is proposed to be biochemically/kinetically suited as a hypoxia sensor due to its relatively high sensitivity to changes in O2 concentration and slow reaction with O2. To ascertain whether these parameters are conserved among the HIF hydroxylases, we compared the reactions of FIH and PHD2 with O2. Consistent with previous reports, we found lower Km(app)(O2) values for FIH than for PHD2 with all HIF-derived substrates. Under pre-steady-state conditions, the O2-initiated FIH reaction is significantly faster than that of PHD2. We then investigated the kinetics with respect to O2 of the FIH reaction with ankyrin repeat domain (ARD) substrates. FIH has lower Km(app)(O2) values for the tested ARDs than HIF-α substrates, and pre-steady-state O2-initiated reactions were faster with ARDs than with HIF-α substrates. The results correlate with cellular studies showing that FIH is active at lower O2 concentrations than the PHDs and suggest that competition between HIF-α and ARDs for FIH is likely to be biologically relevant, particularly in hypoxic conditions. The overall results are consistent with the proposal that the kinetic properties of individual oxygenases reflect their biological capacity to act as hypoxia sensors.
© 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

Entities:  

Keywords:  HIF hydroxylase; ankyrin repeat domain; dioxygenase; factor inhibiting HIF; hypoxia; hypoxia-inducible factor (HIF); kinetics; oxygen sensor; pre-steady-state kinetics; prolyl hydroxylase

Mesh:

Substances:

Year:  2015        PMID: 26112411      PMCID: PMC4528135          DOI: 10.1074/jbc.M115.653014

Source DB:  PubMed          Journal:  J Biol Chem        ISSN: 0021-9258            Impact factor:   5.157


Introduction

The chronic hypoxic response in animals is mediated by the heterodimeric (α/β) hypoxia-inducible transcriptional factor (HIF), accumulation of which triggers up-regulation of an array of genes, including those encoding for erythropoietin, vascular endothelial growth factor (VEGF), vasomotor regulators, and glycolytic enzymes (reviewed in Refs. 1–4). The levels and activity of HIF isoforms in cells are regulated by post-translational hydroxylation of their HIF-α domains, as catalyzed by prolyl hydroxylase domain enzymes (PHD1–3, also known as EGLN1–3) and factor inhibiting HIF (FIH), collectively termed the HIF hydroxylases (5). The PHDs catalyze hydroxylation of one or both of two proline residues in the O2-dependent degradation region of HIF-α (C-terminal oxygen-dependent degradation domain (CODD) and N-terminal oxygen-dependent degradation domain (NODD)), resulting in its targeting to the proteasome (2, 6). FIH catalyzes hydroxylation of an asparaginyl residue in the HIF-α C-terminal transactivation domain (CAD), which leads to reduced interaction of HIF with the transcriptional co-activator proteins CBP/p300 (CREB-binding protein/p300) (7–9). Together with the PHDs, FIH is proposed to act as an O2 sensor in cells, providing a direct link between cellular O2 concentrations and the hypoxic response (5, 10, 11). The PHDs and FIH catalyze hydroxylation of both HIF-1α and HIF-2α isoforms. The HIF-1/2α isoforms have similar domain architectures and characteristics; however, differences in their properties have been identified, and they are not biologically redundant (12, 13). Whereas HIF-1α is mostly responsible for activation of glycolytic pathway genes (e.g. HK1 (hexokinase 1) and HK2 (hexokinase 2)), HIF-2α is involved in regulation of genes responsible for cell cycle progression (e.g. cyclin D1), tumor growth, erythropoiesis (EPO (erythropoietin)), and maintaining stem cell pluripotency among other functions (14, 15). In addition, there is evidence that HIF-1/2α can act as either pro-oncogenic or tumor suppressor factors, depending on the context in which they are present (12, 16, 17). Although FIH was first identified as a HIF hydroxylase, it has subsequently been shown to hydroxylate semiconserved Asn residues in many proteins containing ankyrin repeat domains (ARDs) (18). ARDs comprise a conserved sequence of 33 residues and are extensively involved in protein-protein interactions (reviewed in Ref. 19). The range of ARD-containing substrates for FIH is apparently very diverse (19), including tankyrase, NF-κB (nuclear factor κ-light chain enhancer of activated B cells, a protein complex that controls transcription of DNA), Notch-1 (neurogenic locus notch homolog protein, a transmembrane protein involved in signaling), MYPT-1 (the myosin phosphatase targeting protein, a regulatory subunit of protein phosphatase 1), and vanilloid 3 channel (hydroxylation of which abolishes activity (20)). In contrast to the “switchlike” signaling effect of CAD hydroxylation on HIF activity, no such well defined role for FIH-catalyzed ARD hydroxylation has yet been defined. In some but probably not all cases, Asn hydroxylation has been observed to stabilize the ARD protein fold (21–24). Competition between ARDs and HIF-α isoforms for FIH is proposed to tune the hypoxic response and has the potential to enable memory of hypoxic events (25). Recombinant FIH has been shown to be capable of catalyzing hydroxylation of residues besides Asn in the context of ARDs (e.g. His, Leu, or Ser residues) (26), with some of these reactions having been shown to occur in human cells (27), demonstrating that FIH is a highly promiscuous enzyme. The HIF hydroxylases are Fe(II)/2-oxoglutarate (2OG)-dependent oxygenases, a family of enzymes with wide-ranging biological roles (28). The 2OG oxygenases have a conserved double-stranded β-helix fold that supports an Fe(II)-coordinating HX(D/E)XH catalytic triad and employ a conserved consensus oxidation mechanism (29, 30): formation of an enzyme·Fe(II)·2OG·substrate ternary complex allows O2 activation followed by 2-electron oxidation of 2OG coupled to oxidation of the substrate (Fig. 1). A substantial body of structural, kinetic, and spectroscopic evidence supports this consensus mechanism (29, 31–34). Transient kinetics combined with spectroscopic techniques have provided evidence for intermediates (including the reactive Fe(IV)-oxo species (32)) and have been used to measure the kinetics of events following O2 binding. For some 2OG oxygenases, O2 binding is followed by rapid formation of the reactive intermediates (∼<1 s) (e.g. for TauD (taurine dioxygenase) (32, 35), vCPH (a viral collagen prolyl hydroxylase) (36), and DAOCS (deacetoxycephalosporin C synthase) (37). However, for PHD2, the most important of the human PHDs, we found that the rate of reaction subsequent to O2 exposure was considerably slower than for TauD (∼100-fold) (38). Combined with the graded response of PHD2 to increasing O2 concentrations in steady-state kinetic assays and also in cells (11, 39), we have proposed that the apparently slow reaction of PHD2 with O2 reflects its role as an O2 sensor (38).
FIGURE 1.

The PHD- and FIH-catalyzed reactions and outline of the proposed consensus mechanism for 2OG-dependent oxygenases. A, prolyl hydroxylation performed by PHD2; B, asparaginyl hydroxylation as performed by FIH; C, O2 binding subsequent to formation of the enzyme·substrate complex leads to 2OG decarboxylation with the formation of an Fe(IV)-oxo intermediate, which then performs oxidative modification of the “prime” substrate (e.g. HIF-α).

The PHD- and FIH-catalyzed reactions and outline of the proposed consensus mechanism for 2OG-dependent oxygenases. A, prolyl hydroxylation performed by PHD2; B, asparaginyl hydroxylation as performed by FIH; C, O2 binding subsequent to formation of the enzyme·substrate complex leads to 2OG decarboxylation with the formation of an Fe(IV)-oxo intermediate, which then performs oxidative modification of the “prime” substrate (e.g. HIF-α). Although FIH is proposed to be an O2-sensing HIF hydroxylase, cellular and kinetic data suggest that FIH is less efficient at detecting deviations from normoxia than the PHDs. In cells, FIH is still substantially active under hypoxic conditions, whereas PHD activity drops significantly (39). The differences are apparently reflected in the lower reported Kapp(O2) values for FIH (∼90–200 μm for FIH compared with ∼250 μm to 1.7 mm for PHD2 (10, 40–42)). Interestingly, the Kapp(O2) for FIH has also been reported to be substrate-dependent (43), with a lower Kapp for O2 for Notch-1 (ARD) hydroxylation than for HIF-1α hydroxylation, suggesting that FIH may be more active toward at least some ARDs than HIF-α substrates in hypoxia. Because targeting the HIF hydroxylases for the treatment of hypoxia-related diseases is of medicinal interest (PHD inhibitors are presently undergoing large scale clinical trials), a detailed understanding of the kinetics of these enzymes with respect to O2 is important to compare and rationalize the sensitivity of the HIF hydroxylases to hypoxia. Following our observation of the slow reaction of PHD2 with O2, we therefore conducted a detailed investigation of the kinetics of the reaction of FIH with O2. First, we investigated whether the slow reaction with O2 (as observed for a PHD2·HIF-1α complex (38, 42)) was conserved among O2-sensing HIF hydroxylases. Second, we investigated the effect of different substrates on the kinetics of the reactions of PHD2 and FIH with O2, in terms of HIF-1/2α isoforms, HIF hydroxylation sites for PHD2, and FIH with HIF versus ARD substrates. We describe spectroscopic, kinetic, and mechanistic evidence revealing that the reaction of PHD2 with O2 is notably slow in the presence of all tested HIF substrates. We also report that the reaction of FIH with O2 is significantly faster than for PHD2 in the presence of all HIF-1/2α substrates and to an even greater degree in the presence of all tested ARD substrates. The results are consistent with studies indicating that FIH is more active than the PHDs under hypoxic conditions (39) as well as the reported ability of FIH to preferentially hydroxylate ARD rather than HIF substrates (19, 44). The work also demonstrates that, at least for PHD2 and FIH, the kinetic properties of these enzymes with respect to O2 reflect their cellular hypoxia-sensing ability.

Experimental Procedures

Full-length recombinant FIH, two- and three-consensus ankyrin repeats (2CA and 3CA) were produced as described (21) in Escherichia coli BL21(DE3) cells and purified as His6-tagged proteins with subsequent thrombin cleavage of the tag. The catalytic domain of PHD2 (residues 181–426) was purified as described (45). 1CA, tankyrase-120-mer, HIF-2α CAD35-mer, HIF-1α CAD35-mer, tankyrase-135-mer, HIF-1α CAD19-mer, HIF-2α CAD19-mer, HIF-1α or HIF-2α CODD19-mer, and HIF-1α or HIF-2α NODD19-mer peptides were purchased from GL Biochem (Shanghai) Ltd., China. The N and C termini of the peptides were amino groups and carboxylates (Table 1).
TABLE 1

Sequences of the peptide substrates used in this study

Where peptides represent fragments of a protein, amino acid numbers are given in parentheses.

PeptideSequence
CODD HIF-1α19-mer (556–574)DLDLEMLAPYIPMDDDFQL
CODD HIF-2α19-mer (523–541)ELDLETLAPYIPMDGEDFQ
NODD HIF-1α19-mer (395–413)DALTLLAPAAGDTIISLDF
NODD HIF-2α19-mer (398–416)EELAQLAPTPGDAIISLDF
CAD HIF-1α19-mer (789–806)DESGLPQLTSYDCEVNAPI
CAD HIF-1α35-mer (789–822)DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL
CAD HIF-2α19-mer (832–850)ESYLLPELTRYDCEVNVPV
CAD HIF-2α35-mer (832–866)ESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRAL
1CA20-merHLEVVKLLLEAGADVNAQDK
tankyrase-120-mer (849–868)NLEVAEYLLEHGADVNAQDK
tankyrase-135-mer (844–886)AAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAA
2CASDKNGSTPLHLAARNGHLEVVKLLLEHGADVNAQDKWGKTAFDISIDNGNEDLAEILQ
3CAGSHMGSDLGKKLLEAARAGQDDEVRILMANGADVAAKDKNGSTPLHLAARNGHLEVVKLLLEAGADVNAQDKFGKTAFDISIDNGNEDLAEILQ

Enzyme Activity Assays and Studies of O2 Dependence

Enzymatic assays were conducted as described (46, 47). Unless otherwise stated, the assay mixture typically contained 5 μm FIH, 500 μm substrate, 500 μm 2OG, 1 mm l-ascorbate, and 50 μm Fe(NH4)2(SO4)2 or 4 μm PHD2, 100 μm substrate, 300 μm 2OG, 4 mm l-ascorbate, and 50 μm Fe(NH4)2(SO4)2. For HIF-1α CODD19-mer, the background levels of methionine oxidation resulting from assay conditions were subtracted based on non-enzymatic controls (48). Determination of initial velocities in steady-state kinetic experiments was performed varying the (co-)substrate concentrations and maintaining concentrations of components at levels higher than 2 × Kapp to ensure saturation conditions. The O2 dependence of FIH-catalyzed reactions was determined by conducting enzymatic assays in an “In vivo 500 Hypoxia Workstation” (Ruskinn) using buffers pre-equilibrated under different pO2 values for 24 h. The O2 dependence of PHD2-catalyzed reactions was determined by conducting enzymatic assays in sealed glass vials with variable N2/O2 contents (42). Reactions were stopped by spotting samples onto a matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF-MS) target plate and immediately mixing with α-cyano-4-hydroxycinnamic acid matrix. Hydroxylation levels were assessed by MALDI-TOF-MS as described (46).

Stopped-flow UV-visible Spectroscopy Experiments

Stopped-flow UV-visible spectroscopy experiments were performed as described previously (32, 42). Anerobically prepared assay mixtures containing 0.5 mm apo-FIH, 1 mm substrate, 5 mm 2OG, 0.4 mm Fe(II) or 0.8 mm apo-PHD2, 1 mm substrate, 5 mm 2OG, 0.5 mm Fe(II) were rapidly mixed with O2-free/O2-saturated buffer. The reaction was observed over 1000 s using a photodiode array detector, and kinetic traces were analyzed using Origin version 8.51 software. Data were fitted with a double exponential function (y = A1 × exp(−kriset) + A2 × exp(−kfallt) + y0). The A1, A2, and y0 parameters were restricted with upper limits to match the observed amplitude/offset changes.

Rapid Quench-Flow Experiments

Rapid quench-flow experiments were performed using the same conditions and preparation of the assay mixture as used in stopped-flow experiments. Rapid quench-flow equipment (TgK Scientific Ltd.) in an anaerobic glove box was used for the experiments. Samples were quenched with 1% CF3CO2H and analyzed using MALDI-TOF-MS (peptide hydroxylation) as described above or liquid chromatography-mass spectrometry (LC-MS, for succinate production). For LC-MS, chromatographic separation was performed at 50 °C using a Waters ACQUITY BEH Amide 1.7-μm, 2.1 × 100-mm column on a Waters ACQUITYTM ultraperformance liquid chromatography system (Waters Corp., Milford, MA). The following eluents were used: mobile phase A: 10% H2O, 90% acetonitrile (v/v), 10 mm ammonium formate; mobile phase B: 50% H2O, 50% acetonitrile (v/v), 10 mm ammonium formate. The elution gradient was 0–7.0 min linear from 10 to 30% B, and 7.0–9.0 min at 10% B for re-equilibration of the column. A constant flow rate of 0.4 ml/min was used. Analytes were detected in negative ionization mode using single reaction monitoring on a Quattro triple quadrupole mass spectrometer (Waters) with a cone voltage of 15 V and a capillary voltage of 3.0 kV. The desolvation temperature was set to 250 °C, and the source temperature was set to 120 °C.

Intact protein LC-MS

Samples obtained from FIH kinetic assays with 2CA and 3CA were diluted to a substrate concentration of 5 μm and then analyzed using a Waters® LCT Classic mass spectrometer by electrospray ionization in positive ion mode. An Agilent HP1100 LC system was used, and samples were run through a Phenomenex® Aeris Widepore 3.6-μm XB-C8 150 × 2.1-mm column at 0.5 ml/min in a gradient of phase A (95% H2O, 5% CH3CN, 0.01% formic acid) to phase B (95% CH3CN, 5% H2O, 0.01% formic acid). The LC/MS used the following method: 0–1.5 min, 100% A and then 1.5–12 min linear gradient from 0 to 100% B, 12–14 min 100% B, and 15.0–19.0 min 100% A for re-equilibration of the column. Data were collected and analyzed using MassLynx version 4.0.

CD Spectroscopy

CD spectra were recorded using a Chirascan CD/fluorimeter (Applied Photophysics) spectrometer. Measurements were carried out at 20 °C in a 0.1 cm path length quartz cuvette, with protein concentration of 0.125 mg/ml in 5 mm sodium phosphate buffer (pH 8.0). Spectra were recorded in the wavelength range of 260–190 nm at 0.5-nm intervals, and each spectrum represents an average of three scans. Spectra were baseline-corrected by subtraction of the buffer spectrum. Data were expressed as the mean residue ellipticity ([θ], degrees·cm2·dmol−1). Thermal denaturation experiments were performed under the same conditions. The ellipticity at 220 nm (θ220) was monitored from 10 to 90 °C.

MALDI-TOF/TOF-MS/MS

Hydroxylation sites were assigned unambiguously by MALDI-TOF/TOF mass spectrometry (Fig. 2) using a Bruker Ultraflex instrument, essentially as described previously (25). Thus, peptide samples were spotted onto an AnchorChip target plate with an α-cyano-4-hydroxycinnamic acid matrix using the dried droplet method. MS and MS/MS spectra were acquired by manual operation in reflectron mode, and the instrument was calibrated directly prior to data acquisition using monoisotopic peptide masses with Peptide Calibration Standard II (Bruker Daltonics, Coventry, UK). Sample ionization was achieved with a nitrogen laser (337 nm), and MS/MS spectra were generated by laser-induced dissociation (49). Assignment of hydroxylation sites in other peptides used in this study was performed previously (8, 21, 22, 26, 50).
FIGURE 2.

Assignment of modification sites by MALDI-TOF/TOF laser-induced dissociation fragmentation of hydroxylated peptide substrates. Modification sites were confirmed by enzymatic hydroxylation of synthetic peptide substrates followed by MS/MS analysis with MALDI-TOF/TOF laser-induced dissociation. A, CODD HIF-2α. B, NODD HIF-2α. C, NODD HIF-1α. D, tankyrase-1 (35-mer). Assay conditions were as follows. 4–5 μm enzyme, 100 μm peptide, 50 μm Fe(II), 300 μm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C at atmospheric O2 for 20 min.

Assignment of modification sites by MALDI-TOF/TOF laser-induced dissociation fragmentation of hydroxylated peptide substrates. Modification sites were confirmed by enzymatic hydroxylation of synthetic peptide substrates followed by MS/MS analysis with MALDI-TOF/TOF laser-induced dissociation. A, CODD HIF-2α. B, NODD HIF-2α. C, NODD HIF-1α. D, tankyrase-1 (35-mer). Assay conditions were as follows. 4–5 μm enzyme, 100 μm peptide, 50 μm Fe(II), 300 μm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C at atmospheric O2 for 20 min.

Results

Steady-state Kinetic Studies of FIH- and PHD2-catalyzed Hydroxylation of HIF-1/2α

As a prelude to studies on the reaction of PHD2 and FIH with O2, (apparent) K values were determined for 2OG and HIF peptide substrates (HIF-1/2α CODD/NODD/CAD; Table 1) under standard conditions. Enzyme assays were conducted as described under “Experimental Procedures,” and levels of peptide hydroxylation were analyzed using MALDI-TOF-MS. Differences were observed in the relative efficiencies of catalysis in overall time course assays; consistent with a previous report (46), PHD2 showed a higher level of activity toward CODD (70–90% substrate hydroxylation after 15 min for both HIF-1α and HIF-2α, respectively) than NODD (50 and 20% substrate hydroxylation for HIF-1α and HIF-2α, respectively) (Fig. 3, A and B). Under the standard conditions, FIH only hydroxylated 10–20% of HIF-α 19-mer fragments; therefore, for further studies, 35-mer HIF-α CAD peptides were used. Requirements of longer peptides to observe more efficient FIH-catalyzed hydroxylation has been reported and is likely related to insufficient binding of short CAD peptides (10, 40, 51). Increasing the length of the HIF-1α CAD peptide resulted in nearly complete substrate hydroxylation, whereas analyses increasing the length of the HIF-2α CAD showed only a 10% increase in activity and <30% substrate hydroxylation (Fig. 3, C and D).
FIGURE 3.

PHD2- and FIH-catalyzed hydroxylation of HIF-1/2α peptide substrates. Sequences of the peptides are given in Table 1. A, time course of HIF-1/2α CODD19-mer peptide hydroxylation; B, time course of HIF-1/2α NODD19-mer peptide hydroxylation. Conditions were as follows: 4 μm PHD2, 100 μm peptide, 50 μm Fe(II), 300 μm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C at atmospheric O2. C, time course of HIF-1α CAD 19- and 35-mer peptide hydroxylation. D, time course of HIF-2α CAD 19- and 35-mer peptide hydroxylation. Conditions were as follows: 5 μm FIH, 500 μm peptide, 50 μm Fe(II), 500 μm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C at atmospheric O2. The different hydroxylation levels were analyzed by MALDI-TOF-MS. Error bars, S.D. of triplicate assays.

Sequences of the peptide substrates used in this study Where peptides represent fragments of a protein, amino acid numbers are given in parentheses. PHD2- and FIH-catalyzed hydroxylation of HIF-1/2α peptide substrates. Sequences of the peptides are given in Table 1. A, time course of HIF-1/2α CODD19-mer peptide hydroxylation; B, time course of HIF-1/2α NODD19-mer peptide hydroxylation. Conditions were as follows: 4 μm PHD2, 100 μm peptide, 50 μm Fe(II), 300 μm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C at atmospheric O2. C, time course of HIF-1α CAD 19- and 35-mer peptide hydroxylation. D, time course of HIF-2α CAD 19- and 35-mer peptide hydroxylation. Conditions were as follows: 5 μm FIH, 500 μm peptide, 50 μm Fe(II), 500 μm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C at atmospheric O2. The different hydroxylation levels were analyzed by MALDI-TOF-MS. Error bars, S.D. of triplicate assays. Steady-state kinetic parameters were then determined for PHD2 and FIH. Consistent with previous reports (11, 40, 46), PHD2 has a higher affinity for 2OG than FIH (Kapp(2OG) = 13 ± 2 μm for PHD2 with CODD HIF-1α compared with 110 ± 20 μm for FIH with HIF-1α CAD35-mer), and kcatapp values revealed more efficient PHD2-catalyzed hydroxylation of CODD than NODD substrates with both HIF-1α and HIF-2α (e.g. 0.060 ± 0.006 and 0.028 ± 0.001 s−1 for CODD and NODD HIF-1α, respectively, Table 2; kinetic constants derived from data in supplemental Figs. S1 and S2). The determined parameters for FIH were consistent with the reported more efficient FIH-catalyzed hydroxylation of HIF-1α compared with HIF-2α CAD (Table 2; kinetic constants derived from data in supplemental Fig. S3) (10, 40). Substrate inhibition was observed at high 2OG concentrations (>100 μm for HIF-1α CAD and >700 μm for HIF-2α CAD peptide; Table 2).
TABLE 2

Steady-state kinetic parameters of FIH and PHD2 catalysis

Conditions were as follows. 0.1–5 μm FIH, peptide substrate (varied), 50 μm Fe(II), 2OG (varied), and 1 mm l-ascorbate in 50 mm HEPES (pH 7.5) were incubated at 37 °C. 4 μm PHD2, peptide substrate (varied), 50 μm Fe(II), 2OG (varied), and 4 mm l-ascorbate in 50 mm HEPES (pH 7.5) were incubated at 37 °C. Hydroxylation levels were analyzed by MALDI-TOF-MS. The dependences of the initial rate on the substrate concentration are presented in supplemental Figs. S1–S3.

EnzymeSubstrateKmapp(2OG)Kmapp(peptide)Kmapp(O2)kcatapp
μmμmμms1
FIHHIF-1α CAD35-mer110 ± 20180 ± 30110 ± 300.56 ± 0.04
FIHHIF-2α CAD35-mer19 ± 6a315 ± 40a110 ± 100.049 ± 0.005
PHD2HIF-1α CODD13 ± 210 ± 6460 ± 300.060 ± 0.006
PHD2HIF-1α NODD30 ± 911 ± 2>4500.028 ± 0.001
PHD2HIF-2α CODD9 ± 234 ± 10>4500.069 ± 0.006
PHD2HIF-2α NODD17 ± 550 ± 8410 ± 800.013 ± 0.001

Substrate inhibition at 2OG concentrations >100 μm and HIF-2α CAD35-mer concentrations >700 μm was observed.

Steady-state kinetic parameters of FIH and PHD2 catalysis Conditions were as follows. 0.1–5 μm FIH, peptide substrate (varied), 50 μm Fe(II), 2OG (varied), and 1 mm l-ascorbate in 50 mm HEPES (pH 7.5) were incubated at 37 °C. 4 μm PHD2, peptide substrate (varied), 50 μm Fe(II), 2OG (varied), and 4 mm l-ascorbate in 50 mm HEPES (pH 7.5) were incubated at 37 °C. Hydroxylation levels were analyzed by MALDI-TOF-MS. The dependences of the initial rate on the substrate concentration are presented in supplemental Figs. S1–S3. Substrate inhibition at 2OG concentrations >100 μm and HIF-2α CAD35-mer concentrations >700 μm was observed. To subsequently study the O2 dependence of the PHD2- and FIH-catalyzed reaction, the initial rates of hydroxylation were determined either in a hypoxic work station or by performing the reaction in sealed glass vials under N2/O2 gas mixes with variable O2 concentration (42). Half-saturation of O2 for FIH-catalyzed hydroxylation of HIF-1α CAD peptides was achieved at 9–11% O2, giving Kapp(O2) as 110 ± 30 μm, which was much lower than for PHD2-catalyzed hydroxylation of CODD/NODD HIF-1/2α (Kapp(O2) > 400 μm in all cases), consistent with previous reports (Fig. 4) (10, 11, 42). Notably, these results are consistent with previous Kapp(O2) estimates for FIH and are also supportive of the reported ability of FIH to retain activity to a greater degree of hypoxia than the PHDs in cells (39). Interestingly, despite the difference in final hydroxylation levels and steady-state product accumulation time courses, there was no difference in Kapp(O2) for HIF-1α CAD 19- and 35-mer peptides, suggesting no influence of substrate binding on the affinities of O2 to an enzyme·substrate complex when saturating concentrations of the peptides are used (supplemental Fig. S4).
FIGURE 4.

O A, O2 dependence of PHD2-catalyzed hydroxylation of HIF-1/2α CODD/NODD 19-mer peptides. 4 μm PHD2, peptide (varied), 50 μm Fe(II), 2OG (varied), 4 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C. The different O2 levels were maintained using mass flow controllers (42), and the hydroxylation levels were analyzed by MALDI-TOF-MS. B, O2 dependence of FIH-catalyzed hydroxylation of CAD HIF-1/2α 35-mer peptides. Conditions were as follows. 5 μm FIH, 500 μm peptide, 50 μm Fe(II), 1 mm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C in a hypoxia work station under different pO2. To compare reactions with different Vmax, the relative initial rates (to the initial rate of the reaction at 20% O2) are presented. Error bars, S.D. of triplicate assays.

O A, O2 dependence of PHD2-catalyzed hydroxylation of HIF-1/2α CODD/NODD 19-mer peptides. 4 μm PHD2, peptide (varied), 50 μm Fe(II), 2OG (varied), 4 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C. The different O2 levels were maintained using mass flow controllers (42), and the hydroxylation levels were analyzed by MALDI-TOF-MS. B, O2 dependence of FIH-catalyzed hydroxylation of CAD HIF-1/2α 35-mer peptides. Conditions were as follows. 5 μm FIH, 500 μm peptide, 50 μm Fe(II), 1 mm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C in a hypoxia work station under different pO2. To compare reactions with different Vmax, the relative initial rates (to the initial rate of the reaction at 20% O2) are presented. Error bars, S.D. of triplicate assays.

Pre-steady-state Kinetic Studies of the Reactions of PHD2·Fe(II)·2OG·HIF-α CODD/NODD Substrates with O2

Previously reported pre-steady-state kinetic studies on PHD2 focused on its reaction with CODD HIF-1α 19-mer peptide (38, 42); there is no reported information on the rates of PHD2 reaction with O2 in the presence of NODD HIF-1α or HIF-2α substrates. To ascertain whether a slow reaction with O2 under pre-steady-state conditions is common to PHD2-catalyzed hydroxylation of both CODD and NODD, we investigated the reaction of PHD2 with NODD substrates in comparison with CODD for both HIF-1α and HIF-2α. Pre-steady-state reactions of PHD2 were initiated by rapid mixing of anaerobic PHD2·Fe(II)·2OG·HIF-α complexes with O2-saturated buffer at 5 °C. Reactions were initially observed using a photodiode array detector, and difference spectra (in comparison with the reaction with O2-free buffer) were subsequently analyzed. The formation of an enzyme·substrate complex for 2OG oxygenases is characterized by a weak absorbance feature at 520–530 nm due to metal ligand charge transfer interactions of Fe(II) and 2OG (32–34, 38, 53). Consistent with the consumption of the enzyme·substrate complex, and dependent on active PHD2·Fe(II)·2OG·substrate complex, a decay in absorbance at 520 nm was observed during the PHD2-catalyzed reaction, with the minimum reached at ∼20 s, after which an absorbance increase was observed (Fig. 5, A and B). Although this absorbance increase is consistent with reformation of an enzyme·substrate complex (32) (PHD2·Fe(II)·2OG and PHD2·Fe(II)·2OG·substrate formation would both give rise to absorbance increases in this region), calculated rates are probably also influenced by off-pathway processes (e.g. accumulation of Fe(III)) (42). Thus, we analyzed rates of 520 nm absorbance decay for PHD2-catalyzed CODD HIF-1α hydroxylation and other peptide substrates (CODD/NODD HIF-1/2α) (Fig. 5A and Table 3). Comparison of kinetics in the presence of CODD HIF-1α and HIF-2α peptides revealed faster O2-initiated decay of this species in the case of HIF-2α (0.040 ± 0.007 and 0.450 ± 0.010 s−1 for CODD HIF-1α and HIF-2α, respectively). Equivalent studies of complexes in the presence of NODD HIF-1α and HIF-2α revealed nearly equivalent rates of 0.178 ± 0.002 and 0.195 ± 0.003 s−1, respectively.
FIGURE 5.

Pre-steady-state kinetics of PHD2-catalyzed HIF-1/2α hydroxylation. Reaction mixtures containing anaerobic 0.8 mm apo-PHD2, 0.5 mm Fe(II), 5 mm 2OG, 1 mm peptide (19-mer), or protein substrate in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio. The sequences of the peptides are given in Table 1. A, kinetic traces at λ = 520 nm showing O2-dependent consumption of the initial PHD2·Fe(II)·2OG·peptide complexes. B, stopped-flow kinetic traces at 520 nm showing absorbance changes in control experiments: Fe(II) only, mix of Fe(II) and 2OG, reaction of PHD2·Fe(II)·2OG complex with O2 in the absence of CODD; reaction of PHD2·Fe(II)·N-oxalylglycine (NOG)·CODD complex with O2. N-Oxalylglycine is an inhibitor of 2OG oxygenases. C, stopped-flow kinetic traces at 520 nm showing absorbance species formed on PHD2-catalyzed HIF-1α NODD 19-mer peptide hydroxylation (black) and recombinant protein (HIF-1α(344–503)) hydroxylation (red). D, stopped-flow kinetic traces at 310 nm showing absorbance species formed in the PHD2-catalyzed HIF-1/2α hydroxylation. The kinetic traces represent the average of triplicate assays. E, HIF-1/2α peptide hydroxylation, as determined by MALDI-TOF-MS. Reactions were quenched with 1% CF3CO2H at defined time points.

TABLE 3

Kinetic parameters of pre-steady-state PHD2- and FIH-catalyzed hydroxylation

Conditions were as follows: an anaerobically prepared mixture of 0.8 mm PHD2, 1 mm peptide substrate, 5 mm 2OG, and 0.7 mm Fe(II) or 0.5 mm FIH, 1 mm peptide substrate, 5 mm 2OG, and 0.4 mm Fe(II) in 50 mm HEPES (pH 7.5) was rapidly mixed with O2-saturated buffer at 5 °C. ND, not determined.

EnzymeSubstrateStopped-flow, 520 nm (PHD2), 500 nm (FIH)
Rapid quench-flow
kfall phasekrise phasekproductksuccinate
s1s1s1s1
PHD2CODD HIF-1α0.040 ± 0.0070.015 ± 0.0050.0155 ± 0.00120.0130 ± 0.0020
PHD2CODD HIF-2α0.450 ± 0.0100.027 ± 0.0010.0124 ± 0.00300.0120 ± 0.0070
PHD2NODD HIF-1α0.178 ± 0.0060.002 ± 0.0010.0080 ± 0.00200.0060 ± 0.0010
PHD2NODD HIF-2α0.195 ± 0.0090.003 ± 0.0010.0199 ± 0.00320.0270 ± 0.0060
FIHCAD HIF-1α35-mer4.5 ± 0.30.009 ± 0.0050.33 ± 0.070.3 ± 0.1
FIHCAD HIF-2α35-mer4.9 ± 0.20.017 ± 0.010.12 ± 0.010.11 ± 0.03
FIHCAD HIF-1α19-merNDND0.013 ± 0.0030.016 ± 0.004
Pre-steady-state kinetics of PHD2-catalyzed HIF-1/2α hydroxylation. Reaction mixtures containing anaerobic 0.8 mm apo-PHD2, 0.5 mm Fe(II), 5 mm 2OG, 1 mm peptide (19-mer), or protein substrate in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio. The sequences of the peptides are given in Table 1. A, kinetic traces at λ = 520 nm showing O2-dependent consumption of the initial PHD2·Fe(II)·2OG·peptide complexes. B, stopped-flow kinetic traces at 520 nm showing absorbance changes in control experiments: Fe(II) only, mix of Fe(II) and 2OG, reaction of PHD2·Fe(II)·2OG complex with O2 in the absence of CODD; reaction of PHD2·Fe(II)·N-oxalylglycine (NOG)·CODD complex with O2. N-Oxalylglycine is an inhibitor of 2OG oxygenases. C, stopped-flow kinetic traces at 520 nm showing absorbance species formed on PHD2-catalyzed HIF-1α NODD 19-mer peptide hydroxylation (black) and recombinant protein (HIF-1α(344–503)) hydroxylation (red). D, stopped-flow kinetic traces at 310 nm showing absorbance species formed in the PHD2-catalyzed HIF-1/2α hydroxylation. The kinetic traces represent the average of triplicate assays. E, HIF-1/2α peptide hydroxylation, as determined by MALDI-TOF-MS. Reactions were quenched with 1% CF3CO2H at defined time points. Kinetic parameters of pre-steady-state PHD2- and FIH-catalyzed hydroxylation Conditions were as follows: an anaerobically prepared mixture of 0.8 mm PHD2, 1 mm peptide substrate, 5 mm 2OG, and 0.7 mm Fe(II) or 0.5 mm FIH, 1 mm peptide substrate, 5 mm 2OG, and 0.4 mm Fe(II) in 50 mm HEPES (pH 7.5) was rapidly mixed with O2-saturated buffer at 5 °C. ND, not determined. To investigate the rate of the PHD-catalyzed reaction with longer HIF substrates, equivalent experiments were conducted with recombinant HIF-1α(344–503) NODD protein; these showed the same kinetics of PHD2·Fe(II)·2OG·NODD complex consumption as was observed in the presence of the 19-mer peptide (Fig. 5C), confirming that peptide binding is not rate-limiting. Consistent with a previous report (42), the formation and degradation of a transient species absorbing at λmax = 310 nm was observed (in this and other pre-steady-state assays in this study; Fig. 5D); however, the slow rates of its formation suggest that (consistent with our previous observations (38, 42)) an Fe(IV)-oxo intermediate (λmax ∼320 nm (32)) species probably does not accumulate during PHD2 catalysis. To investigate correlation of the spectroscopic observations with rates of product accumulation, equivalent reactions were analyzed by rapid quench-flow methodology. Anerobically prepared PHD2·Fe(II)·2OG·peptide substrate complexes were mixed with O2-saturated buffer in a 1:1 ratio; reactions were quenched at defined time points with 1% aqueous CF3CO2H. The level of peptide hydroxylation was assessed by MALDI-TOF-MS (42), and succinate accumulation was analyzed by LC-MS. To obtain rate constants for product accumulation, the results were fitted with a single exponential function (Fig. 5E and Table 3). Besides NODD HIF-2α being hydroxylated at a faster rate than NODD HIF-1α, our results showed no significant difference in the kinetics of hydroxylated product formation for PHD2 in the presence of any of the tested NODD and CODD substrates. These results suggest that the more rapid enzyme·substrate complex depletion observed for CODD HIF-2α did not affect the rate-limiting step in product formation. The time courses of succinate accumulation (reflecting 2OG turnover) were coupled to peptide hydroxylation within the limits of detection (Table 3 and supplemental Fig. S5).

Pre-steady-state Kinetic Studies of the Reactions of FIH·Fe(II)·2OG·HIF-1/2α CAD Substrates with O2

Although the pre-steady-state reaction of PHD2 with O2 has been previously investigated (38, 42), to date, no studies on the pre-steady-state kinetics of FIH have been reported. We carried out stopped-flow and rapid quench-flow experiments to compare the reaction of FIH with O2 with that of PHD2 and to relate the results to the differences reported in Kapp(O2) values. Upon rapid mixing of anaerobic FIH·Fe(II)·2OG·HIF-α complexes with O2-saturated buffer at 5 °C, a decay in absorbance in the 500 nm region and subsequent increase resulting in a minimum at ∼0.3–3 s was observed in stopped-flow UV-visible absorbance experiments, as reported for PHD2 and other 2OG oxygenases (Fig. 6A and Table 3) (32–34, 36, 53). Kinetic traces were fitted using a double exponential function; the fitting parameters of intermediate formation and decay are summarized in Table 3. The results reveal that the 500 nm decay occurs much more rapidly for FIH compared with PHD2: 4.5 ± 0.3 s−1 for FIH with CAD HIF-1α35-mer and 0.040 ± 0.007 s−1 for PHD2 with CODD HIF-1α, suggesting a faster O2-initiated reaction for FIH (Fig. 6A).
FIGURE 6.

Comparison of the O Reaction mixtures containing anaerobic 0.8 mm apo-PHD2, 0.5 mm Fe(II), 5 mm 2OG, 1 mm peptide or 0.5 mm FIH, 0.4 mm Fe(II), 5 mm 2OG, 1 mm peptide in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio. A, kinetic traces at λ = 520 nm (for PHD2) or λ = 500 nm (for FIH) showing O2-dependent consumption of the initial enzyme·Fe(II)·2OG·peptide complexes. The kinetic traces represent the average of triplicate assays. B, FIH- and PHD2-catalyzed HIF-1α peptide hydroxylation under the same conditions, as determined by MALDI-TOF-MS. Reactions were quenched with 1% CF3CO2H at defined time points. C, formation and degradation of 310 nm species in the FIH-catalyzed HIF-1/2α CAD35-mer hydroxylation.

Comparison of the O Reaction mixtures containing anaerobic 0.8 mm apo-PHD2, 0.5 mm Fe(II), 5 mm 2OG, 1 mm peptide or 0.5 mm FIH, 0.4 mm Fe(II), 5 mm 2OG, 1 mm peptide in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio. A, kinetic traces at λ = 520 nm (for PHD2) or λ = 500 nm (for FIH) showing O2-dependent consumption of the initial enzyme·Fe(II)·2OG·peptide complexes. The kinetic traces represent the average of triplicate assays. B, FIH- and PHD2-catalyzed HIF-1α peptide hydroxylation under the same conditions, as determined by MALDI-TOF-MS. Reactions were quenched with 1% CF3CO2H at defined time points. C, formation and degradation of 310 nm species in the FIH-catalyzed HIF-1/2α CAD35-mer hydroxylation. The kinetic constant of product formation for the FIH·Fe(II)·2OG·HIF-1α CAD35-mer complex upon reaction with O2 was determined to be 0.33 ± 0.07 s−1 (Table 3 and Fig. 6B). This was faster than the kinetic constant of product formation for an FIH·Fe(II)·2OG·HIF-2α CAD35-mer complex upon reaction with O2 (0.12 ± 0.01 s−1 (Table 3 and supplemental Fig. S6). A lower kcatapp value was also observed in steady-state experiments (0.56 ± 0.04 and 0.049 ± 0.005 s−1 for HIF-1α and HIF-2α, respectively; Table 2 and supplemental Fig. S3). Notably, the O2-initiated rates of product accumulation were significantly faster in the case of FIH compared with PHD2 (Fig. 6B; rate constants, 0.33 ± 0.07 s−1 for FIH with CAD HIF-1α35-mer and 0.0155 ± 0.0012 s−1 for PHD2 with CODD HIF-1α), consistent with the differences in 500 nm decay rates observed by stopped-flow analyses and potentially related to the reduced Kapp(O2) values for FIH compared with PHD2. During the stopped-flow analyses, we observed late formation of a transient species with maximum absorbance at 310 nm and a maximum accumulation time at 50–100 s, as observed for PHD2 (Fig. 6C). Comparison with the O2-activated product formation studied by rapid quench-flow experiments revealed that this species is formed after the hydroxylation of the peptide substrates was complete, suggesting that a detectable Fe(IV)-oxo intermediate does not accumulate during the FIH-catalyzed reaction. The observed accumulation of a 310-nm transient species can be rationalized by the formation of a transient iron species as a result of substrate-uncoupled 2OG turnover subsequent to consumption of all prime substrate and/or an oxidation of bound or unbound Fe(II) (42). Thus, similar to the observations for PHD2 (38, 42), accumulation of an Fe(IV)-oxo intermediate was not observed (at 320 nm) in FIH catalysis, at least with our tested substrates.

Steady-state Kinetic Studies of FIH-catalyzed Hydroxylation of ARD Substrates

FIH catalyzes hydroxylation of multiple ARD substrates (18, 19, 21, 23, 43, 44). It has been reported that the FIH Kapp(O2) value for ARD-containing proteins Notch1–3 is 10-fold lower than for HIF-1α (43), suggesting a relatively higher affinity of FIH for O2 when catalyzing ARD hydroxylation, compared with HIF-α hydroxylation. We therefore wished to further investigate the kinetic dependence of FIH on O2 with respect to ARD and HIF substrates. We compared FIH hydroxylation of a consensus ankyrin repeat 20-mer peptide (1CA20-mer, designed based on ARD sequence analyses (21, 54, 55)) and a 20-mer fragment of tankyrase-1, tnkrs-120-mer (a multifunctional poly(ADP-ribose) polymerase containing 24 ARDs) to HIF-α isoforms by determining steady-state kinetic parameters for these substrates as a prelude to investigating O2 dependence (43). Overall, the Kapp values for ankyrin repeat peptide FIH substrates are all lower than for either HIF-1α or HIF-2α CAD peptide substrates (∼180–300 μm for HIF-1/2α CAD and <100 μm for ankyrin substrates (Table 4); kinetic constants derived from data in supplemental Fig. S7), supporting the previously reported stronger binding of ARDs to FIH (43). At the same time, kcatapp values for ankyrin peptides were higher than for HIF-α (1.6 ± 0.1 and 0.56 ± 0.04 s−1 for 1CA20-mer and HIF-1α CAD35-mer, respectively), implying more efficient turnover of the ankyrin substrates (Table 4 and supplemental Fig. S7), again consistent with previous reports (43).
TABLE 4

Steady-state kinetic parameters of FIH-catalyzed ARD hydroxylation

Conditions were as follows: 0.1–5 μm FIH, substrate (varied), 50 μm Fe(II), 2OG (varied), and 1 mm l-ascorbate in 50 mm HEPES (pH 7.5) were incubated at 37 °C. Hydroxylation levels were analyzed by MALDI-TOF-MS or LC-MS. The dependences of the initial rate on the substrate concentration are presented in supplemental Figs. S7 and S8. ND, not determined.

EnzymeSubstrateKmapp(2OG)Kmapp(peptide)Kmapp(O2)kcatapp
μmμmμms1
FIH1CA20-mer290 ± 5025 ± 740 ± 101.6 ± 0.1
FIHtnkrs-120-mer370 ± 12078 ± 11ND0.8 ± 0.1
FIHtnkrs-135-mer61 ± 714 ± 450 ± 103.0 ± 0.2
FIH2CA110 ± 3016 ± 356 ± 151.7 ± 0.2
FIH3CA200 ± 6060 ± 15120 ± 200.6 ± 0.2
Steady-state kinetic parameters of FIH-catalyzed ARD hydroxylation Conditions were as follows: 0.1–5 μm FIH, substrate (varied), 50 μm Fe(II), 2OG (varied), and 1 mm l-ascorbate in 50 mm HEPES (pH 7.5) were incubated at 37 °C. Hydroxylation levels were analyzed by MALDI-TOF-MS or LC-MS. The dependences of the initial rate on the substrate concentration are presented in supplemental Figs. S7 and S8. ND, not determined. ARD proteins probably must undergo at least partial unfolding from their consensus fold prior to productive FIH-catalyzed hydroxylation (21, 44). To investigate the effect of ankyrin repeat folding on the efficiency of hydroxylation, 1CA20-mer was compared with two- and three-consensus ankyrin repeat proteins (2CA and 3CA). The CA repeat sequence was designed previously based on bioinformatics studies of multiple natural ARD sequences (21, 54, 55). Circular dichroism experiments showed that whereas 2CA does not possess significant secondary structure (2CA is unfolded at >10 °C), 3CA is folded in solution (Fig. 7 and Refs. 21, 22). The kinetic parameters for 1CA20-mer, 2CA, and 3CA were determined. They showed a decrease in substrate and co-substrate Kapp values for 2CA compared with 1CA20-mer (Kapp(substrate) = 25 ± 7 and 16 ± 3 μm, for 1CA and 2CA, respectively) in line with increased efficiency of longer substrates for FIH but an increase in the Kapp value for the 3CA substrate (60 ± 15 μm (Table 4); kinetic constants derived from data in supplemental Fig. S8). Notably, there was a reduction in turnover rate for 3CA substrate. These results suggest that the requirement for at least partial unfolding of the ankyrin repeat prior to FIH-catalyzed hydroxylation affects catalytic efficiency (21, 44).
FIGURE 7.

CD spectroscopic comparison of 2CA and 3CA secondary structure. Thermal denaturation experiments of 2CA and 3CA are shown. Conditions were as follows. 0.2 mg/ml protein in 10 mm sodium phosphate buffer (pH 8.0) was studied at 222 nm for thermal denaturation experiments between 10 and 90 °C. A, melting curves of 2CA. B, spectra of 2CA between 260 and 190 nm at 10 °C, after heating to 90 °C and after cooling again to 10 °C. C, melting curves of 3CA. D, spectra of 3CA between 260 and 190 nm at 10 °C, after heating to 90 °C, where the α-helical structure is predominantly lost, and after cooling again to 10 °C, where the structure is largely regained.

CD spectroscopic comparison of 2CA and 3CA secondary structure. Thermal denaturation experiments of 2CA and 3CA are shown. Conditions were as follows. 0.2 mg/ml protein in 10 mm sodium phosphate buffer (pH 8.0) was studied at 222 nm for thermal denaturation experiments between 10 and 90 °C. A, melting curves of 2CA. B, spectra of 2CA between 260 and 190 nm at 10 °C, after heating to 90 °C and after cooling again to 10 °C. C, melting curves of 3CA. D, spectra of 3CA between 260 and 190 nm at 10 °C, after heating to 90 °C, where the α-helical structure is predominantly lost, and after cooling again to 10 °C, where the structure is largely regained. We then determined and compared Kapp(O2) values for our ankyrin substrates with those determined for HIF-1/2α CAD (Table 4 and Fig. 8). The Kapp (O2) values for 1CA and tnkrs-135-mer were lower than those determined for HIF substrates (40 ± 10, 50 ± 10, and 110 ± 30 μm for 1CA, tnkrs-135-mer, and HIF-1α35-mer, respectively; note that the more efficient 35-mer tnkrs-1 peptide was used to compare with the equivalent length HIF-1α35-mer). These results are supportive of the reported comparison of Notch1–3 Kapp(O2) values (43), strengthening the proposal that binding of different protein substrates can modulate the reaction/affinity of FIH for O2. There was little difference in the FIH affinities to O2 in the presence of the 1CA and 2CA substrates as determined by Kapp(O2) values (40 ± 10 and 56 ± 15 μm for 1CA and 2CA, respectively). Compared with the substantially unfolded 1CA or 2CA, however, the Kapp(O2) in the presence of 3CA (120 ± 20 μm) was 2-fold higher than the values in the presence of 1CA and 2CA and similar to that in the presence of HIF-α (110 ± 30 μm). Thus, increasing the number of ankyrin repeats and folding of the 3CA does not appear to facilitate the reaction of FIH with O2; this may be related to the substrate unfolding process required for hydroxylation of the folded 3CA (22).
FIGURE 8.

Time course and O Sequences of the peptides are given in Table 1. Conditions were as follows. 5 μm FIH, 500 μm peptide, 50 μm Fe(II), 1 mm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C. For O2 dependence studies, reactions were carried out in a hypoxic work station under different pO2 (assays at >20% O2 conducted using mass flow controllers (42)). The different hydroxylation levels were analyzed by MALDI-TOF-MS or by LC-MS (for 2CA and 3CA). To compare reactions with different Vmax, the relative initial rates (relative to the initial rate of the reaction at 20% O2) are presented. Error bars, S.D. of triplicate assays. A, time course of consensus ARD substrate hydroxylation (tankyrase-1 (tnkrs-1 20-mer and 35-mer) and one-consensus ankyrin repeat 20-mer (1CA)). B, time course of ARD peptide hydroxylation (one-consensus ankyrin repeat 20-mer (1CA), two ankyrin repeats (2CA), and three ankyrin repeats (3CA)). C, O2 dependence of HIF-1/2α CAD, 1CA, and tnkrs-135-mer hydroxylation. D, O2 dependence of 1CA, 2CA, and 3CA hydroxylation.

Time course and O Sequences of the peptides are given in Table 1. Conditions were as follows. 5 μm FIH, 500 μm peptide, 50 μm Fe(II), 1 mm 2OG, 1 mm l-ascorbate in HEPES 50 mm (pH 7.5) were incubated at 37 °C. For O2 dependence studies, reactions were carried out in a hypoxic work station under different pO2 (assays at >20% O2 conducted using mass flow controllers (42)). The different hydroxylation levels were analyzed by MALDI-TOF-MS or by LC-MS (for 2CA and 3CA). To compare reactions with different Vmax, the relative initial rates (relative to the initial rate of the reaction at 20% O2) are presented. Error bars, S.D. of triplicate assays. A, time course of consensus ARD substrate hydroxylation (tankyrase-1 (tnkrs-1 20-mer and 35-mer) and one-consensus ankyrin repeat 20-mer (1CA)). B, time course of ARD peptide hydroxylation (one-consensus ankyrin repeat 20-mer (1CA), two ankyrin repeats (2CA), and three ankyrin repeats (3CA)). C, O2 dependence of HIF-1/2α CAD, 1CA, and tnkrs-135-mer hydroxylation. D, O2 dependence of 1CA, 2CA, and 3CA hydroxylation.

Pre-steady-state Studies of the Reactions of FIH·Fe(II)·2OG·ARD complexes with O2

To further investigate the difference in the O2 dependence of the FIH-catalyzed hydroxylation of HIF-α and ARD substrates, stopped-flow and rapid quench-flow experiments were performed. Interestingly, the determined pre-steady-state kinetic parameters suggested markedly faster O2-initiated reaction rates in the presence of ankyrin rather than HIF-α CAD substrates. Upon reaction of FIH·Fe(II)·2OG·1CA20-mer and FIH·Fe(II)·2OG·tnkrs-120-mer complexes with O2, rate constants of product accumulation were determined to be 1.3 ± 0.2 and 1.5 ± 0.1 s−1, respectively (i.e. ∼10-fold faster than the reaction with HIF 35-mer substrates) (Fig. 9). Rates of succinate production were also determined and showed similar relative changes (determined rate constants are summarized in Table 5 and supplemental Fig. S6); for both HIF-α isoforms as well as ankyrin substrates, the reaction was fully coupled. In previously reported steady-state kinetic studies (43), when the length of the peptide substrate was increased from 20-mer to 34-mer for ankyrin peptides, a ∼100-fold increase in substrate affinity was observed. O2 initiation of the FIH reaction with a 35-mer tankyrase-1 peptide resulted in product formation at a rate ∼7-fold faster than for the 20-mer (determined rate constants 1.5 ± 0.1 s−1 for tnkrs-120-mer hydroxylation, 11 ± 3 s−1 for tnkrs-135-mer hydroxylation). Consistent with faster hydroxylation, stopped-flow UV-visible absorbance experiments revealed that an absorbance minimum at 500 nm was reached faster for ankyrin substrates compared with HIF-α substrates (Fig. 10A). As for FIH-catalyzed HIF-α CAD hydroxylation, a transient species absorbing at 310 nm was observed subsequent to FIH-catalyzed ARD hydroxylation (Fig. 10B) (i.e. accumulation of an Fe(IV)-oxo intermediate was not observed (at 320 nm) in FIH catalysis).
FIGURE 9.

Rapid quench-flow experiments showing FIH-catalyzed hydroxylation of HIF-1/2α CAD and ARD substrates. Reaction mixtures containing anaerobic 0.5 mm apo-FIH, 0.4 mm Fe(II), 5 mm 2OG, 1 mm peptide in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio and then quenched with 1% CF3CO2H at defined time points. The data were fitted with the function, y = a·(1 − exp(−bx)) + c. Hydroxylation levels were assessed by MALDI-TOF-MS. A, hydroxylation of HIF-1α CAD, 1CA, and tankyrase-1 peptide substrates (19- and 20-mers); B, hydroxylation of HIF-1α, HIF-2α, and tankyrase-1 35-mer peptide substrates; C, hydroxylation of 1CA, 2CA, and 3CA. Data plotted were cumulatively acquired over the course of 1–3 separate experiments.

TABLE 5

Pre-steady-state kinetic parameters of FIH-catalyzed ARD hydroxylation

Conditions were as follows. 0.5 mm apo-FIH, 0.4 mm Fe(II), 5 mm 2OG, and 1 mm substrate in 50 mm HEPES (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio. ND, not determined.

SubstrateStopped-flow, 500 nm
Rapid quench-flow
kfall phasekrise phasekproductksuccinate
s1s1s1s1
1CA17.6 ± 0.10.4 ± 0.11.3 ± 0.20.8 ± 0.3
2CA11.9 ± 0.20.6 ± 0.10.5 ± 0.1ND
3CA10.5 ± 0.11.7 ± 0.30.051 ± 0.001ND
tnkrs-120-mer16.7 ± 0.20.4 ± 0.21.5 ± 0.11.0 ± 0.3
tnkrs-135-mer14.8 ± 0.20.27 ± 0.0311 ± 310 ± 3
FIGURE 10.

Stopped-flow UV-visible absorbance changes upon FIH-catalyzed hydroxylation of HIF-1/2α CAD and ARD substrates. Reaction mixtures containing anaerobic 0.5 mm apo-FIH, 0.4 mm Fe(II), 5 mm 2OG, and 1 mm peptide in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in 1:1 ratio and analyzed using a photodiode array detector. The data were fitted with a double exponential function. A, decay at 500 nm (representing enzyme·substrate complex depletion) observed upon FIH-catalyzed hydroxylation of ARD substrates compared with HIF-1/2α CAD. B, formation and degradation of 310 nm species observed upon FIH-catalyzed HIF-1/2α CAD and ARD hydroxylation. C, decay at 500 nm observed upon FIH-catalyzed hydroxylation of 1CA, 2CA, and 3CA substrates.

Rapid quench-flow experiments showing FIH-catalyzed hydroxylation of HIF-1/2α CAD and ARD substrates. Reaction mixtures containing anaerobic 0.5 mm apo-FIH, 0.4 mm Fe(II), 5 mm 2OG, 1 mm peptide in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio and then quenched with 1% CF3CO2H at defined time points. The data were fitted with the function, y = a·(1 − exp(−bx)) + c. Hydroxylation levels were assessed by MALDI-TOF-MS. A, hydroxylation of HIF-1α CAD, 1CA, and tankyrase-1 peptide substrates (19- and 20-mers); B, hydroxylation of HIF-1α, HIF-2α, and tankyrase-1 35-mer peptide substrates; C, hydroxylation of 1CA, 2CA, and 3CA. Data plotted were cumulatively acquired over the course of 1–3 separate experiments. Pre-steady-state kinetic parameters of FIH-catalyzed ARD hydroxylation Conditions were as follows. 0.5 mm apo-FIH, 0.4 mm Fe(II), 5 mm 2OG, and 1 mm substrate in 50 mm HEPES (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in a 1:1 ratio. ND, not determined. Stopped-flow UV-visible absorbance changes upon FIH-catalyzed hydroxylation of HIF-1/2α CAD and ARD substrates. Reaction mixtures containing anaerobic 0.5 mm apo-FIH, 0.4 mm Fe(II), 5 mm 2OG, and 1 mm peptide in HEPES 50 mm (pH 7.5) were rapidly mixed with O2-saturated buffer at 5 °C in 1:1 ratio and analyzed using a photodiode array detector. The data were fitted with a double exponential function. A, decay at 500 nm (representing enzyme·substrate complex depletion) observed upon FIH-catalyzed hydroxylation of ARD substrates compared with HIF-1/2α CAD. B, formation and degradation of 310 nm species observed upon FIH-catalyzed HIF-1/2α CAD and ARD hydroxylation. C, decay at 500 nm observed upon FIH-catalyzed hydroxylation of 1CA, 2CA, and 3CA substrates. To investigate the effects of folding of ankyrin repeats on the pre-steady-state kinetics of the reaction with O2, the pre-steady-state parameters of the reaction with 1CA were compared with those with 2CA and 3CA (Table 5). In contrast to the effect of lengthening of the tnkrs-1 substrate, increasing the length of the consensus ankyrin repeat substrate reduced the rate constant of product accumulation, particularly for the 3CA folded substrate (0.051 ± 0.001 s−1 for 3CA compared with 1.3 ± 0.2 s−1 for 1CA), implying that ankyrin repeat folding/unfolding may have an effect on the rate of the reaction with O2 (Fig. 9 and Table 5). It is interesting to note that the 3CA substrate has both a significantly decreased rate of product accumulation and a significantly increased Kapp(O2) compared with the shorter ankyrin substrates. UV-visible stopped-flow analyses showed that the rate of the absorbance decay at 500 nm decreased with increased number of consensus ankyrin repeats (Fig. 10C, 17.6 ± 0.1, 11.9 ± 0.2, and 10.5 ± 0.1 s−1 for 1CA, 2CA, and 3CA, respectively). It is possible that the differences in FIH kinetics for the longer 3CA substrate may be due, at least in part, to the requirement for 3CA to unfold for effective catalysis (21, 44). This unfolding may be necessary for productive access of O2 to the active site. It is notable that in the presence of the 3CA substrate, the rise in the absorbance at 500 nm was relatively fast (1.7 s−1), whereas the rate of product accumulation was slow (0.051 s−1). Whether or not this absorbance at 500 nm reflects reformation of an enzyme·substrate complex (32) or off-pathway accumulation of Fe(III) (42), this result raises the possibility that the reaction of FIH·Fe(II)·2OG·3CA with O2 is rapid but that the hydroxylated product needs to (partially) fold before it is released. This proposal is consistent with the observation that the 2CA and 1CA substrates do not fold to form the consensus ankyrin repeat structure in solution (22).

Discussion

Hypoxia and the resultant response mediated by HIF are characteristic of multiple diseases, including some cancers (56, 57). The available evidence to date indicates that the number of direct and physiologically relevant interfaces between O2 and the HIF system that act in a chronic hypoxia-sensing capacity may be rather limited, with clear evidence currently only for the HIF hydroxylases themselves acting as hypoxia sensors, at least with respect to the HIF system itself. Large scale clinical trials are ongoing with PHD inhibitors for the treatment of anemia and hypoxia-related disorders (57, 58). Thus, understanding the context-dependent roles of the HIF hydroxylases is of current clinical relevance. Our results clearly reveal striking differences between the reactivity of two of the HIF hydroxylases with respect to O2: PHD2, the most important of the human PHDs, and FIH. The data are consistent with prior less detailed kinetic analyses (10, 43) and, importantly, with cellular observations (39) that FIH is more active at lower O2 concentrations than the PHDs. The complexities of the HIF hypoxic sensing system, as are likely present in any pleiotropic eukaryotic sensing mechanism acting at transcriptional and other levels (e.g. variations in protein levels and location), mean that we are very far from quantitative correlations between kinetic studies with isolated components and the “in cell” sensors. Nonetheless, the qualitative correlation between the relative sensitivities of PHD2 and FIH catalysis to changes in O2 availability with isolated components and in cells is striking. Previous studies of the pre-steady-state kinetics of PHD2 showed very slow O2-mediated initiation of CODD HIF-1α hydroxylation (38, 42). In addition to the slower rate of PHD-dependent HIF hydroxylation in response to changed O2 concentrations, this observation was proposed to be related to the biological role of PHD2 as an O2 sensor in cells (39). Steady-state kinetic studies of O2 dependence have shown that Kapp(O2) values for FIH are lower compared with PHD2 (10, 43); our results support these findings. Of note, we also observed a significantly faster O2-initiated reaction of FIH than of PHD2 under pre-steady-state conditions, consistent with our proposal that the slow reaction of PHD2 with O2 is linked to its ability to act as an O2 sensor, as reflected by its Kapp(O2) value (10, 11, 40–42). The results also reveal that FIH manifests mechanistic similarity to PHD2 in its lack of accumulation of the reactive Fe(IV)-oxo intermediate, which possesses distinctive spectroscopic features absorbing at 320 nm (32). This observation suggests that in terms of the rate-limiting steps of catalysis, FIH is similar to PHD2, rather than other 2OG oxygenases, such as TauD and vCPH (32, 36). Further, solvent isotope effect studies of FIH-catalyzed HIF hydroxylation have indicated that the rate-limiting step occurs after dissociation of the iron-bound water molecule from the active site and probably includes the O2 activation step (59), similar to that observed for PHD2 (60). This probably contributes to a degree of restraint with respect to O2 activation subsequent to substrate binding (binding of an Fe(II)-coordinated water molecule is proposed to be weakened upon prime substrate binding to enable O2 binding; Fig. 1). We also investigated the HIF substrate dependence of O2 kinetics for both PHD2 and FIH. PHD2 has been shown to express a preference for hydroxylation of the CODD site, compared with NODD (46, 61). However, we found in both pre-steady-state and steady-state experiments that O2-initiated reaction rates are independent of the nature of the prime substrate. Faster O2-initiated decay of the 520 nm-absorbing enzyme·Fe(II)·2OG·substrate complex was observed in our stopped-flow experiments for HIF-2α CODD hydroxylation compared with HIF-1α CODD, suggesting faster O2 activation for the former. However, we did not observe any difference in the pre-steady-state time course of product accumulation for HIF-1/2α CODD, and the determined kcatapp values for both substrates were the same within error (0.060 ± 0.006 and 0.069 ± 0.006 s−1 for HIF-1α and HIF-2α CODD, respectively). Thus, although the initial step of O2-initiated decay of the 520 nm-absorbing species is faster for the reaction with HIF-2α CODD, the overall effect is not rate-limiting for the reaction, and steady-state parameters with respect to O2 are not affected. FIH is seemingly a remarkably promiscuous oxygenase, being able to catalyze hydroxylation of Asn residues in both HIF and ARDs (19). Whereas the O2 dependence of HIF-1α versus HIF-2α was not significantly different for FIH catalysis, our results provide evidence that Kapp(O2) values of FIH are lower with respect to ankyrin substrates, compared with HIF substrates, consistent with reported studies on Notch1–3 (43). Notably, the pre-steady-state rate of reaction of FIH with O2 was much faster in the presence of (most) ankyrin substrates than HIF substrates (e.g. 0.33 and 11 s−1 for HIF-1α CAD35-mer and tnkrs-135mer, respectively), again supporting our proposal that the rate of the O2-initiated reaction under pre-steady-state conditions correlates with the steady-state Kapp(O2) parameter. Whereas the 1CA and 2CA FIH substrates are not folded in solution, 3CA possesses a defined secondary structure (22) (note that these are consensus (i.e. averaged) ARD sequences rather than specific natural ARD substrates). The results imply that the secondary structure of FIH ankyrin repeat substrates can affect the rate of reaction with O2. Previous studies have suggested that whereas for HIF-α CAD, the secondary structure does not affect the efficiency of the FIH-catalyzed hydroxylation, for ankyrin repeat substrates, unfolding of the substrate is required prior to hydroxylation (44, 62). It has also been proposed that the difference in the efficiency of FIH-catalyzed ARD hydroxylation is related to the stability of the ARD protein fold (21). A protein with four contiguous consensus ankyrin repeats was found not to be hydroxylated by FIH, whereas 3CA is a substrate (21). The natural ARD proteins, Notch and IκBα, contain more than six ARDs and are known to be relatively efficient substrates for FIH (43, 62), including in cells (18). Thus, the number of contiguous ARDs in a protein does not necessarily correlate with the hydroxylation efficiency, which is also related to local stability and sequence of the hydroxylated region (21, 22). (Note also that FIH probably interacts with ARDs that it does not hydroxylate (22).) The observation that ARD folding affects FIH catalysis is in agreement with our observations, where a slower reaction with a folded ankyrin substrate was observed. It suggests that the unfolding step, which occurs prior to hydroxylation, affects the kinetics of ARD hydroxylation. If O2 reactivity is limited by access to the active site, this may rationalize the observed slower rate for the 3CA substrate. This may also rationalize the overall observation of faster kinetics with respect to O2 for FIH than for PHD2; PHD2 structural studies revealed a “tight” active site relative to that of FIH (45, 63). Further, if the nature of the enzyme-substrate interaction affects O2 access to the active site, this raises the possibility that alternative substrates for the HIF hydroxylases may have different O2 sensitivity profiles. The influence of enzyme-substrate interactions on the reaction of FIH with O2 is of interest in terms of understanding the prime biological function of FIH. Although FIH is involved in hypoxia sensing in cells (25), the precise importance of the role of ARD hydroxylation in the hypoxic response is not well understood. Taking into account the abundance of ARD substrates in cells, our results indicate that FIH has the potential to hydroxylate ARD substrates under conditions of low O2 availability, where its ability to hydroxylate HIF substrates may be substantially diminished. Thus, at least on a short time scale (i.e. tens of minutes) FIH-catalyzed ARD hydroxylation may not directly contribute in a sensing capacity to the hypoxic response. However, it has the possibility of contributing to the context-dependent regulation of the hypoxic response on a longer time scale (including by enabling memory effects (64)) by altering the kinetics of FIH HIF-α catalysis in cells by regulating the fraction of FIH free to hydroxylate HIF-α, because (at least some) hydroxylated ARDs bind less tightly to FIH than unhydroxylated ARDs (19, 44).

Author Contributions

H. T. and E. F. designed the study and wrote the paper. H. T. expressed and purified proteins and performed all of the kinetic studies. A. P. H. assisted with purification of 2CA and 3CA and with protein LC/MS. E. A. H. performed CD studies on 2CA and 3CA. N. D. L. and J. S. O. M. assisted with succinate determination by LC/MS. H. B. K. performed MALDI-TOF/TOF-MS/MS experiments. C. J. S. critically revised the manuscript. All authors analyzed the results and approved the final manuscript.
  62 in total

1.  Studies on deacetoxycephalosporin C synthase support a consensus mechanism for 2-oxoglutarate dependent oxygenases.

Authors:  Hanna Tarhonskaya; Andrea Szöllössi; Ivanhoe K H Leung; Jacob T Bush; Luc Henry; Rasheduzzaman Chowdhury; Aman Iqbal; Timothy D W Claridge; Christopher J Schofield; Emily Flashman
Journal:  Biochemistry       Date:  2014-04-11       Impact factor: 3.162

Review 2.  Molecular responses to hypoxia-inducible factor 1α and beyond.

Authors:  Jason Brocato; Yana Chervona; Max Costa
Journal:  Mol Pharmacol       Date:  2014-02-25       Impact factor: 4.436

3.  Structural basis for recruitment of CBP/p300 by hypoxia-inducible factor-1 alpha.

Authors:  Steven J Freedman; Zhen-Yu J Sun; Florence Poy; Andrew L Kung; David M Livingston; Gerhard Wagner; Michael J Eck
Journal:  Proc Natl Acad Sci U S A       Date:  2002-04-16       Impact factor: 11.205

4.  Carboxyl-terminal transactivation activity of hypoxia-inducible factor 1 alpha is governed by a von Hippel-Lindau protein-independent, hydroxylation-regulated association with p300/CBP.

Authors:  Nianli Sang; Jie Fang; Vickram Srinivas; Irene Leshchinsky; Jaime Caro
Journal:  Mol Cell Biol       Date:  2002-05       Impact factor: 4.272

5.  Inverse solvent isotope effects arising from substrate triggering in the factor inhibiting hypoxia inducible factor.

Authors:  John A Hangasky; Evren Saban; Michael J Knapp
Journal:  Biochemistry       Date:  2013-02-18       Impact factor: 3.162

6.  The contribution of VHL substrate binding and HIF1-alpha to the phenotype of VHL loss in renal cell carcinoma.

Authors:  Jodi K Maranchie; James R Vasselli; Joseph Riss; Juan S Bonifacino; W Marston Linehan; Richard D Klausner
Journal:  Cancer Cell       Date:  2002-04       Impact factor: 31.743

7.  Substrate preference of the HIF-prolyl hydroxylase-2 (PHD2) and substrate-induced conformational change.

Authors:  Serap Pektas; Michael J Knapp
Journal:  J Inorg Biochem       Date:  2013-05-21       Impact factor: 4.155

8.  Investigating the contribution of the active site environment to the slow reaction of hypoxia-inducible factor prolyl hydroxylase domain 2 with oxygen.

Authors:  Hanna Tarhonskaya; Rasheduzzaman Chowdhury; Ivanhoe K H Leung; Nikita D Loik; James S O McCullagh; Timothy D W Claridge; Christopher J Schofield; Emily Flashman
Journal:  Biochem J       Date:  2014-11-01       Impact factor: 3.857

9.  Non-enzymatic chemistry enables 2-hydroxyglutarate-mediated activation of 2-oxoglutarate oxygenases.

Authors:  Hanna Tarhonskaya; Anna M Rydzik; Ivanhoe K H Leung; Nikita D Loik; Mun Chiang Chan; Akane Kawamura; James S O McCullagh; Timothy D W Claridge; Emily Flashman; Christopher J Schofield
Journal:  Nat Commun       Date:  2014-03-05       Impact factor: 14.919

10.  Human oxygen sensing may have origins in prokaryotic elongation factor Tu prolyl-hydroxylation.

Authors:  John S Scotti; Ivanhoe K H Leung; Wei Ge; Michael A Bentley; Jordi Paps; Holger B Kramer; Joongoo Lee; WeiShen Aik; Hwanho Choi; Steinar M Paulsen; Lesley A H Bowman; Nikita D Loik; Shoichiro Horita; Chia-hua Ho; Nadia J Kershaw; Christoph M Tang; Timothy D W Claridge; Gail M Preston; Michael A McDonough; Christopher J Schofield
Journal:  Proc Natl Acad Sci U S A       Date:  2014-09-02       Impact factor: 11.205

View more
  32 in total

Review 1.  Unlocking mammalian regeneration through hypoxia inducible factor one alpha signaling.

Authors:  Kelsey G DeFrates; Daniela Franco; Ellen Heber-Katz; Phillip B Messersmith
Journal:  Biomaterials       Date:  2021-01-09       Impact factor: 12.479

2.  William Kaelin, Peter Ratcliffe, and Gregg Semenza receive the 2016 Albert Lasker Basic Medical Research Award.

Authors:  Jillian H Hurst
Journal:  J Clin Invest       Date:  2016-09-13       Impact factor: 14.808

3.  Metabolic adaptation in hypoxia and cancer.

Authors:  Felipe Paredes; Holly C Williams; Alejandra San Martin
Journal:  Cancer Lett       Date:  2021-01-11       Impact factor: 8.679

Review 4.  Amazing Diversity in Biochemical Roles of Fe(II)/2-Oxoglutarate Oxygenases.

Authors:  Caitlyn Q Herr; Robert P Hausinger
Journal:  Trends Biochem Sci       Date:  2018-04-27       Impact factor: 13.807

Review 5.  Self-Sustained Regulation or Self-Perpetuating Dysregulation: ROS-dependent HIF-YAP-Notch Signaling as a Double-Edged Sword on Stem Cell Physiology and Tumorigenesis.

Authors:  Chin-Lin Guo
Journal:  Front Cell Dev Biol       Date:  2022-06-14

Review 6.  O2 sensing, mitochondria and ROS signaling: The fog is lifting.

Authors:  Gregory B Waypa; Kimberly A Smith; Paul T Schumacker
Journal:  Mol Aspects Med       Date:  2016-01-14

7.  The Activity of JmjC Histone Lysine Demethylase KDM4A is Highly Sensitive to Oxygen Concentrations.

Authors:  Rebecca L Hancock; Norma Masson; Kate Dunne; Emily Flashman; Akane Kawamura
Journal:  ACS Chem Biol       Date:  2017-02-20       Impact factor: 5.100

8.  Characterization and functional analysis of hypoxia-inducible factor HIF1α and its inhibitor HIF1αn in tilapia.

Authors:  Hong Lian Li; Xiao Hui Gu; Bi Jun Li; Xiao Chen; Hao Ran Lin; Jun Hong Xia
Journal:  PLoS One       Date:  2017-03-09       Impact factor: 3.240

9.  Tuning the Transcriptional Response to Hypoxia by Inhibiting Hypoxia-inducible Factor (HIF) Prolyl and Asparaginyl Hydroxylases.

Authors:  Mun Chiang Chan; Nicholas E Ilott; Johannes Schödel; David Sims; Anthony Tumber; Kerstin Lippl; David R Mole; Christopher W Pugh; Peter J Ratcliffe; Chris P Ponting; Christopher J Schofield
Journal:  J Biol Chem       Date:  2016-08-08       Impact factor: 5.157

10.  Factor inhibiting HIF1-A novel target of SUMOylation in the human placenta.

Authors:  Julien Sallais; Sruthi Alahari; Andrea Tagliaferro; Jayonta Bhattacharjee; Martin Post; Isabella Caniggia
Journal:  Oncotarget       Date:  2017-12-07
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.