Literature DB >> 25589173

Engineering synthetic antibody binders for allosteric inhibition of prolactin receptor signaling.

Shahir S Rizk1,2, Jean-Louis K Kouadio3,4, Anna Szymborska5,6, Erica M Duguid7, Somnath Mukherjee8, Jiamao Zheng9, Charles V Clevenger10,11, Anthony A Kossiakoff12.   

Abstract

BACKGROUND: Many receptors function by binding to multiple ligands, each eliciting a distinct biological output. The extracellular domain of the human prolactin receptor (hPRL-R) uses an identical epitope to bind to both prolactin (hPRL) and growth hormone (hGH), yet little is known about how each hormone binding event triggers the appropriate response.
FINDINGS: Here, we utilized a phage display library to generate synthetic antibodies (sABs) that preferentially modulate hPRL-R function in a hormone-dependent fashion. We determined the crystal structure of a sAB-hPRL-R complex, which revealed a novel allosteric mechanism of antagonism, whereby the sAB traps the receptor in a conformation more suitable for hGH binding than hPRL. This was validated by examining the effect of the sABs on hormone internalization via the hPRL-R and its downstream signaling pathway.
CONCLUSIONS: The findings suggest that subtle structural changes in the extracellular domain of hPRL-R induced by each hormone determine the biological output triggered by hormone binding. We conclude that sABs generated by phage display selection can detect these subtle structural differences, and therefore can be used to dissect the structural basis of receptor-ligand specificity.

Entities:  

Mesh:

Substances:

Year:  2015        PMID: 25589173      PMCID: PMC4300558          DOI: 10.1186/s12964-014-0080-8

Source DB:  PubMed          Journal:  Cell Commun Signal        ISSN: 1478-811X            Impact factor:   5.712


Findings

It is commonplace for a single receptor to recognize a number of different ligands and a single ligand to bind to a number of different receptors [1]. In many cases, the distinct biological output elicited by each ligand is due to its interaction with a different epitope on the surface of a receptor, triggering a defined signaling pathway. In some unique cases, a receptor is able to interact with different ligands using an identical set of amino acids, yet each ligand results in a distinct biological outcome. A prominent example of this type of promiscuity is the prolactin receptor (PRL-R), which uses the same set of amino acids on its extracellular domain (ECD) to bind to two different hormones: prolactin (PRL) [2,3] and growth hormone (GH) [4,5]. Prolactin receptor signaling is primarily triggered by homodimerization [3], which is induced by GH or PRL binding. Since the structures of hGH and PRL contain no tertiary symmetry, in forming their respective complexes with the ECD homodimers, the hormones employ opposite faces utilizing surface epitopes possessing quite different topographical and electrostatic features [4-6]. As a consequence, in the case for both PRL and GH, the ECD binding sites have quite different affinities: a high affinity site called Site 1, and a lower affinity site, Site2 [6]. Although Site1 has higher affinity than Site2, quite remarkably, the paratope they interact with on the ECD is virtually identical. Thus, the same binding patch on the PRL-R ECD recognizes two distinct binding interfaces on each of two different hormones, yet each hormone activates a distinct biological outcome. Exactly how this is accomplished is an area of intense interest in both basic and applied research and many unresolved molecular recognition issues remain. We present, here, a methodology that utilizes a novel class of affinity reagents generated by phage display selections that induce allosteric changes in a target protein that can effectively differentiate between ligands that bind to the same receptor epitope. These affinity reagents are based on the antigen-antibody fragment (Fab) antibody frameworks and are called “synthetic antibodies” or sABs [7]. The extracellular domain of the human prolactin receptor (hPRL-R) was chosen as a target system because of its number of activating hormones [5,6,8] and the biological implications of being able to selectively tune its activity [3,9,10]. Structural studies comparing the two hormone-receptor complexes [4] suggested that such selectivity could be achieved by capturing subtle conformational differences induced by hGH versus hPRL at either site in the ECD through an allosteric-control mechanism. To generate sABs against hPRL-R, the immobilized ECD was incubated with a 1010 member reduced genetic code phage display library [11]. The sABs are displayed in bivalent format by fusion to the pIII coat protein of M13 phage. Diversity is introduced into four of the six complementary determining region (CDR) binding loops. After three rounds of selection followed by a binding screen by phage ELISA, four unique sAB clones were identified. All four sABs, designated A4, A8, A9 and A10, were expressed and purified, and their affinities for the hPRL-R ECD were determined by surface plasmon resonance (SPR) (Table 1). Three of the four sABs exhibited nanomolar affinities for the hPRL-R ECD. sAB, A4 showed little detectable binding in a protein format and thus was used as a negative control in the subsequent experiments.
Table 1

Binding kinetics and loop sequence of PRL-R sABs

sAB k on (M −1s −1 ) a k off (s −1 ) a K D (nM) a Loop sequence
L3 b H1 b H2 b H3 b
A-4 No bindingHYTTPPFYSSYIYIYPSYGYSYYSYYGWDYHNSSGAM
A-8 9.6 × 104 5.4 × 10−4 5.6YYSYYYPFFSSSSMYISPYYGSSYGYVYWNAYSSGM
A-9 1.4 × 104 3.4 × 10−5 2.5YSSSYLLFSSSSISIYSYYSSSYDSYPWVYSYTVSGAF
A-10 1.2 × 105 2.6 × 10−3 21HYTTPPFSSSYISISPYYGSSYYYPEETAF

Binding kinetics were determined by SPR on a Biacore 2000, dissociation constant was calculated from the on and off rates.

Randomized loops in the Fab scaffold, L3: light chain loop 3; H1, H2 and H3: heavy chain loop 1, 2 and 3, respectively.

Binding kinetics and loop sequence of PRL-R sABs Binding kinetics were determined by SPR on a Biacore 2000, dissociation constant was calculated from the on and off rates. Randomized loops in the Fab scaffold, L3: light chain loop 3; H1, H2 and H3: heavy chain loop 1, 2 and 3, respectively. To gain insight into the structural basis of the interactions between the sABs and hPRL-R, we determined the crystal structure of the receptor in complex with sAB A8. In the structure, the sAB binds to the opposite face of the ECD away from the hormone-binding site (Figure 1a). Interactions between the two molecules are mediated by side chain residues of the CDR loops of the sAB and the hinge region that connects the two tandem fibronectin (FN) domains of hPRL-R (Figure 1b). Alignment of the ECD FN2 domain in the context of the sAB-bound structure with the 2:1 PRLR: PRL structure [8] reveals that the sAB captures a hinge-bending conformation that results in a subtle, but significant rotation of FN1 relative to FN2 (Figure 1c).
Figure 1

Crystal structure of the hPRL-R in complex with sAB A8. a sAB A8 (green) binds to the human PRL-R (red) opposite to the hormone binding site. b A close up of the interactions between the CDR loops of sAB A8 (green) and the hinge region between the two fibronectin (FN) domains of PRL-R (red). c Alignment of the FN2 domains of the PRL-R structure determined here (red) with the PRL-R structure (yellow) bound to PRL (grey) in the 2:1 complex (PDB code: 3NPZ), the side view (above) shows the twist between the two FN domains induced by sAB binding and the top view (below) shows a rotation of the FN1 domain relative to the FN2 domain in the sAB-bound structure. d Alignment of the sAB-bound PRL-R (red) with the hGH-bound PRL-R (green) and the PRL-bound PRL-R (yellow) using the FN2. The bottom panel is a top view of the FN1 of all three structures, with the sAB-bound receptor more resembling the hGH-bound conformation. e Inhibition of sAB binding by hGH or PRL using phage ELISA. Both hGH (left panel) and PRL (right panel) inhibit the interaction between phage-displayed sABs and hPRL-R in a concentration dependent manner. f IC50 values of the hGH or PRL inhibition of the interaction between sABs and hPRL-R calculated from e.

Crystal structure of the hPRL-R in complex with sAB A8. a sAB A8 (green) binds to the human PRL-R (red) opposite to the hormone binding site. b A close up of the interactions between the CDR loops of sAB A8 (green) and the hinge region between the two fibronectin (FN) domains of PRL-R (red). c Alignment of the FN2 domains of the PRL-R structure determined here (red) with the PRL-R structure (yellow) bound to PRL (grey) in the 2:1 complex (PDB code: 3NPZ), the side view (above) shows the twist between the two FN domains induced by sAB binding and the top view (below) shows a rotation of the FN1 domain relative to the FN2 domain in the sAB-bound structure. d Alignment of the sAB-bound PRL-R (red) with the hGH-bound PRL-R (green) and the PRL-bound PRL-R (yellow) using the FN2. The bottom panel is a top view of the FN1 of all three structures, with the sAB-bound receptor more resembling the hGH-bound conformation. e Inhibition of sAB binding by hGH or PRL using phage ELISA. Both hGH (left panel) and PRL (right panel) inhibit the interaction between phage-displayed sABs and hPRL-R in a concentration dependent manner. f IC50 values of the hGH or PRL inhibition of the interaction between sABs and hPRL-R calculated from e. Interestingly, the receptor in complex with the sAB more closely resembles the hGH-bound form than the PRL-bound form [4] (Figure 1d). By aligning the FN1 domains of all three structures, the FN2 of the sAB-bound form and the hGH-bound form align well, while the FN2 of the PRL-bound is offset from the other 2 structures (Figure 1d). This observation implies that the sAB would have a greater impact on PRL binding than hGH binding. To test this, we examined the ability of each hormone to inhibit sAB binding to the receptor using a phage ELISA. In this experiment, the biotinylated receptor was immobilized on streptavidin plates and incubated with increasing concentrations of either hGH or PRL in the presence of phage displaying sAB A8, A9 or A10. By detecting the relative amount of phage bound to the receptor at each hormone concentration, IC50 values for each hormone-sAB combination were determined (Figure 1e). Although hGH has a higher affinity for the receptor (Kd ~1nM) [6] than PRL (Kd ~6nM) [2], the IC50 values for hGH were ~5 fold higher than those for PRL (Figure 1f). This indicates that PRL has a more profound inhibitory effect on sAB-receptor interaction than hGH, an observation that is consistent with structure alignments (Figure 1d). The results also suggest that all three sABs bind to the same epitope on the receptor, supported by basic epitope mapping using phage ELISA (Additional file 1: Figure S2). We note that biological signaling requires the hormones to bind the ECD at both Site1 and the lower affinity Site2. Thus, it is possible that the sABs have an even more profound effect on ECD binding at Site2. Unfortunately, because of its more transient nature, it is not possible to quantitatively measure the influence of sABs on binding of the hormone at Site2. Thus, we instead quantified the effects using relevant biological readouts of the intracellular signaling mechanism mediated by the hPRL-R using T47D, a breast cancer cell-line. First, we examined the effects of sABs on hormone-induced receptor internalization, which is a ubiquitous feature of cytokine receptor activation. We tested the ability of the four sABs to block hPRL-R-mediated internalization of cy5-labeled hPRL or hGH. Fluorescence microscopy indicated that sABs A8, A9 and A10 significantly decreased or completely abolished the internalization of hPRL, whereas the control sAB A4 had no effect on hormone internalization (Figure 2a). In contrast, internalization of hGH was only slightly inhibited by sABs A8, A9 and A10 (Figure 2b), presumably due to the ability of the sABs to recognize the conformation differences between the hPRL and hGH bound forms of hPRL-R.
Figure 2

sAB inhibition of hPRL-R in T47D breast cancer cells. a-b Fluorescence microscopy images of cells treated with 100 nM cy5-hPRL (a) or cy5-hGH (b) in the presence of each sAB. All panels represent two merged channels; blue: DAPI nuclear stain, red: cy5. c A Stat5 phospholyration luciferase reporter assay of T47D cells in the presence or absence of hPRL and hPRL-R sABs. A sAB against bacterial maltose binding protein (MBP) [7] was used as a negative control. d Western blot detection of the time-dependent inhibition of hPRL-R signaling by hPRL-R sABs.

sAB inhibition of hPRL-R in T47D breast cancer cells. a-b Fluorescence microscopy images of cells treated with 100 nM cy5-hPRL (a) or cy5-hGH (b) in the presence of each sAB. All panels represent two merged channels; blue: DAPI nuclear stain, red: cy5. c A Stat5 phospholyration luciferase reporter assay of T47D cells in the presence or absence of hPRL and hPRL-R sABs. A sAB against bacterial maltose binding protein (MBP) [7] was used as a negative control. d Western blot detection of the time-dependent inhibition of hPRL-R signaling by hPRL-R sABs. We next examined the concentration and time-dependent effects of the sABs on hPRL-R signaling. A luciferase reporter assay [12] revealed that sABs A8, A9 and A10 exhibit a concentration-dependent inhibition of downstream Stat5 phosphorylation, whereas the control sAB A4 showed no significant effect (Figure 2c). The inhibition of hPRL-R signaling by these three sABs was confirmed by western blot analysis of the downstream components of the prolactin induced signaling pathway (Figure 2d). These sABs drastically inhibited Stat5 and ERK phosphorylation, and partially inhibited AKT phosphorylation. Additionally, inhibition of signaling is correlated with the affinity of each sAB for the receptor. The structural information gained from the A8-hPRL-R complex reveals the mechanism by which the sAB functions as an allosteric antagonist of PRL activity. The ability of a number of cytokine receptors, including hPRL-R, to bind to multiple ligands, which manifest in different biological responses, brings about important questions relating subtle changes in receptor conformation on the cell-surface to downstream effects inside the cell. Our work indicates that sABs can distinguish between such subtle differences in receptor structure, i.e. hGH-bound vs. hPRL-bound, that ultimately define the function of the receptor. Therefore, the ability to utilize phage display to rationally engineer sophisticated reagents as highly selective inhibitors with defined behavior can serve as a powerful approach to investigate the diversity of structural states of cell-surface receptors and to design new drugs.
  12 in total

1.  Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.

Authors:  Jan van Agthoven; Chi Zhang; Estelle Tallet; Bertrand Raynal; Sylviane Hoos; Bruno Baron; Patrick England; Vincent Goffin; Isabelle Broutin
Journal:  J Mol Biol       Date:  2010-09-25       Impact factor: 5.469

Review 2.  New mechanisms for PRLr action in breast cancer.

Authors:  Charles V Clevenger; Samantha L Gadd; Jiamao Zheng
Journal:  Trends Endocrinol Metab       Date:  2009-06-15       Impact factor: 12.015

3.  The X-ray structure of a growth hormone-prolactin receptor complex.

Authors:  W Somers; M Ultsch; A M De Vos; A A Kossiakoff
Journal:  Nature       Date:  1994-12-01       Impact factor: 49.962

4.  Expression of functional prolactin and its receptor in human colorectal cancer.

Authors:  Jan-Michel Otte; Claudia Otte; Stefanie Beckedorf; Frank Schmitz; Barbara K Vonderhaar; Ulrich R Fölsch; Sievert Kloehn; Karl-Heinz Herzig; Heiner Mönig
Journal:  Int J Colorectal Dis       Date:  2002-06-27       Impact factor: 2.571

Review 5.  The role of prolactin in mammary carcinoma.

Authors:  Charles V Clevenger; Priscilla A Furth; Susan E Hankinson; Linda A Schuler
Journal:  Endocr Rev       Date:  2003-02       Impact factor: 19.871

6.  Zinc mediation of the binding of human growth hormone to the human prolactin receptor.

Authors:  B C Cunningham; S Bass; G Fuh; J A Wells
Journal:  Science       Date:  1990-12-21       Impact factor: 47.728

7.  Crystal structure of an affinity-matured prolactin complexed to its dimerized receptor reveals the topology of hormone binding site 2.

Authors:  Isabelle Broutin; Jean-Baptiste Jomain; Estelle Tallet; Jan van Agthoven; Bertrand Raynal; Sylviane Hoos; Birthe B Kragelund; Paul A Kelly; Arnaud Ducruix; Patrick England; Vincent Goffin
Journal:  J Biol Chem       Date:  2010-01-06       Impact factor: 5.157

8.  Crystal structure and site 1 binding energetics of human placental lactogen.

Authors:  Scott T R Walsh; Anthony A Kossiakoff
Journal:  J Mol Biol       Date:  2006-03-02       Impact factor: 5.469

9.  Allosteric control of ligand-binding affinity using engineered conformation-specific effector proteins.

Authors:  Shahir S Rizk; Marcin Paduch; John H Heithaus; Erica M Duguid; Andrew Sandstrom; Anthony A Kossiakoff
Journal:  Nat Struct Mol Biol       Date:  2011-03-06       Impact factor: 15.369

10.  Quantification of PRL/Stat5 signaling with a novel pGL4-CISH reporter.

Authors:  Feng Fang; Giovanni Antico; Jiamao Zheng; Charles V Clevenger
Journal:  BMC Biotechnol       Date:  2008-02-06       Impact factor: 2.563

View more
  9 in total

1.  An engineered ultra-high affinity Fab-Protein G pair enables a modular antibody platform with multifunctional capability.

Authors:  Tomasz Slezak; Lucas J Bailey; Mateusz Jaskolowski; Dominik A Nahotko; Ekaterina V Filippova; Elena K Davydova; Anthony A Kossiakoff
Journal:  Protein Sci       Date:  2019-11-01       Impact factor: 6.725

2.  Engineered synthetic antibodies as probes to quantify the energetic contributions of ligand binding to conformational changes in proteins.

Authors:  Somnath Mukherjee; Dionne H Griffin; James R Horn; Shahir S Rizk; Malgorzata Nocula-Lugowska; Magnus Malmqvist; Sangwoo S Kim; Anthony A Kossiakoff
Journal:  J Biol Chem       Date:  2018-01-10       Impact factor: 5.157

3.  Prolactin Receptor-Mediated Internalization of Imaging Agents Detects Epithelial Ovarian Cancer with Enhanced Sensitivity and Specificity.

Authors:  Karthik M Sundaram; Yilin Zhang; Anirban K Mitra; Jean-Louis K Kouadio; Katja Gwin; Anthony A Kossiakoff; Brian B Roman; Ernst Lengyel; Joseph A Piccirilli
Journal:  Cancer Res       Date:  2017-02-15       Impact factor: 12.701

Review 4.  The "Sticky Patch" Model of Crystallization and Modification of Proteins for Enhanced Crystallizability.

Authors:  Zygmunt S Derewenda; Adam Godzik
Journal:  Methods Mol Biol       Date:  2017

5.  Development of "Plug and Play" Fiducial Marks for Structural Studies of GPCR Signaling Complexes by Single-Particle Cryo-EM.

Authors:  Przemyslaw Dutka; Somnath Mukherjee; Xiang Gao; Yanyong Kang; Parker W de Waal; Lei Wang; Youwen Zhuang; Karsten Melcher; Cheng Zhang; H Eric Xu; Anthony A Kossiakoff
Journal:  Structure       Date:  2019-10-25       Impact factor: 5.006

6.  Targeted rescue of cancer-associated IDH1 mutant activity using an engineered synthetic antibody.

Authors:  Shahir S Rizk; Somnath Mukherjee; Akiko Koide; Shohei Koide; Anthony A Kossiakoff
Journal:  Sci Rep       Date:  2017-04-03       Impact factor: 4.379

7.  Selective function-blocking monoclonal human antibody highlights the important role of membrane type-1 matrix metalloproteinase (MT1-MMP) in metastasis.

Authors:  Albert G Remacle; Piotr Cieplak; Dong Hyun Nam; Sergey A Shiryaev; Xin Ge; Alex Y Strongin
Journal:  Oncotarget       Date:  2017-01-10

Review 8.  Protein Engineering: Advances in Phage Display for Basic Science and Medical Research.

Authors:  Elena K Davydova
Journal:  Biochemistry (Mosc)       Date:  2022-01       Impact factor: 2.487

Review 9.  Membrane Hormone Receptors and Their Signaling Pathways as Targets for Endocrine Disruptors.

Authors:  Yves Combarnous; Thi Mong Diep Nguyen
Journal:  J Xenobiot       Date:  2022-03-25
  9 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.