Erik González1, Marion Rother2, Markus C Kerr3, Munir A Al-Zeer1, Mohammad Abu-Lubad1, Mirjana Kessler1, Volker Brinkmann1, Alexander Loewer4, Thomas F Meyer1. 1. Department of Molecular Biology, Max Planck Institute for Infection Biology, Charitéplatz 1, 10117 Berlin, Germany. 2. 1] Department of Molecular Biology, Max Planck Institute for Infection Biology, Charitéplatz 1, 10117 Berlin, Germany [2] Steinbeis Innovation Center for Systems Biomedicine, Falkensee, Germany. 3. 1] Department of Molecular Biology, Max Planck Institute for Infection Biology, Charitéplatz 1, 10117 Berlin, Germany [2] Institute for Molecular Bioscience, University of Queensland, St Lucia, Queensland 4072, Australia. 4. Berlin Institute for Medical Systems Biology, Max-Delbrück-Center for Molecular Medicine, Robert-Rössle-Strasse 10, 13125 Berlin, Germany.
Abstract
Chlamydia, a major human bacterial pathogen, assumes effective strategies to protect infected cells against death-inducing stimuli, thereby ensuring completion of its developmental cycle. Paired with its capacity to cause extensive host DNA damage, this poses a potential risk of malignant transformation, consistent with circumstantial epidemiological evidence. Here we reveal a dramatic depletion of p53, a tumor suppressor deregulated in many cancers, during Chlamydia infection. Using biochemical approaches and live imaging of individual cells, we demonstrate that p53 diminution requires phosphorylation of Murine Double Minute 2 (MDM2; a ubiquitin ligase) and subsequent interaction of phospho-MDM2 with p53 before induced proteasomal degradation. Strikingly, inhibition of the p53-MDM2 interaction is sufficient to disrupt intracellular development of Chlamydia and interferes with the pathogen's anti-apoptotic effect on host cells. This highlights the dependency of the pathogen on a functional MDM2-p53 axis and lends support to a potentially pro-carcinogenic effect of chlamydial infection.
Chlamydia, a major human bacterial pathogen, assumes effective strategies to protect infected cells against death-inducing stimuli, thereby ensuring completion of its developmental cycle. Paired with its capacity to cause extensive host DNA damage, this poses a potential risk of malignant transformation, consistent with circumstantial epidemiological evidence. Here we reveal a dramatic depletion of p53, a tumor suppressor deregulated in many cancers, during Chlamydia infection. Using biochemical approaches and live imaging of individual cells, we demonstrate that p53 diminution requires phosphorylation of Murine Double Minute 2 (MDM2; a ubiquitin ligase) and subsequent interaction of phospho-MDM2 with p53 before induced proteasomal degradation. Strikingly, inhibition of the p53-MDM2 interaction is sufficient to disrupt intracellular development of Chlamydia and interferes with the pathogen's anti-apoptotic effect on host cells. This highlights the dependency of the pathogen on a functional MDM2-p53 axis and lends support to a potentially pro-carcinogenic effect of chlamydial infection.
The tumour suppressor p53, the
‘guardian of the genome’, is modulated in response to cellular
stress, including DNA damage, osmotic shock, ribonucleotide depletion, deregulated
oncogene expression and also by specific pathogenic bacteria12.
Activation of p53 initiates a suite of
signalling cascades that lead to transient cellular responses (for example, cell cycle
arrest and DNA repair) or to terminal cell fates (for example, differentiation,
apoptosis or senescence), depending on the nature and degree of the signal
initiated3.Chlamydia trachomatis is the most common cause of sexually transmitted bacterial
infection in humans and the leading cause of preventable blindness worldwide4. If left untreated, infection in women can lead to pelvic inflammatory
disease, causing chronic pelvic pain and even infertility. In addition, positive
correlations between C. trachomatis infection and invasive cervical cancer (ICC)
in human papillomavirus (HPV)-positive women suggest that Chlamydia can act as
co-factor for squamous cell transformation567, although the molecular
mechanism for this correlation is unclear.Depending on the infection stage, Chlamydia can induce host cell death or actively
inhibit apoptosis8. Initial observations demonstrated a profound
resistance of C. trachomatis-infected HeLa cells to a range of apoptotic
stimuli9, a property that was shared with other pathogenic
Chlamydia species10. Our recent finding that cells cleared of
Chlamydia infection exhibit reduced p53 binding to the promoter of the cell cycle checkpoint regulator
p21 (ref. 11), together with the central role of p53 in modulating the cellular stress response, notably apoptosis,
prompted us to investigate the consequences of Chlamydia infection on cellular
p53 levels.Here we find that p53 is
proteolytically degraded from 24 hours post-infection (h p.i.) with various
Chlamydia species in response to activation of the classical p53–MDM2 interaction axis. Further, we find that
pharmacological inhibition of this interaction is sufficient to inhibit both the
intracellular development of the pathogen and re-sensitize the infected host cells to
apoptotic stimuli.
Results
Chlamydia infection induces the degradation of p53
Western immunoblotting of HeLa cells infected with Chlamydia trachomatis
L2 (CTL2) revealed a striking reduction in total cellular p53 protein starting from
24 h p.i., with a further reduction to nearly non-detectable levels
between 36 and 48 h p.i. (Fig. 1a). The
Chlamydia-induced p53 degradation was observed irrespective of the cell lysis
and protein sample preparation procedure applied (Laemmli, 8 M urea
or RIPA buffer; Supplementary Fig.
1a,b), excluding proteolytic artefacts12. Also, the
degraded protein was confirmed to be tumour-suppressor p53 using specific RNA interference
oligonucleotides (Supplementary Fig.
1c).
Figure 1
Chlamydia induces p53 degradation.
(a) Western blotting analysis showing progressive degradation of total
p53 protein between
24 and 48 h p.i. in CTL2-infected whole-cell lysates
(MOI=1). Chlamydial Hsp60
and β-actin
served as infection and loading controls, respectively. (b)
Representative time-lapse microscopy images of p53-Venus-expressing cells infected
with CTL2 (MOI=0.5) from 24 to 40 h p.i. Nuclei from infected and
uninfected cells are presented as montages as indicated. (c)
Individual cells were tracked and the average nuclear Venus fluorescence (in
green) measured. Normalized trajectories of p53-Venus levels are shown.
Vertical dashed line indicates time of cell division. Scale bar,
20 μm. (d) The fraction of cells showing no
pulse, 1 or 2 pulses or more than 3 pulses between 24 and 48 h
p.i. The frequency of p53
pulses from >60 infected or uninfected cells were quantified. Error
bars present the standard error of the proportion. (e) Western
blotting showing decreased degradation of total p53 and non-cleavage of
keratin 8 and
vimentin in
whole-cell lysates prepared from cells infected with CTL2 (MOI=1) for
48 h and treated with the proteasome inhibitors lactacystin or MG132 (150 μM)
from 47 h p.i. Chlamydial Major Outer Membrane Protein (MOMP) and β-actin served as
infection and loading controls, respectively. Full blots for a and
e are shown in Supplementary Fig. 7.
Previous studies have demonstrated that population-averaged analyses such as
immunoblotting can mask true dynamic signalling responses to stress1314. Furthermore, we sought to circumvent the necessary lysis
steps inherent in these protocols as there is currently significant controversy
surrounding the actions of chlamydial proteases following cell lysis12. We therefore analysed p53 dynamics in intact cells using an MCF7 reporter cell
line expressing pMT-p53-Venus
and pEF1α-mCherry-53BP1. These cells present spontaneous asynchronous pulses
in the fluorescent p53-Venus
signal over time15. Cells were infected with CTL2 and examined by
time-lapse videomicroscopy from 24 to 48 h p.i. Strikingly, although
p53-Venus oscillations
(p53 pulses) were observed
in uninfected cells, infected cells (identified by their large
Chlamydia-filled inclusions) presented a rapid and sustained reduction of
p53-Venus signal from 24
to 48 h p.i., concurrent with an increase in inclusion size (Fig. 1b–d; Supplementary Movie 1). As the expression of this p53-Venus reporter is under the control
of a constitutive metallothionein (MT) promoter, this observation suggests that
the decrease in cellular p53
observed in Fig. 1a must reflect proteolytic activity
rather than transcriptional regulation.Regulation of p53 degradation
is mediated by Murine Double Minute
2 (MDM2).
Following activation, MDM2
binds and ubiquitinates p53,
leading to its translocation to the cytosol and proteasomal degradation16. MDM2 is
phosphorylated by AKT at Ser-166/186, both of which are located within the
RXRXXS/T consensus motifs for AKT kinase. The phosphorylation of MDM2 at Ser-166/186 promotes its nuclear
localization and its interaction with p300, a transcriptional co-activator that
forms a complex with MDM2 and
promotes p53 degradation171819. To monitor MDM2 activation, we carried out western immunoblotting of
Chlamydia-infected protein samples using an
anti-phospho-MDM2 (Ser166)
antibody. From 10 h p.i. an elevation in phosphorylated MDM2 was observed, suggesting that this
might be an essential step involved in p53 degradation in Chlamydia-infected cells (Fig. 2a). Notably, western immunoblotting of the same
samples using antibodies to detect total MDM2 levels showed no change following infection. Inhibiting
proteasomal activity with the cell permeable proteasome inhibitors MG132 and lactacystin20–also a known inhibitor of the chlamydial protease-like activity
factor (CPAF)–rescued p53 protein levels (Fig. 1e),
indicating the involvement of the proteasome in Chlamydia-induced
p53 degradation. To
exclude artificial post-lysis degradation of p53 by CPAF, we also monitored cleavage of keratin-8 and vimentin, two recognized post-lysis CPAF
targets1221. No evidence of keratin-8 or vimentin proteolysis was observed at
48 h p.i. (Fig. 1e) thus validating our lysis
method.
Figure 2
Chlamydia-induced degradation of p53 is mediated by phosphorylation of MDM2.
(a) Western blotting analysis showing a progressive increase of
P-MDM2 (S166)
compared with total MDM2
between 10 and 48 h p.i. in CTL2 (MOI=1)-infected whole-cell
lysates. Chlamydial Hsp60
and β-actin
served as infection and loading controls, respectively. (b) Western
blotting showing decreased degradation of total p53 in whole-cell lysates prepared
from cells infected with CTL2 (MOI 1) for 48 h and treated with
the inhibitors Nutlin3a
or RITA. Chlamydial
Hsp60 and
β-actin
served as infection and loading controls, respectively. Full blots for
a and b) are shown in Supplementary Fig. 7. (c) The
fraction of cells showing no pulse, 1 or 2 pulses or more than 3 pulses
between 24 and 48 h p.i. was quantified following treatment with
Nutlin3a or
chloramphenicol
(CAM). The frequency
of p53 pulses from
>60 infected or uninfected cells was quantified. Error bars present
the standard error of the proportion.
To dissect the link between Chlamydia-induced p53 degradation and MDM2 phosphorylation, we used
established pharmacological inhibitors as they offer the capacity to rapidly and
specifically target key molecular players. Nutlins are cis-imidazoline
analogues that inhibit the interaction between phospho-MDM2 and p53 (ref. 22). Similarly, the small-molecule inhibitor RITA (reactivation of p53 and induction of tumour cell
apoptosis) binds p53 and
thereby also prevents its interaction with MDM2 and the subsequent degradation of p53 (ref. 23). Cells were infected with CTL2 for 48 h, treated
with Nutlin3a or RITA at the indicated concentrations
from 12 h p.i., and subjected to western immunoblotting. The
inhibitors markedly reduced the degree to which p53 was degraded, whereas levels of
phosphorylated MDM2, total
MDM2 and bacterial
Hsp60 protein remained
unchanged (Fig. 2b). Further, time-lapse videomicroscopy
demonstrated that 5 μM Nutlin3a added at 24 h p.i. was sufficient to
rescue the pulses in p53-Venus, despite infection with CTL2 (Fig.
2c). Interestingly, although infected cells presented regular pulses
in p53-Venus signal with
Nutlin3a treatment,
uninfected cells presented a sustained p53-Venus signal (Supplementary Movie 2). Treatment with the bacterial protein
synthesis inhibitor chloramphenicol (CAM,
10–100 μg ml−1)
from 24 h p.i. was sufficient to inhibit inclusion expansion24, however, it was not sufficient to rescue the p53-Venus pulses (Fig.
2c and Supplementary Movie
3) or prevent phosphorylation of MDM2 and degradation of p53 (Supplementary
Fig. 2).There is considerable controversy surrounding the roles played by secreted
bacterial proteases during chlamydial infection and the associated protein
degradation phenotypes observed25. Treatment of
Chlamydia-infected cells with CAM is sufficient to reverse a number of cellular phenotypes
induced upon infection262728, presumably reflecting an
inability to maintain sufficient intracellular concentrations of secreted
bacterial effector molecules following application of the agent. Indeed,
time-lapse videomicroscopy of Chlamydia-infected cells treated with
10 μg ml−1
CAM from 24 h p.i.
and imaged from 48 to 88 h p.i. continued to present a lack of
p53-Venus pulses (Supplementary Movie 4). To examine
the possible role played by CPAF in this process, a published cell permeable
CPAF-specific inhibitor peptide29 was employed in conjunction
with time-lapse videomicroscopy. As reported previously, addition of the
CPAF-inhibitor peptide from 12 or 24 h p.i. led to rapid induction of
non-apoptotic cell death in CTL2-infected cells, severely attenuating the
duration that videomicroscopy could be performed29. In spite of
this, no p53 pulses were
observed from 24–40 h p.i. in Chlamydia-infected
cells cultured in the presence of the inhibitor peptide, whereas p53 pulses were still readily observed
in uninfected cells (Supplementary Movie
5).
Chlamydia requires functional interaction of MDM2 with p53
A moderate reduction in the expansion of inclusions in infected cells treated
with 5 μM Nutlin3a was noted in the time-lapse experiments (compare
Supplementary Movies 1 and 2).
This prompted us to investigate the consequences of Nutlin3a treatment on the formation of
infectious CTL2 progeny. Cells were infected with CTL2 for 24 h to
establish infection and then treated with increasing concentrations of
Nutlin3a or RITA for a further 24 h. The
cells were then lysed and the lysates used to infect a second population of HeLa
cells for 24 h. Cells were fixed, immunolabelled and the number of
resulting inclusions quantified. In parallel, the impact of Nutlin3a or RITA on inclusion size and number as
well as the number of host cell nuclei was monitored in the primary infection.
Strikingly, although there was little significant impact upon inclusion size or
number in the primary infection following Nutlin3a or RITA treatment, there was a dramatic, dose-dependent
decrease in infectious progeny, suggesting that the pathogen was unable to
complete its normal developmental cycle (Fig. 3a).
Figure 3
Disruption of p53–MDM2 interaction inhibits the formation of infectious
progeny.
(a) Monolayers of HeLa cells, infected with CTL2 (MOI 0.5) for
24 h p.i., and treated with or without Nutlin3a or RITA for additional
24 h, were labelled with anti-Chlamydia antibody and
Hoechst and the
number and size of inclusions as well as number of nuclei per well
determined using ScanR software. From parallel wells, the
generation of infectious EBs was determined via infectivity assay. Results
depicted as mean percentage±s.d. normalized to controls of two
independent experiments; **P<0.01, ***P<0.001,
one-way analysis of variance with Bonferroni post-hoc test.
(b) Representative transmission electron micrographs of infected
cells 48 h p.i., with or without Nutlin3a from 24 h p.i.
Scale bars, 5 μm. Insets present high-resolution images
of the indicated region. (c) The relative proportion of EBs, RBs and
IBs, quantified from 5 to 6 electron micrographs of three independent
experiments. Nutlin3a
treatment significantly increased the proportion of IBs, whereas the
proportion of EB’s decreased accordingly. Results are depicted as
mean percentage±s.d. of two independent experiments;
*P<0.05, **P<0.01, two-tailed
Student’s t-test.
Chlamydial development is characterized by the reversible transition from an
electron-dense elementary body (EB) to a larger, non-infectious replicative
reticulate body (RB). During the later stages of the infection cycle, the
replicating RBs transform back into infectious EBs before host cell lysis or
extrusion of the inclusion. Ultrastructural analysis by transmission electron
microscopy of HeLa cells infected for 48 h with CTL2 in the presence
or absence of 5 or 10 μM Nutlin3a from 24 h p.i. revealed that
Nutlin3a did not induce
major morphological or structural changes in inclusion or bacterial membranes,
nor were enlarged RBs, often referred to as aberrant bodies, observed (Fig. 3b). However, there was a highly significant reduction
in the proportion of EBs coupled with a concurrent increase in the proportion of
intermediate bodies (IBs)–RBs in the process of retransformation to
EBs–characterized by their size and compact nucleoids (Fig. 3b,c). Similar observations were made in RITA-treated cells (Supplementary Fig. 3). This suggests that a
functional MDM2–p53 interaction is necessary for the proper formation of
infectious EBs.
Degradation of p53 is
conserved among pathogenic Chlamydiae
The primary site of CTL2 infection is the urogenital system. To examine the
impact of CTL2 infection upon p53 in cells of this system, human primary mesenchymal cells
were prepared from fallopian tubes surgically removed from patients undergoing
procedures for benign gynaecological disease, as described previously30. These primary cells were infected with CTL2 at multiplicity of
infection (MOI)=1 and treated with Nutlin3a or CAM from 24 to 48 h p.i. The samples were then
fixed and prepared for immunofluorescence microscopy using antibodies against
p53 and CTL2 (Fig. 4a). Confocal analysis confirmed that while around 40%
of non-infected cells presented a detectable p53 signal in the nucleus, this proportion decreased
significantly to less than 10% upon infection, in congruence with our
observations in HeLa and MCF7 cells. Similarly, the decrease in p53 signal could be rescued following
treatment with 10 μM Nutlin3a but not with
10 μg ml−1
CAM (Fig.
4b). As in HeLa cells, CTL2 infection did not influence total
cellular MDM2 levels of
primary fallopian tube mesenchymal cells (Supplementary Fig. 4). Western immunoblotting of primary fallopian
tube mesenchymal cells infected with CTL2 and treated with Nutlin3a confirmed that
Chlamydia-induced p53 degradation was dependent upon a functional
p53–MDM2 interaction (Fig. 4c).
CAM treatment was not
sufficient to prevent degradation of p53 in primary mesenchymal cells from the fallopian tube
(Fig. 4c). These observations in primary cells are in
accordance with the western immunoblotting and live cell microscopy data of HeLa
cells presented in Fig. 2b,c, Supplementary Movies 2 and 3 and Supplementary Fig. 2.
Figure 4
Degradation of p53 is
sustained in primary cells and mediates Chlamydia’s
anti-apoptotic effect.
(a) CTL2 infection reduces the number of p53-positive nuclei in fallopian
tube primary mesenchymal cell monolayers, an effect which is partially
reversed by Nutlin3a
treatment. Chloramphenicol (CAM) has no effect on p53 degradation in infected cells.
Primary cells were infected with CTL2 (MOI 1) and treated with Nutlin3a or CAM from 24 to 48 h p.i.
Chlamydia inclusions and p53 were labelled with a Chlamydia and
p53 antibody,
respectively; nuclei were stained with Hoechst. Scale bar, 200 μm.
(b) Quantification of the confocal images shows that the
Nutlin3a-induced
increase in the proportion of p53-positive nuclei is highly significant. Results are
depicted as mean±s.d. of two independent experiments;
*P<0.05, two-tailed Student’s t-test.
(c) Western blotting showing decreased degradation of total
p53 in whole-cell
lysates prepared from human fallopian tube primary cells infected with CTL2
(MOI=1) for 48 h. Nutlin3a treatment recovered p53 protein levels, whereas
CAM treatment did
not; β-actin
served as loading control. (d) Western blotting analysis showing that
in human fallopian tube primary cells infected with C. pneumoniae
(MOI=5), C. psittaci (MOI=3), C. muridarum (MOI=1) or C.
trachomatis L2 (MOI=1) p53 protein levels are dramatically reduced by
48 h p.i. compared with uninfected cells, whereas total
p53 protein
80 h p.i. in Simkania negevensis-infected (MOI=2) cells is
comparable to controls; β-actin served as loading control. Full blots
for c and d are shown in Supplementary Fig. 7. (e) The
extent of apoptosis induced by TNF-α treatment was analysed by
immunolabelling with cleaved caspase-3 antibody in HeLa cells infected with CTL2
(MOI=1). Infected cells showed greatly reduced labelling, however,
Nutlin3a treatment
partially restored the number of cleaved caspase-3-positive cells. Chlamydia inclusions
and nuclei were labelled with Chlamydia antibody and Hoechst. (f) Number of
cleaved caspase-3-positive nuclei per image in infected HeLa cells
treated with Nutlin3a
during apoptosis induction with TNF-α and cycloheximide, shows that Nutlin3a significantly increases
the number of apoptotic nuclei in infected cell populations. Results are
depicted as mean±s.d. of three independent experiments;
**P<0.01, ****P<0.0001, one-way analysis of
variance with Bonferroni post-hoc test.
To investigate whether or not this phenotype was species-specific, the impact of
infection with C. pneumoniae, C. psittaci, C. muridarum and C.
trachomatis L2 on p53
protein levels in primary fallopian tube cells was compared. Western
immunoblotting demonstrated that in all cases infection resulted in a
significant decrease in p53
(Fig. 4d). In contrast, infection with Simkania
negevensis3132–a primarily environmental
bacterial member of the order of Chlamydiales–did not induce
degradation of p53 (Fig. 4d; Supplementary Fig. 5). This observation suggests that p53 degradation results from a direct
impact of the invasive Chlamydiaceae upon the host cell rather than from
general, unspecific infection-induced stress.
Loss of p53 contributes
to Chlamydia’s anti-apoptotic influence
Chlamydia-infected cells are profoundly resistant to apoptosis during the
replicative phase of the pathogen’s development8. To
determine whether the observed p53 degradation contributes to this apoptosis resistance,
HeLa cells at 12 h p.i. were treated with 20 μM
Nutlin3a for
10 h, followed by induction of apoptosis with
50 ng ml−1
tumour necrosis
factor-α (TNF-α) and
10 μg ml−1
cycloheximide for
5 h. Cells were fixed and examined by immunofluorescence microscopy
using antibodies directed against cleaved caspase-3. Although Chlamydia infection alone
conferred significant resistance to TNF-α-induced apoptosis, inhibition of
MDM2-mediated degradation
of p53 with Nutlin3a was sufficient to partly
reverse this phenotype (Fig. 4e,f). An alternative readout
of apoptosis was applied by using antibodies directed against cleaved
poly-(ADP-ribose) polymerase (PARP). Again, Nutlin3a treatment of infected cells partly re-sensitized
cells to the pro-apoptotic signal elicited by TNF-α as monitored by the
significant increase in the number of infected and cleaved PARP-positive cells,
thus reinforcing our observation that recovery of p53 protein levels through inhibition
of the MDM2–p53 interaction impairs the anti-apoptotic effect induced by
Chlamydia (Supplementary Fig.
6). Indeed, we noted that infected MCF7p53-Venus reporter cells were also more
sensitive to photodamage during the live-cell imaging experiments following
treatment with Nutlin3a (Supplementary Movie 2), indicating
that they are more sensitive to extracellular stress stimuli, again reinforcing
the connection between the degradation of p53 and the resistance to apoptosis observed in
Chlamydia-infected cells.Therefore, MDM2-mediated
degradation of p53 in
Chlamydia-infected cells contributes to the anti-apoptotic influence
upon the host cell.
Discussion
In order to complete its unique biphasic developmental cycle, Chlamydia has
developed potent strategies to protect infected cells against death-inducing
stimuli8. The metabolic burden placed upon the host cell during
the replicative phase and the later stages of chlamydial infection initiates a
number of stress-related signalling pathways, which in turn need to be modulated by
the pathogen to maintain host cell viability, thereby ensuring the survival of
Chlamydia and allowing for a productive infection333435. Here we reveal the Chlamydia-induced degradation of p53, a key molecular node in the cellular
stress response pathway. This degradation was preceded by the activation of the
canonical p53-MDM2 axis and could be reversed through the
application of specific pharmacological inhibitors of this interaction.Chlamydia infection has recently been shown to cause accumulation of
double-stranded DNA breaks within the genome of the host cell while simultaneously
interfering with the DNA damage response, notably activation of the key transducer
of double-stranded DNA break signals, the nuclear protein kinase ataxia
telangiectasia mutated36. Thus, the p53 degradation phenotype reported here
represents another example of how Chlamydia infection interferes with the
host’s genotoxic stress response. As the p53 degradation phenotype was observed with
all Chlamydia species tested, as well as in the presence of the bacterial
protein synthesis inhibitor CAM,
activation of the MDM2 feedback
loop is likely to occur via a host-derived mechanism. One attractive candidate for
this role is the AKT/PKB serine-threonine kinase. MDM2 associates with AKT and is
phosphorylated at serine residues
166 and 186 following activation of the kinase (through phosphorylation at residues
308 and 473) or ectopic expression of constitutively active AKT. AKT itself is
activated in response to a variety of cell survival stimuli via the
phosphatidylinositol 3-kinase signalling cascade3738. Verbeke et
al.39 demonstrated that inhibition of both
phosphatidylinositol 3-kinase activity and AKT expression renders CTL2-infected
cells sensitive to staurosporine-induced apoptosis. Further, the authors
demonstrated that AKT itself was phosphorylated at serine residue 473 following infection39, supporting the consideration that this upstream signalling cascade
is instrumental for the degradation phenotype presented here. In addition, however,
the inability of Nutlin3a
treatment to re-sensitize the infected cells to apoptotic stimuli to the degree seen
in uninfected cells strongly suggests that additional mechanisms are employed by the
pathogen40414243.We show that treatment with Nutlin3a and RITA inhibits the later stages of the pathogen’s
developmental cycle and thereby blocks the formation of infectious progeny.
Precisely, why p53 degradation
supports progression of the pathogen’s intracellular development is
unclear. Intriguingly, the accumulated IB phenotype observed in Nutlin3a-treated cells is distinctive and
remarkably similar to that observed when chlamydial lipooligosaccharide synthesis is
inhibited with small molecules, although the agents used in this study share no
structural relationship with Nutlin3a44. Given p53’s central role in cellular
metabolism45 and the dependence of the pathogen upon the host for
metabolites, metabolomic studies under these conditions may prove to be
enlightening.Finally, given the prominent role of p53 in tumour suppression, one wonders about the contribution of
Chlamydia-induced p53
degradation to tumourigenesis in the female genital tract. Indeed, a number of
epidemiological studies have linked Chlamydia infection with several
gynaecological cancers, including cervical and ovarian cancers46, and
carcinogenesis in other organs47. It is established that infection
with HPV is necessary but not sufficient to induce ICC, as only a small proportion
of women infected with HPV progress to develop ICC48. This implicates
the involvement of additional genetic or environmental factors including infectious
agents that may contribute to final transformation. Given that C. trachomatis
is the most common sexually transmitted bacterium in humans, it represents an
attractive candidate for such a co-factor. Several large cohort studies have found a
significant correlation between C. trachomatis infection and an increased
risk of ICC development when adjusted for other factors5649,
whereas a single study opposed these epidemiological findings50.
Thus, C. trachomatis infection may play a role in confounding squamous cell
ICC in HPV-infectedwomen.Intriguingly, p53 degradation is
an important virulence mechanism in the infection of cervical cells with oncogenic
HPV strains 16 and 18 (ref. 51). The E6 and E7 open reading frames of HPV encode oncogenes, of which
E7 binds to tumour-suppressor
protein pRB leading to its
degradation via the ubiquitin-proteasome pathway5253 and
E6 forms a complex with
p53 and E6AP, an E3 ubiquitin ligase, promoting
p53 degradation via the same
pathway5455. Co-infection with C. trachomatis might
augment the action of the E6 HPV
protein by activating MDM2-dependent degradation of p53 and shift cell fate further towards transformation.Our observations with normal human cells derived from the fallopian tube, which is
not a primary site of HPV infection, further suggest that C. trachomatis
could induce severe p53
degradation even in the absence of E6. It has recently been suggested that a significant proportion
of high-grade serous ovarian cancer originates from the columnar epithelium of the
fallopian tube565758, which is readily colonized by C.
trachomatis during ascending infections. Intriguingly, p53 loss of function is a common
denominator of nearly all ovarian cancer cases59. Functional
p53 signalling is likely to
be an essential response to the cytotoxic stress triggered in the fallopian tube by
ovulation60. Chronic or recurrent infections with C.
trachomatis could interfere with this protective mechanism. Hence, our study
also lends support for a possible direct role of C. trachomatis infection in
ovarian cancer development. Although more comprehensive insight is required to
determine the mechanistic contribution of C. trachomatis to these
malignancies, the observation of p53 degradation may be considered a significant piece of the
puzzle.
Methods
Antibodies, cell lines, human tissue samples and reagents
Mouse monoclonal anti-p53 (DO-1, sc-126,
1:1,000–2,000 for immunoblotting, 1:100 for immunofluorescence) and
rabbit anti-total MDM2 (N-20, sc-813, 1:1,000
for immunoblotting, 1:100 for immunofluorescence) were purchased from Santa Cruz Biotechnology Inc.; anti-Chlamydia trachomatis
MOMP (ab20881,
1:2,000), anti-cytokeratin-8 (ab9023,
1:8,000) and anti-vimentin (ab16700, 1:2,000)
antibodies were purchased from Abcam, mouse
monoclonal anti-Chlamydia trachomatis species-specific KK-12 IgG2a, was
obtained from David Grayston (University of Washington, Seattle, WA, USA,
1:10,000), genus-specific rabbit polyclonal
anti-Chlamydia (3-090, 1:100) from Milan Analytica, mouse monoclonal anti-C. trachomatis
Hsp60 (ALX-804-072-R100,
1:8,000) from Enzo Life Sciences; rabbit monoclonal anti-cleaved PARP (Asp214, D64E10,
1:400) from Cell Signaling, mouse monoclonal anti-β-actin (AC-15,
1:4,000–16,000) from Sigma, rabbit polyclonal anti-cleaved
caspase-3 (Asp175, 9661,
1:400) and rabbit polyclonal anti-P-MDM2 (S166, 3521S, 1:1,000) were from Cell Signaling.
Secondary antibodies used for immunofluorescence and western blot analyses were
Cy3-linked anti-rabbit (711-165-152, 1:200) and anti-mouse (115-166-072, 1:200),
Cy2-linked anti-mouse (115-225-146, 1:200) and DyLight 488 anti-rabbit
(111-485-144, 1:200) from Jackson ImmunoResearch Laboratories, HP-linked ECL
anti-rabbit (NA934, 1:3,000) and HP-linked anti-mouse (NA931, 1:3,000) from
Amersham. HeLa (ATCC CCL-2) and the p53-Venus reporter MCF7 cell lines15 were
maintained in RPMI-1640 medium (52400) from Gibco-Life Technologies (52400)
supplemented with 10% fetal bovine serum (S0115, Biochrom AG). Nutlin3a was purchased from Sigma
(N6287), RITA from Calbiochem
(506149), MG132 from Sigma
(C2211) and Lactacystin from
Cayman Chemical (CAS 154226-60-5). CPAF-inhibitor peptide
(SLFYSPMVPHFWAELRNHYATSGLKRRRRRRRRR) and the scrambled
control (NFALSHFRLPLSTYKEMPYVSHWAGRRRRRRRRR) with >95%
purity were ordered from Genscript. A dose-dependent reduction in infectious
progeny and induction of cell death, as reported previously61,
was used to confirm its efficacy. RNA interference oligonucleotides siAllstars
(scrambled control) and sip53 (targeting p53,
5′-TTGGTGAACCTTAGTACCTAA-3′) were
purchased from Qiagen. Hoechst
33342 was purchased from Sigma.Human fallopian tube tissue samples were provided by the Department of
Gynaecology, Charité University Hospital, Campus Virchow Clinic,
Berlin, Germany. Scientific use of the tissue was approved by the Ethics
Commission of the Charité, Berlin (EA1/002/07) and informed consent was
obtained from all subjects. Fragments were sourced from standard surgical
procedures for benign gynaecological diseases and only anatomically normal
pieces were utilized for subsequent experiments. Primary mesenchymal cells were
prepared from these samples as described previously30 and
typically used for infection at passage numbers six to eight.
Infections with Chlamydiales
We used Chlamydia trachomatis L2 (ATCC VR-902B), Chlamydia
pneumoniae (ATCC VR-1310), Chlamydia muridarum (ATCC VR-123),
Chlamydia psittaci (02DC15) and Simkania negevensis (ATCC
VR-1471) at the indicated MOIs. Cells were infected for 2 h in normal
RPMI growth medium containing 5% fetal bovine serum, 2 mM
glutamine and
1 mM sodium
pyruvate at 35 °C. The medium was then
replaced with fresh growth medium and cells were cultured for the indicated
times at 35 °C. In addition, C. pneumoniae and C.
psittaci inocula were centrifuged at 920 × g for
30 min onto fresh cell monolayers and then further incubated under
the conditions described above.
Western immunoblotting
Cell monolayers were lysed directly with SDS lysis buffer (100 mM
Tris/HCl, pH 6.8, 4%
SDS, 20% glycerol, 0.02% bromophenol blue, 200 nM
dithiothreitol), where
indicated with 8 M urea12 or RIPA lysis buffer
(50 mM Tris/HCl pH
7.5, 1% Nonidet P-40, 0.1% SDS, 150 mM NaCl, 2 mM EDTA). RIPA lysates were incubated for 30 min on
ice. Cell lysates were boiled at 95 °C for
10 min. Equal amounts of protein were separated using
SDS–polyacrylamide gel electrophoresis and immunoblotted as described
previously62.
Time-lapse videomicroscopy
This procedure was conducted on cells seeded onto glass-bottom 35 mm
dishes (Mattek) in an environment-controlled (37 °C and 5%
CO2) system consisting of an Olympus IX81 inverted microscope
(Olympus), X-Light Multipoint Confocal Scanning Module (CrEST) with Nipkow
spinning disc, and a Hamamatsu C9100-02 CCD camera (Hamamatsu Photonics K.K).
Bright-field images were acquired with a × 63 phase contrast objective
(NA=1.25 oil, Olympus) and a high-speed shutter system. Fluorescent images were
acquired with a Lumencor SPECTRA-4 LED-based Light Engine Illumination System
with 390/18; 475/28; 549/15; 632/22 solid-state LEDs using VisiView Premier
Image acquisition Software. To examine the impact of the CPAF-specific inhibitor
peptide time-lapse videomicroscopy was conducted similarly on a Nikon Ti-E
inverted deconvolution microscope equipped with a Hamamatsu 4.0 4Mp Mono camera,
× 40/0.95 Apo DIC W.D. 0.25 mm objective, Lumencor Spectra 7
epifluorescent lamp and climate control chamber. In short, the reporter cells
were infected for 2 h (MOI=0.5), washed and incubated at
37 °C and 5% CO2 for either 12 or
24 h. Media were then replaced with media containing 0, 2.5, 5, 7.5,
10, 12.5, 15, 20, 30 μM CPAF peptide or control peptide.
Videomicroscopy was conducted from 24 h p.i. Acute cytotoxicity was
observed at CPAF inhibitor peptide concentrations
>15 μM. P53-Venus pulses were not observed in infected cells at any
of the CPAF-peptide concentrations tested but cytotoxic effects limited
recording times to between 10 and 20 h. P53 pulses were still evident in
uninfected cells cultured in the presence of the CPAF peptide. The interval
between frames was 20 min and exposure times were
<50 ms to minimize photobleaching and phototoxic effects.
Post-acquisition processing and analysis was conducted using FIJI software.
Infectious progeny assays
HeLa cells seeded in 384-well plates were infected with CTL2 as described above.
Infected cells were lysed at 48 h p.i. by adding Nonidet P40 (NP40)
at a final concentration of 0.06% per well. Pipetting steps were performed using
a robotic station (Biomek FX pipetting robot, Beckman Coulter). Lysates were
diluted in infection medium and were transferred to fresh HeLa cells at a final
dilution of 1:40. After 2 h medium was exchanged. Plates were
incubated for 24 h at 35 °C and 5% CO2
and processed for immunolabelling.
Transmission electron microscopy
Samples were fixed with 2.5% glutaraldehyde, post-fixed with 0.5% osmiumtetroxide, contrasted with 2%
uranylacetate and 0.1%
tannic acid, dehydrated
with a graded ethanol series
and epoxy resin-embedded. Ultrathin sections were contrasted with lead citrate and analysed using a Leo
906E transmission electron microscope.
Indirect immunofluorescence
This procedure was conducted as described previously62. Briefly,
cell monolayers were fixed for 25 min in 4% paraformaldehyde followed
by liberal washing with PBS. Monolayers were permeabilized for 10 min
with Triton X-100 (0.3%) in PBS, washed three times and then incubated with 2.5%
BSA in PBS as a blocking reagent. Cells were sequentially incubated for
1 h at room temperature (or overnight at 4 °C)
with primary antibodies and 1 h at room temperature with secondary
antibodies. Samples were then washed with PBS and mounted onto glass slides
using Mowiol.
Apoptosis assay
HeLa cells seeded in 384-well plates were infected with CTL2 as described in the
infectious progeny assay. Cells were treated with Nutlin3a at the indicated
concentrations from 12 h p.i. Ten hours post Nutlin3a treatment, medium was
exchanged and recombinant human TNF-α (BD Pharmingen, 554618) was added at the
indicated concentrations with
10 μg ml−1
cycloheximide (Sigma,
065K12261) together with Nutlin3a and incubated for 5 h until fixation and
immunolabelling.
Author contributions
E.G., M.R. and M.C.K. contributed equally. E.G. and M.R. conducted the western
immunoblotting for Figs 1a, 2a,b and
4d and Supplementary Figs 1,2,3 and 5, the infectious progeny assay presented in
Fig. 3a, the Simkania western immunoblotting and
immunofluorescence presented in Fig. 4d and Supplementary Fig. 5, respectively, the apoptosis
assay presented in Fig. 4e,f and Supplementary Fig. 6. M.C.K. conducted the
western immunoblotting for Fig. 1e, the live imaging presented
in Figs 1b–d and 2c and Supplementary Movies 1 to 5, conducted
the confocal imaging presented in Fig. 4a and contributed to
the analysis presented in Fig. 4b, Supplementary Fig. 4 and Supplementary Fig. 6b. M.A.Z and M.A. prepared
the immunofluorescence samples and conducted the western immunoblotting for Fig. 4a,c and d and contributed to the analysis presented in
Supplementary Fig. 6b. M.K.
contributed to the analysis presented in Fig. 4b. V.B.
conducted TEM and quantification presented in Fig. 3b,c and
Supplementary Fig. 3. A.L. and
T.F.M. triggered initiation of this study and A.L. provided the cells used for the
live imaging and assisted in the analysis of the imaging experiments. T.F.M.
supervised the project and the manuscript preparation.
Additional information
How to cite this article: González, E. et al.
Chlamydia infection depends on a functional MDM2-p53 axis. Nat. Commun. 5:5201 doi: 10.1038/ncomms6201
(2014).
Authors: Jennifer S Smith; Cristina Bosetti; Nubia Muñoz; Rolando Herrero; F Xavier Bosch; José Eluf-Neto; Chris J L M Meijer; Adriaan J C Van Den Brule; Silvia Franceschi; Rosanna W Peeling Journal: Int J Cancer Date: 2004-09-01 Impact factor: 7.396
Authors: Lyubomir T Vassilev; Binh T Vu; Bradford Graves; Daisy Carvajal; Frank Podlaski; Zoran Filipovic; Norman Kong; Ursula Kammlott; Christine Lukacs; Christian Klein; Nader Fotouhi; Emily A Liu Journal: Science Date: 2004-01-02 Impact factor: 47.728
Authors: Aasia Saleemuddin; Ann K Folkins; Leslie Garrett; Judy Garber; Michael G Muto; Christopher P Crum; Shelley Tworoger Journal: Gynecol Oncol Date: 2008-08-21 Impact factor: 5.482
Authors: Krishnaraj Rajalingam; Manu Sharma; Christine Lohmann; Monique Oswald; Oliver Thieck; Christopher J Froelich; Thomas Rudel Journal: PLoS One Date: 2008-09-01 Impact factor: 3.240
Authors: S Menon; P Timms; J A Allan; K Alexander; L Rombauts; P Horner; M Keltz; J Hocking; W M Huston Journal: Clin Microbiol Rev Date: 2015-10 Impact factor: 26.132