| Literature DB >> 25386165 |
Satoshi Ogawa1, Ishwar S Parhar1.
Abstract
Gonadotropin-inhibitory hormone (GnIH) was discovered as a novel hypothalamic peptide that inhibits gonadotropin release in the quail. The presence of GnIH-homologous peptides and its receptors (GnIHRs) have been demonstrated in various vertebrate species including teleosts, suggesting that the GnIH-GnIHR family is evolutionarily conserved. In avian and mammalian brain, GnIH neurons are localized in the hypothalamic nuclei and their neural projections are widely distributed. GnIH acts on the pituitary and gonadotropin-releasing hormone neurons to inhibit reproductive functions by decreasing gonadotropin release and synthesis. In addition, GnIH-GnIHR signaling is regulated by various factors, such as environmental cues and stress. However, the function of fish GnIH orthologs remains inconclusive because the physiological properties of fish GnIH peptides are debatable. This review summarizes the current research progress in GnIH-GnIHR signaling and their physiological functions in vertebrates with special emphasis on non-mammalian vertebrate species.Entities:
Keywords: GnRH; LPXRFa; gonadotropin; reproduction; teleosts
Year: 2014 PMID: 25386165 PMCID: PMC4208418 DOI: 10.3389/fendo.2014.00177
Source DB: PubMed Journal: Front Endocrinol (Lausanne) ISSN: 1664-2392 Impact factor: 5.555
Comparison of amino acid sequences of GnIH and its homologous peptides from jawless fish to mammals.
| Animal | Species | Name | Amino acid sequence | Distribution (mRNA or peptides) | Mode of action | Reference |
|---|---|---|---|---|---|---|
| Sea lamprey | LPXRFa-1a | SGVGQGRSSKTLF | B, T, O | ( | ||
| LPXRFa-1b | AALRSGVGQGRSSKTLF | ( | ||||
| LPXRFa-2 | SEPFWHRT | ( | ||||
| Hagfish | LPXRFa | A | ( | |||
| Goldfish | gfLPXRFa-1 | PTHLHAN | B | ( | ||
| gfLPXRFa-2 | AKSNIN | ( | ||||
| gfLPXRFa-3 | SGTGLSAT | ( | ||||
| Zebrafish | zfLPXRFa-1 | PAHLHAN | B, E, T, O, M, K, SP, G | ( | ||
| zfLPXRFa-2 | APKSTIN | ( | ||||
| zfLPXRFa-3 | SGTGPSAT | ( | ||||
| Grass Puffer | LPXRFa-1 | SLDMERINIQVSPTSGKVSLP | B, P, E, K, SP | ( | ||
| TIVRLYPPTLQPHHQHVN | ||||||
| LPXRFa-2 | DGVQGGDHVPNLNPN | ( | ||||
| Nile tilapia | LPXRFa-1 | Ac-TLLSSNDGTYSVRKQPHQETKNEIHRSLDL | B, P, T, O | ( | ||
| ESFNIRVAPTTSKFSLPTIIRFYPPTVKPLHLHAN | ||||||
| LPXRFa-2 | p-QSDERTPNSSPN | ( | ||||
| LPXRFa-3 | Ac-APNQL | ( | ||||
| Bullfrog | fGRP/R-Rfa | SLKPAAN | B | ( | ||
| fGRP-RP-1 | SIPN | ( | ||||
| fGRP-RP-2 | YLSGKTKVQSMAN | ( | ||||
| fGRP-RP-3 | AQYTNHFVHSLDT | ( | ||||
| European green frog | R-RFa | SLKPAAN | B | ( | ||
| Japanese red-bellied newt | nLPXRFa-1 | SVPN | B | ( | ||
| nLPXRFa-2 | MPHASAN | ( | ||||
| nLPXRFa-3 | SIQPLAN | ( | ||||
| nLPXRFa-4 | APSAGQFIQTLAN | ( | ||||
| Japanese Quail | GnIH | SIKPSAY | B, T, O | GnRH1 | ( | |
| GnIH-RP-1 | SLNFEEMKDWGSKNFMKVNTPTVNKVPNSVAN | ( | ||||
| GnIH-RP-2 | SSIQSLLN | ( | ||||
| Chicken | GnIH | SIRPSAY | B | ( | ||
| GnIH-RP-1 | SLNFEEMKDWGSKNFLKVNTPTVNKVPNSVAN | ( | ||||
| GnIH-RP-2 | SSIQSLLN | ( | ||||
| Gambel’s white-crowned sparrow | GnIH | SIKPFSN | B | GnRH2 | ( | |
| GnIH-RP-1 | SLNFEEMEDWGSKDIIKMNPFTASKMPNSVAN | ( | ||||
| GnIH-RP-2 | SPLVKGSSQSLLN | ( | ||||
| European starling | GnIH | SIKPFAN | B, T, O | GnRH1, GnRH2 | ( | |
| GnIH-RP-1 | SLNFDEMEDWGSKDIIKMNPFTVSKMPNSVAN | ( | ||||
| GnIH-RP-2 | GSSQSLLN | ( | ||||
| Zebra finch | GnIH | SIKPFSN | B | GnRH1 | ( | |
| GnIH-RP-1 | SLNFEEMEDWRSKDIIKMNPFAASKMPNSVAN | ( | ||||
| GnIH-RP-2 | SPLVKGSSQSLLN | ( | ||||
| Human being | RFRP-1 | MPHSFAN | B | ( | ||
| RFRP-3 | VPN | B | GnRH1 | ( | ||
| Rhesus macaque | RFRP-1 | MPHSVTN | B | ( | ||
| RFRP-3 | SGRNMEVSLVRQVLN | B | GnRH1, GnRH2, dopamine, β-endorphin | ( | ||
| Mouse | RFRP-1 | SVSFQELKDWGAKKVIKMSPAPANKVPHSAAN | B | ( | ||
| RFRP-3 | ANMEAGTRSHFPS | B | GnRH1, kisspeptin | ( | ||
| Rat | RFRP-1 | SVTFQELKDWGAKKDIKMSPAPANKVPHSAAN | B, E | ( | ||
| RFRP-3 | ANMEAGTMSHFPS | B | GnRH1, kisspeptin | ( | ||
| Syrian golden hamster | RFRP-1 | SPAPANKVPHSAAN | B | ( | ||
| RFRP-3 | TLSRVPS | B | GnRH1 | ( | ||
| Cow | RFRP-1 | SLTFEEVKDWAPKIKMNKPVVNKMPPSAAN | B | ( | ||
| RFRP-3 | AMAHLPLRLGKNREDSLSRWVPN | B, P | ( | |||
| Sheep | RFRP-1 | SLTFEEVKDWGPKIKMNTPAVNKMPPSAAN | B | ( | ||
| RFRP-3 | VMAHLPLRLGKNREDSLSRRVPN | B, P | GnRH1, NPY, POMC, orexin, MCH | ( | ||
| Pig | LPXRF-1 | SLNFEELKDWGPKNVIKMSTPVVNKMPPLAAN | B, M, O, E, K, A, U, Pg | ( | ||
| LPXRF-3 | AIASLPLRFGRNTEDSMSRPVPM | |||||
.
The identical C-terminal LPXRFamide (X = Leu or Gln) motif sequences are in bold font.
Figure 1Phylogenetic tree of GnIH and its homologous peptides sequences in vertebrates. The phylogenetic tree was constructed by MEGA 3.1 using the neighbor-joining method. The amino acid sequences analyzed for the phylogenetic tree construction are listed in Table 1.
List of GnIH receptor (GPR147) and its homologous sequences found or predicted from jawless fish to mammals.
| Animal | Species | Name | GenBank accession number | Distribution | Expression in GnRH or other neurons | Reference |
|---|---|---|---|---|---|---|
| Coelacanth | Neuropeptide FF receptor 1 | XP_005991458 | Predicted | |||
| Spotted gar | Neuropeptide FF receptor 1 like | XP_006630407 | Predicted | |||
| Goldfish | G-protein couple receptor IHR1/GnIHR1 | AFY63167 | B, P, T, O | ( | ||
| G-protein couple receptor IHR2/GnIHR2 | AFY63168 | B, P, T, O | ( | |||
| G-protein couple receptor IHR3/GnIHR3 | AFY63169 | B, P | ( | |||
| AER11372 | ||||||
| Zebrafish | GnIHR1 (neuropeptide FF receptor 1 like 1) | ADB43133 | B, P, T, M, K, SP, H, Gl, E | ( | ||
| NP_001165167 | ||||||
| GnIHR2 (neuropeptide FF receptor 1 like 2) | ADB43134 | B, T, K, SP, H, L, Gl, E | ( | |||
| NP_001165168 | ||||||
| GnIHR3 (neuropeptide FF receptor 1) | ADB43135 | B, T, O, M, K, SP, IN, H, Gl, E | ( | |||
| NP_001082858 | ||||||
| Takifugu | RFamide-related peptide receptor | BAF34887 | B, P, E, K | ( | ||
| Mexican tetra | Neuropeptide FF receptor 1 like | XP_007255089 | Predicted | |||
| Rainbow trout | Unnamed protein product | CDQ96641 | ( | |||
| Bicolor damselfish | Neuropeptide FF receptor 1 like | XP_008295983 | Predicted | |||
| Xenopus | Neuropeptide FF receptor 1 | NP_001084551 | ( | |||
| Green anole | Neuropeptide FF receptor 1 | XP_008104865 | Predicted | |||
| King cobra | Neuropeptide FF receptor 1 | ETE63534 | ( | |||
| Chinese alligator | Neuropeptide FF receptor 1 | XP_006027961 | Predicted | |||
| American alligator | Neuropeptide FF receptor 1 | XP_006265135 | Predicted | |||
| Western painted turtle | Neuropeptide FF receptor 1 like | XP_005286579 | Predicted | |||
| Green sea turtle | Neuropeptide FF receptor 1 like | XP_007053537 | Predicted | |||
| Japanese quail | GnIH receptor | BAD86818 | B, T, O | ( | ||
| European starling | GnIH receptor | EF212891 | B, P, T, O | GnRH1, GnRH2 | ( | |
| Budgerigar | Neuropeptide FF receptor 1 | XP_005154065 | Predicted | |||
| Chicken | Neuropeptide FF receptor 1 | NP_989693 | B, P, T, O | ( | ||
| BAE17050 | ||||||
| Human being | Neuropeptide FF receptor 1 | NP_071429 | B, P | ( | ||
| Mouse | Neuropeptide FF receptor 1 | NP_001170982 | GnRH, kisspeptin | ( | ||
| Rat | Neuropeptide FF receptor 1 | NP_071627 | B, E | GnRH, kisspeptin, dopamine | ( | |
| Syrian golden hamster | GPR147 | ACY39880 | B, P, T | ( | ||
| Sheep | Neuropeptide FF receptor 1 | ABW08098 | B | ( | ||
| Pig | Neuropeptide FF receptor 1 | HQ681286 | B, P, O, K, E, U, A, IN, S | ( | ||
.
Figure 2Phylogenetic tree of GnIH receptor (GPR147) and its homologous sequences in vertebrates. The phylogenetic tree was constructed by MEGA 3.1 using the neighbor-joining method. GenBank accession numbers for the sequences are listed in Table 2.
Figure 3Comparison of localization of GnIH cells and their associations with other neural systems in the brain from jawless fish, jawed fish, amphibians, birds, and mammals. In jawless fish (sea lamprey), LPXRFa-cells are localized in the bed nucleus of the tract of the postoptic commissure (nTPOC) in the hypothalamus (11). In jawed fish (goldfish, salmon, and carp), LPXRFa-immunoreactive cells are seen in the nucleus posterioris periventricularis (NPPv) (13, 48, 72). In amphibians (bullfrog and newt), LPXRFa-neurons are seen in the anterior preoptic area (POA) and/or the suprachiasmatic nucleus (SCN) (17, 18, 20, 21). In birds, the GnIH neurons are present in the PVN. In mammals and birds, GnIH neurons project to the median eminence (ME). In mammals, GnIH neurons are localized in the dorsomedial nucleus of the hypothalamus (DMH) and in the paraventricular nucleus (PVN). In jawless fish (sea lamprey), LPXRFa-immunoreactive fibers are seen in the neurohypophysis (NE), suggesting action of GnIH on the pituitary (pit) cells. In jawed fish, LPXRFa-immunoreactive fibers are present in the pituitary. In amphibians, birds, and mammals, LPXRFa/GnIH fibers are terminated in the ME. In birds and mammals, GnIH cells (black circle) associated with several other neurons such as GnRH neuron types: GnRH1 (red circle), GnRH2 (green circle), and GnRH3 (blue circle) neurons. The open circle with green indicates the presence of GnRH2 neurons only in certain mammalian species such as primates but not in rodents (73). In some mammals, GnIH fibers are also closely associated with kisspeptin neurons (yellow circle). GnIH neural functions are regulated by melatonin (Mel) derived from the pineal gland (dark blue) or eyes. In jawed and jawless fish, the effect of melatonin on GnIH neurons is still unknown, but there might be direct projection from the pineal gland to GnIH neurons in the hypothalamus (74–76). Confirmed association is indicated by the line, and unconfirmed hypothetical association is indicated by the dotted line.
Functions of GnIH and its homologous peptides from jawless fish to mammals.
| Animal | Species | GnIH types | Functions | Reference |
|---|---|---|---|---|
| Sea lamprey | LPXRFa-2 | Stimulation of GnRH-III synthesis and GTHβ mRNA expression | ( | |
| Goldfish | gfLPXRFa-1 | Stimulation of GTH and GH release | ( | |
| gfLPXRFa-2 | Stimulation of GTH and GH release | ( | ||
| Inhibition of LH and FSH synthesis | ( | |||
| gfLPXRFa-3 | Stimulation of GTH and GH release | ( | ||
| Inhibition of LH synthesis | ( | |||
| Inhibition of GnRH-elicited FSH synthesis | ( | |||
| Stimulation of GTH synthesis and release in prespawning fish | ( | |||
| Inhibition of GTH synthesis in early to later stages of gonadal recrudescence | ( | |||
| Inhibition of GnRH-elicited GTH synthesis in early and mid gonadal recrudescence | ( | |||
| Zebrafish | gfLPXRFa-3 | Inhibition of GTH release | ( | |
| Grass puffer | gfLPXRFa-1 | Stimulation of GTH synthesis | ( | |
| Nile tilapia | LPXRFa-2 | Stimulation of LH and FSH release ( | ( | |
| Bullfrog | fGRP | Stimulation of GH release | ( | |
| fGRP-RP-2 | Stimulation of GH/PRL release | ( | ||
| Japanese quail | GnIH | Inhibition of GTH synthesis and release | ( | |
| Chicken | GnIH | Inhibition of GTH synthesis and release | ( | |
| Inhibition of LH release in immature but not mature chickens | ( | |||
| Stimulation of feeding behavior | ( | |||
| GnIH-RP-1 | Stimulation of feeding behavior | ( | ||
| GnIH-RP-2 | Stimulation of feeding behavior | ( | ||
| Gambel’s white-crowned sparrow | GnIH | Inhibition of GnRH-elicited GTH release | ( | |
| Inhibition of reproductive behavior | ||||
| Song sparrows | GnIH | Inhibiting GnRH-induced LH release | ( | |
| Rufous-winged sparrow | GnIH | No effect on LH release and GnRH-elicited LH secretion | ( | |
| Human being | RFRP-1 | Stimulation of PRL release | ( | |
| Mouse | RFRP-3 | Suppressive action on the excitability of GnRH neurons | ( | |
| Rat | RFRP-1 | Stimulation of ACTH and oxytocin release | ( | |
| RFRP-3 | Stimulation of ACTH and oxytocin release | ( | ||
| Stimulation of GH secretion | ( | |||
| Inhibition of GTH release | ( | |||
| Inhibition of GnRH-elicited GTH release | ( | |||
| Inhibition of reproductive behavior | ( | |||
| Stimulation of feeding behavior | ( | |||
| No effect on basal LH secretion, but inhibition of GnRH-elicited LH release | ( | |||
| Syrian golden hamster | RFRP-1 | Inhibition of GTH release | ( | |
| RFRP-3 | Inhibition of GTH release | ( | ||
| Bovine | RFRP-3 | Inhibition of GnRH-elicited GTH release | ( | |
| Ovine | RFRP-3 | Inhibition of GnRH-elicited GTH synthesis and release | ( | |
| Reduction of the amplitude of LH pulses | ||||
Figure 4Effect of environmental actions on GnIH system and its potential functions. Environmental cues such as social stress or seasonal/diurnal change influence on GnIH neurons via hormonal mediators such as corticosterone or melatonin. GnIH neurons negatively act on GnRH-I and GnRH-II neurons, which influence on gonadotropin (LH and FSH) secretion in the pituitary and reproductive and/or food intake behaviors, respectively. In jawless and jawed fish, GnIH neurons send projection to GnRH-III neurons, which may regulate social behaviors. In mammals, GnIH neurons are also closely associated with kisspeptin neurons. However, the role of GnIH in kisspeptin neurons remains unknown.