BACKGROUND: Bacterial sortases are transpeptidases that covalently anchor surface proteins to the peptidoglycan of the Gram-positive cell wall. Sortase protein anchoring is mediated by a conserved cell wall sorting signal on the anchored protein, comprising of a C-terminal recognition sequence containing an "LPXTG-like" motif, followed by a hydrophobic domain and a positively charged tail. RESULTS: We report that Clostridium difficile strain 630 encodes a single sortase (SrtB). A FRET-based assay was used to confirm that recombinant SrtB catalyzes the cleavage of fluorescently labelled peptides containing (S/P)PXTG motifs. Strain 630 encodes seven predicted cell wall proteins with the (S/P)PXTG sorting motif, four of which are conserved across all five C. difficile lineages and include potential adhesins and cell wall hydrolases. Replacement of the predicted catalytic cysteine residue at position 209 with alanine abolishes SrtB activity, as does addition of the cysteine protease inhibitor MTSET to the reaction. Mass spectrometry reveals the cleavage site to be between the threonine and glycine residues of the (S/P)PXTG peptide. Small-molecule inhibitors identified through an in silico screen inhibit SrtB enzymatic activity to a greater degree than MTSET. CONCLUSIONS: These results demonstrate for the first time that C. difficile encodes a single sortase enzyme, which cleaves motifs containing (S/P)PXTG in-vitro. The activity of the sortase can be inhibited by mutation of a cysteine residue in the predicted active site and by small-molecule inhibitors.
BACKGROUND: Bacterial sortases are transpeptidases that covalently anchor surface proteins to the peptidoglycan of the Gram-positive cell wall. Sortase protein anchoring is mediated by a conserved cell wall sorting signal on the anchored protein, comprising of a C-terminal recognition sequence containing an "LPXTG-like" motif, followed by a hydrophobic domain and a positively charged tail. RESULTS: We report that Clostridium difficile strain 630 encodes a single sortase (SrtB). A FRET-based assay was used to confirm that recombinant SrtB catalyzes the cleavage of fluorescently labelled peptides containing (S/P)PXTG motifs. Strain 630 encodes seven predicted cell wall proteins with the (S/P)PXTG sorting motif, four of which are conserved across all five C. difficile lineages and include potential adhesins and cell wall hydrolases. Replacement of the predicted catalytic cysteine residue at position 209 with alanine abolishes SrtB activity, as does addition of the cysteine protease inhibitor MTSET to the reaction. Mass spectrometry reveals the cleavage site to be between the threonine and glycine residues of the (S/P)PXTG peptide. Small-molecule inhibitors identified through an in silico screen inhibit SrtB enzymatic activity to a greater degree than MTSET. CONCLUSIONS: These results demonstrate for the first time that C. difficile encodes a single sortase enzyme, which cleaves motifs containing (S/P)PXTG in-vitro. The activity of the sortase can be inhibited by mutation of a cysteine residue in the predicted active site and by small-molecule inhibitors.
Sortases are membrane-bound cysteine transpeptidases that anchor surface proteins to the peptidoglycan cell wall in Gram-positive bacteria. Surface proteins anchored via sortases are often essential virulence factors important in colonization and invasion, evasion of the host immune system, and nutrient acquisition. The sorting process is mediated by a conserved C-terminal cell wall sorting signal on the anchored protein, comprised of a C-terminal recognition sequence (often LPXTG, where X is any amino acid), followed closely by a hydrophobic transmembrane domain and a positively charged tail [1]. A conserved catalytic cysteine residue of the sortase cleaves the LPXTG motif of the polypeptide between the threonine and glycine residues and covalently attaches the protein to the peptidoglycan [2-6].There are six described sortase families, A-F, that share amino acid similarity [7]. All catalyze similar transpeptidation reactions, but recognize different substrate motifs and serve different functions within the cell. Class A sortases (SrtA), such as the prototypical Staphylococcus aureus Sortase A (SaSrtA), are considered housekeeping sortases as they are capable of anchoring many functionally distinct proteins to the cell wall. SaSrtA, which recognizes an LPXTG motif, is responsible for anchoring a variety of surface proteins involved in adherence and immune response evasion, and is essential for virulence in animal models [8,9]. SrtA orthologues have been found in the genomes of almost all Gram-positive bacteria [8,10-16]. Class B sortases are functionally different from class A in their substrate specificity. In S. aureus and B. anthracis, the sortase B gene (srtB) is part of an iron-regulated locus isd (iron-responsive surface determinant) responsible for heme-iron transport, and anchors the iron transporter protein, IsdC, by recognizing an NPQTN motif [17,18]. Though mutating srtB has no effect on establishing infection, SaSrtB is required for persistence of the bacterium in mice [17].Clostridium difficile, an anaerobic Gram-positive, spore-forming bacillus, is the leading cause of hospital-acquired infectious diarrhea in North America and Europe. Infection with C. difficile can result in a range of clinical presentations, from mild self-limiting diarrhea to the life-threatening pseudomembranous colitis (PMC), known collectively as C. difficile infection (CDI) [19]. MLST studies have identified that the C. difficile population structure forms at least five distinct lineages that are all associated with CDI [20-22]. Complications of severe CDI can lead to toxic megacolon, bowel perforation, sepsis and death in up to 25% of cases [23]. Broad-spectrum antibiotic usage is the greatest risk factor for development of CDI due to the consequent disruption of the intestinal microflora. Treatment of CDI with metronidazole and vancomycin can exacerbate the problem by continuing to disrupt the intestinal microflora. This leaves the patient susceptible to relapse or re-infection. Approximately one third of patients experience CDI relapse following treatment, and those who relapse have a greater risk of succumbing to the infection [23]. A current imperative is the development of therapies that selectively target C. difficile, whilst leaving the intestinal microflora intact.The C. difficile reference strain 630 encodes a single predicted sortase, CD630_27180, which has high amino-acid similarity with SrtB of S. aureus and B. anthracis [24]. A second sortase encoded within the genome is interrupted by a stop codon prior to the catalytic cysteine and is considered a pseudogene. Thus, in contrast to other Gram-positive bacteria, C. difficile appears to have only a single functional sortase. As such, a compound that inhibits the activity of C. difficile sortase could target the pathogen without disrupting the numerous Gram-negative bacteria that make up the intestinal flora.In this study, we demonstrate that the predicted sortase encoded by CD630_27180 recognizes and cleaves an (S/P)PXTG motif between the threonine and glycine residues. The cleavage of this motif is dependent on the conserved cysteine residue at position 209 in the predicted active site of the sortase. We have also identified seven putative sortase substrates, all of which contain the (S/P)PXTG motif. These substrates are conserved among the five C. difficile lineages and include potential adhesins, a 5’ nucleotidase, and cell wall hydrolases. Furthermore, we identified a number of small-molecule inhibitors by means of an in silico screen that inhibit the activity of the C. difficile SrtB.
Results
Conservation of the catalytically active residues of sortase
The genome sequence of C. difficile strain 630 previously indicated the presence of a single copy of a sortase-like protein, encoded by CD630_27180, based on the presence of the sortase catalytic motif TLXTC [24]. We performed BLAST searches (BlastP) to reveal the protein encoded by CD630_27180 shares 32% and 34% amino acid identity with SrtB from S. aureus (SaSrtB) and B. anthracis (BaSrtB), respectively. In addition to the TLXTC active site, the catalytically essential histidine (His120 in SaSrtA) and arginine (R197 in SaSrtA) residues [3,25,26] are conserved in the C. difficile SrtB. A structural prediction analysis of SrtB was performed using Phyre2 Protein Fold Recognition Server (http://www.sbg.bio.ic.ac.uk/phyre2/html/page.cgi?id=index) [27], and the resulting alignment suggests a high level of conservation between the predicted secondary structure of SrtB and the known crystal structure of the BaSrtB [28] (Figure 1). Expression of C. difficile SrtB was analysed in vitro using RT-PCR analysis on strain 630, which confirmed that CD2718 is actively transcribed during early exponential, late exponential and stationary phases (Additional file 1: Figure S1).
Figure 1
Predicted
SrtB secondary structure
A structural alignment between the known crystal structure of BaSrtB [28] and the predicted structure of C. difficile SrtB using the Phyre2 Protein Fold Recognition Server suggests a high degree of structural conservation. Top: C. difficile SrtB predicted secondary structure and sequence. Bottom: BaSrtB sequence and known structure. Arrows indicate beta sheets, and striped rectangles indicate alpha helixes. Amino acid positions relative to start position are indicated. The sortase active site signature sequence TLXTC is boxed, as are the conserved essential histidine and arginine residues.
Predicted
SrtB secondary structure
A structural alignment between the known crystal structure of BaSrtB [28] and the predicted structure of C. difficile SrtB using the Phyre2 Protein Fold Recognition Server suggests a high degree of structural conservation. Top: C. difficile SrtB predicted secondary structure and sequence. Bottom: BaSrtB sequence and known structure. Arrows indicate beta sheets, and striped rectangles indicate alpha helixes. Amino acid positions relative to start position are indicated. The sortase active site signature sequence TLXTC is boxed, as are the conserved essential histidine and arginine residues.The C. difficile population structure forms at least five distinct clonal lineages that are all associated with human infection [20-22]. To determine whether SrtB is conserved between C. difficile strains, representatives for each of the five distinct clades were chosen for analysis based on the availability of a fully annotated sequence: C. difficile strains 630 for Clade 1, R20291 and CD196 (RT027) for Clade 2 [29], M68 and CF5 (RT017) for Clade 3 [20], CD305 (RT023) for Clade 4 (unpublished, WTSI), and M120 (RT078) for Clade 5 [20]. BLAST searches of these representative strains show that srtB is conserved across all five C. difficile lineages. A second sortase-like gene in the 630 genome, classified as a pseudogene because of an in frame stop codon prior to the catalytic cysteine, is absent from the other four C. difficile lineages.
Bioinformatic prediction of sortase substrates
A bioinformatics approach was used for the preliminary identification of sortase substrate proteins in C. difficile strain 630. The predicted recognition sequence for CD630_27180 has been proposed to be (S/P)PXTG by Pallen et al. [11], and recently to also include the sequence NVQTG, found in the surface- associated collagen binding protein CbpA, by Tulli et al. [30]. Putative proteins were screened for the patterns (S/P)PXTG and NVQTG at the C-terminus [11,30]. Putative candidates were then assessed for the known features of a sortase substrate: a predicted N-terminal signal peptide sequence, and a cell wall sorting signal comprising of a potential transmembrane domain following the sortase recognition sequence, and at least two consecutive basic residues (arginine or lysine) at the C-terminus [31-33].Eight proteins satisfied our definition of a sortase substrate in strain 630 (Table 1). The newly described C. difficile collagen binding protein A, CbpA, is the only protein containing the proposed NVQTG motif [30]. The remaining proteins contained one of four observed variations of the (S/P)PXTG motif: SPKTG, PPKTG, and SPSTG and SPQTG. These predicted C. difficile sortase substrates are a diverse range of surface proteins that include putative cell wall hydrolases, putative adhesins, a collagen-binding protein, and a 5’ nucleotidase/phosphoesterase (Table 1). Transcriptional analysis performed by RT-PCR confirmed that all eight predicted substrate proteins are transcribed during growth in vitro (Additional file 1: Figure S1B-I). The eight predicted substrates are transcribed during all three growth phases examined, with the exception of CD630_25370 and CD630_32460, which do not appear to be transcribed during stationary phase. Four of these putative substrates are conserved across all five C. difficile lineages: CD630_01830, CD630_25370, CD630_27680, and CD630_28310.
Table 1
Identification of putative
SrtB substrates in strain 630
Protein
Function
C-terminal sorting signal
CD630_01830
Putative cell wall hydrolase
MIHSPSTGKTVSVTSINSSYYTARFVTAKRIL
CD630_03860
Putative cell surface protein, collagen binding protein
Putative cell surface protein, collagen binding protein
PSDSPKTGDSTNLMAFIVMLLVSGGGLAGTYLYKRRKMKKS
Bold = predicted sortase recognition sequence.
Bold and Italic = hydrophobic residues.
Italics only = positively charged residues.
Identification of putative
SrtB substrates in strain 630Bold = predicted sortase recognition sequence.Bold and Italic = hydrophobic residues.Italics only = positively charged residues.
Purified C. difficile SrtB cleaves (S/P)PXTG peptides
To determine whether C. difficile SrtB cleaves putative substrates at the predicted motifs, FRET peptides were designed based on the variations observed in the predicted (S/P)PXTG motif (Table 2). Two residues upstream of the motif were included, and two glycine residues were incorporated downstream, as this has been previously shown to improve sortase cleavage efficiency in vitro [34]. Fluorescence of the Edans fluorophore within the peptides is blocked when in close proximity to the fluorescent quencher Dabcyl [35]. When the peptide is cleaved, the Edans fluorophore is separated from Dabcyl, and a fluorescent signal is observed.
Table 2
FRET peptide details
Peptide sequence*
Description
d-IHSPSTGGG-e
Based on CD0183 sequence
d-IHGSSTPGG-e
Control for above peptide
d-SDSPKTGGG-e
Based on CD0386, CD3392 sequence
d-SDGSKTPGG-e
Control for above peptide
d-IHSPQTGGG-e
Based on CD2768 sequence
d-IHGSQTPGG-e
Control for above peptide
d-PVPPKTGGG-e
Based on CD2831 sequence
d-PVGPKTPGG-e
Control for above peptide
d-GQNVQTGGG-e
Based on CbpA sequence
d-QALPETGGG-e
SaSrtA peptide
d-NPQTN-e
SaSrtB peptide
d-IHSPSTGKT-e
Based on CD0183 sequence
d-SDSPKTGDN-e
Based on CD0386 sequence
d-IHSPQTGDV-e
Based on CD2768 sequence
d-PVPPKTGDS-e
Based on CD2831 sequence
*Where d is Dabcyl (4-([4-(dimethylamino)phenyl]azo)-benzoyl) and e is Edans (5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid).
FRET peptide details*Where d is Dabcyl (4-([4-(dimethylamino)phenyl]azo)-benzoyl) and e is Edans (5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid).The N-terminal transmembrane domain of C. difficile SrtB (residues 2–25) was replaced with a six-histidine tag (SrtBΔN26) to improve soluble protein yield. SrtBΔN26 was expressed in E. coli NiCo21(DE3) and purified by nickel affinity chromatography from cleared lysates (Figure 2). Purified SrtBΔN26 was then incubated with a FRET peptide containing the SPKTG sequence. An increase in fluorescence was observed over time, indicating that cleavage of the SPKTG peptide occurred in the presence of SrtBΔN26 over 48 hours (Figure 3). In addition to the SPKTG motif, SrtBΔN26 also cleaved peptides containing the predicted substrate sequences PPKTG, SPSTG, and SPQTG (Figure 4). SrtBΔN26 failed to cleave the scrambled peptide sequences GSKTP, GPKTP, GSSTP and GSQTP (Figure 4). Interestingly, SrtBΔN26 failed to cleave peptides containing the LPETG and NPQTN motifs of SaSrtA and SaSrtB, respectively, and also failed to cleave the proposed sortase recognition motif NVQTG found in the C. difficile collagen binding protein, CbpA [30] (Figure 4).
Figure 2
Expression and purification of SrtB
Δ
.
E. coli NiCo21(DE3) expressing SrtBΔN26, in which the N-terminal membrane anchor has been replaced with a six-histidine tag, were lysed by sonication and cleared lysates purified by nickel affinity chromatography. A. Anti-his western testing for expression of SrtBΔN26. Lane M: molecular mass marker, N: whole cell lysate of non-induced culture, I: whole cell lysate of culture induced with 1 mM IPTG. B. Coomassie-stained SDS-PAGE analysis of SrtBΔN26 purification over an imidazole gradient. Lane L: molecular mass marker, W: column wash, imidazole gradient indicated by grey triangle, arrows indicate the SrtBΔN26 protein.
Figure 3
Cleavage of SPKTG peptide by recombinant SrtB
Δ
. Purified recombinant SrtBΔN26 was incubated with a FRET peptide containing the SPKTG motif and fluorescence measured every hour for the first eight hours, and also at 24 h, 36 h, and 48 h. An increase in relative fluorescence units (arbitrary units) was observed, compared with the peptide incubated alone, indicating that SrtBΔN26 mediated cleavage of the SPKTG peptide occurred over a period of 48 hours. Error bars represent the standard error of the mean.
Figure 4
SrtB
Δ
substrate specificity. Purified recombinant SrtBΔN26 protein was incubated with a range of peptide sequences to investigate its substrate specificity. The motifs SPKTG, PPKTG, SPSTG and SPQTG were all recognized and cleaved following incubation with SrtBΔN26. The scrambled peptide sequences GSKTP, GPKTG, GSSTP, and GSQTP serve as controls for the cleavage specificity of SrtBΔN26. The sequences LPETG and NPQTN, corresponding to the motifs recognized by S. aureus sortase A and B, respectively, do not appear to be substrates for SrtBΔN26. SrtBΔN26 also failed to cleave the proposed sorting signal NVQTG from recently characterized collagen binding protein, CbpA. Bars indicate the mean, and error bars represent the standard error (**corresponds to p < 0.01).
Expression and purification of SrtB
Δ
.
E. coli NiCo21(DE3) expressing SrtBΔN26, in which the N-terminal membrane anchor has been replaced with a six-histidine tag, were lysed by sonication and cleared lysates purified by nickel affinity chromatography. A. Anti-his western testing for expression of SrtBΔN26. Lane M: molecular mass marker, N: whole cell lysate of non-induced culture, I: whole cell lysate of culture induced with 1 mM IPTG. B. Coomassie-stained SDS-PAGE analysis of SrtBΔN26 purification over an imidazole gradient. Lane L: molecular mass marker, W: column wash, imidazole gradient indicated by grey triangle, arrows indicate the SrtBΔN26 protein.Cleavage of SPKTG peptide by recombinant SrtB
Δ
. Purified recombinant SrtBΔN26 was incubated with a FRET peptide containing the SPKTG motif and fluorescence measured every hour for the first eight hours, and also at 24 h, 36 h, and 48 h. An increase in relative fluorescence units (arbitrary units) was observed, compared with the peptide incubated alone, indicating that SrtBΔN26 mediated cleavage of the SPKTG peptide occurred over a period of 48 hours. Error bars represent the standard error of the mean.SrtB
Δ
substrate specificity. Purified recombinant SrtBΔN26 protein was incubated with a range of peptide sequences to investigate its substrate specificity. The motifs SPKTG, PPKTG, SPSTG and SPQTG were all recognized and cleaved following incubation with SrtBΔN26. The scrambled peptide sequences GSKTP, GPKTG, GSSTP, and GSQTP serve as controls for the cleavage specificity of SrtBΔN26. The sequences LPETG and NPQTN, corresponding to the motifs recognized by S. aureus sortase A and B, respectively, do not appear to be substrates for SrtBΔN26. SrtBΔN26 also failed to cleave the proposed sorting signal NVQTG from recently characterized collagen binding protein, CbpA. Bars indicate the mean, and error bars represent the standard error (**corresponds to p < 0.01).
Analysis of FRET reaction
To investigate the importance of the cysteine residue in the proposed active site of C. difficile SrtB, site-directed mutagenesis was used to replace the cysteine residue at position 209 with an alanine. When the resulting mutant protein SrtBΔN26,C209A was incubated with the FRET peptides, the fluorescent signal fell below the limits of detection (Figure 5), indicating that the cysteine residue at position 209 was essential for the activity of the C. difficile SrtB. Cleavage in the FRET-based assay was also inhibited by the addition of MTSET (Figure 5), a known cysteine protease inhibitor and inhibitor of sortase function in S. aureus [36,37] and B. anthracis [15].
Figure 5
SrtB
Δ
activity requires a cysteine residue at position 209. To determine if SrtBΔN26 activity depended on the cysteine residue at position 209, a C209A substitution was made to create SrtBΔN26,C209A. This enzyme was inactive against the FRET peptides when compared with SrtBΔN26. Addition at 5 mM of the cysteine protease inhibitor, MTSET, to the reaction also eliminates activity (**corresponds to p < 0.01).
SrtB
Δ
activity requires a cysteine residue at position 209. To determine if SrtBΔN26 activity depended on the cysteine residue at position 209, a C209A substitution was made to create SrtBΔN26,C209A. This enzyme was inactive against the FRET peptides when compared with SrtBΔN26. Addition at 5 mM of the cysteine protease inhibitor, MTSET, to the reaction also eliminates activity (**corresponds to p < 0.01).The cleavage of the SPKTG, PPKTG, and SPQTG motifs was enhanced at least two-fold by the addition of the two native amino acids immediately downstream of this sequon (data not shown). Analysis of the FRET reaction with these modified peptides revealed that SrtBΔN26, cleaves these peptides between the T and G residues. MALDI analysis of d-PVPPKTGDS-e peptide incubated with SrtBΔN26 results in a peptide with a mass of 889 Da, corresponding to the fragment d-PVPPKT-OH (Figure 6, top). The peptide control, incubated without SrtBΔN26, lacked this fragment (Figure 6, bottom). Cleavage between the T and G residues for the d-SDSPKTGDN-e and d-IHSPQTGDV-e peptides was also confirmed (data not shown), indicating that C. difficile SrtB cleaves the (S/P)PXTG motif between the same residues as other functional sortases [4,15,38,39].
Figure 6
SrtB
Δ
cleaves FRET peptides between T and G residues. MALDI analysis of FRET reaction products revealed a fragment of mass 889.46, corresponding to the predicted mass of d-PVPPKT-OH (top) when d-PVPPKTGDS-e was incubated with SrtBΔN26. This fragment was absent in the mock treated peptide sample (bottom), indicating that SrtBΔN26 cleaves the d-PVPPKTGDS-e between the T and G residues.
SrtB
Δ
cleaves FRET peptides between T and G residues. MALDI analysis of FRET reaction products revealed a fragment of mass 889.46, corresponding to the predicted mass of d-PVPPKT-OH (top) when d-PVPPKTGDS-e was incubated with SrtBΔN26. This fragment was absent in the mock treated peptide sample (bottom), indicating that SrtBΔN26 cleaves the d-PVPPKTGDS-e between the T and G residues.
Kinetic measurements of SrtB activity
In order to calculate the in vitro kinetic parameters of SrtBΔN26 for the d-SDSPKTGDN-e and d-PVPPKTGDS-e peptides, we performed a kinetic analysis of the sortase-catalyzed hydrolysis reaction. Figure 7A shows the progress curves of the SrtBΔN26 catalyzed hydrolysis reactions at various d-SDSPKTGDN-e concentrations. For each progress curve, the amount of fluorescent product (after conversion from RFU to concentration) was approximately 5% of the initial substrate concentration. Within the time period analyzed, the progress curves are linear, so the steady state rate (V) was determined by fitting the data to a linear function. Figure 7B shows V plotted against the concentration of the peptide. Non-linear regression of these data fitted to a modified Michaelis-Menten equation incorporating substrate inhibition (Equation 1):
Figure 7
Kinetic parameters of SrtB
Δ
. In order to determine the in vitro kinetic parameters of SrtBΔN26 for the SPKTG and PPKTG motifs, we performed a kinetic analysis of the sortase-catalyzed hydrolysis reaction. A. Progress curves of the SrtBΔN26-catalyzed hydrolysis reactions at various concentrations of d-SDSPKTGDN-e [8 (blue ●), 10 (green ▪), 20 (red ▲), 40 (teal ▼), 80 (purple ♦), 160 (yellow ), 200 (black ★), and 240 μM (blue +). The steady state rate (V) was determined by fitting the data to a linear function. B. Plot of V against the concentration of the peptide [S]. Nonlinear regression of these data fitted to Equation 1 resulted in a K
of 74.7 ± 48.2 μM for d-SDSPKTGDN-e. SrtBΔN26 is subject to substrate inhibition at peptide concentrations > 30 μM, which is not expected to be physiologically relevant.
Kinetic parameters of SrtB
Δ
. In order to determine the in vitro kinetic parameters of SrtBΔN26 for the SPKTG and PPKTG motifs, we performed a kinetic analysis of the sortase-catalyzed hydrolysis reaction. A. Progress curves of the SrtBΔN26-catalyzed hydrolysis reactions at various concentrations of d-SDSPKTGDN-e [8 (blue ●), 10 (green ▪), 20 (red ▲), 40 (teal ▼), 80 (purple ♦), 160 (yellow ), 200 (black ★), and 240 μM (blue +). The steady state rate (V) was determined by fitting the data to a linear function. B. Plot of V against the concentration of the peptide [S]. Nonlinear regression of these data fitted to Equation 1 resulted in a K
of 74.7 ± 48.2 μM for d-SDSPKTGDN-e. SrtBΔN26 is subject to substrate inhibition at peptide concentrations > 30 μM, which is not expected to be physiologically relevant.Using SciPy 0.11.0 in Python 2.7.3, where V is the apparent maximal enzymatic velocity, K is the apparent Michaelis constant, and K is the apparent inhibitor dissociation constant for unproductive substrate binding. This resulted in a K of 74.7 ± 48.2 μM and a K of 1.1×10−3 ± 6×10−4 min−1 for d-SDSPKTGDN-e (Figure 7B). This analysis was performed for d-PVPPKTGDS-e, resulting in a K of 53.3 ± 25.6 μM and a K of 8.3×10−4 ± 3×10−4 min−1. SrtBΔN26 is subject to substrate inhibition; at peptide concentrations greater than 30 μM, the rate of SrtBΔN26 activity decreases. Substrate inhibition has previously been observed for other sortase enzymes in vitro, and is not expected to be physiologically relevant [40].
Inhibiting SrtB activity
We sought to determine whether C. difficile SrtB could be specifically targeted using small-molecule inhibitors. The published crystal structure of the B. anthracis SrtB (BaSrtB) [28] was used as a template for the selection of potential C. difficile SrtB inhibitors. These orthologous proteins show 70% identity and 90% similarity at the active site, and their differences are confined to the periphery of the active site. The proprietary LeadBuilder virtual-screening method (Domainex Ltd) was used to interrogate the PROTOCATS database of potential protease inhibitors with pharmacophoric and docking filters derived from analysis of the BaSrtB crystal structure. PROTOCATS comprises 80,000 commercially-available compounds that may form reversible transition-state-like complexes with protease enzymes. Compounds in PROTOCATS contain a carbonyl group which is activated to make a fully reversible complex with the active-site serine/cysteine group by virtue of adjacent moderately electron-withdrawing substituents, which are not leaving groups. Some examples of these functional groups are α-ketoamides and aryl ketones. Figure 8A shows one of the identified compounds docking within the active site structure of BaSrtB.
Figure 8
SrtB
Δ
activity can be inhibited by rationally designed inhibitors. The proprietary LeadBuilder virtual-screening method (Domainex Ltd) was used to screen a database of 80,000 potential protease inhibitors, PROTOCATS, with pharmacophoric and docking filters derived from analysis of the BaSrtB crystal structure [28]. A. Space filling model showing one of the hit compounds fitting into the active site of BaSrtB and interacting with the catalytic cysteine residue. B. MTSET and the hits from the virtual screen were tested in the FRET-based assay at varying concentrations to screen for inhibition of SrtBΔN26 mediated cleavage of d-PVPPKTGDS-e. The most effective compounds were LSHTM40, LSHTM50, and LSHTM52, which had IC50 values of 63.1 ± 8.8, 60.1 ± 4.7 and 44.1 ± 6.9 μM, respectively. The IC50 for MTSET was 286.7 ± 16.6 μM, indicating its inhibitory effect on SrtBΔN26 is less potent than the three identified compounds.
SrtB
Δ
activity can be inhibited by rationally designed inhibitors. The proprietary LeadBuilder virtual-screening method (Domainex Ltd) was used to screen a database of 80,000 potential protease inhibitors, PROTOCATS, with pharmacophoric and docking filters derived from analysis of the BaSrtB crystal structure [28]. A. Space filling model showing one of the hit compounds fitting into the active site of BaSrtB and interacting with the catalytic cysteine residue. B. MTSET and the hits from the virtual screen were tested in the FRET-based assay at varying concentrations to screen for inhibition of SrtBΔN26 mediated cleavage of d-PVPPKTGDS-e. The most effective compounds were LSHTM40, LSHTM50, and LSHTM52, which had IC50 values of 63.1 ± 8.8, 60.1 ± 4.7 and 44.1 ± 6.9 μM, respectively. The IC50 for MTSET was 286.7 ± 16.6 μM, indicating its inhibitory effect on SrtBΔN26 is less potent than the three identified compounds.Compounds identified in this screen as potential SrtB inhibitors were tested alongside the cysteine protease inhibitor MTSET at a range of concentrations in the FRET-based assay using the d-PVPPKTGDS-e peptide to compare IC50 values. Addition of MTSET reduced SrtBΔN26 activity to below the limits of detection at concentrations of 500 μM and greater. MTSET exhibited an IC50 of 286.7 ± 16.6 μM (Figure 8B). A panel of potential C. difficile SrtB inhibitors were screened for inhibition of SrtBΔN26 activity. The most effective of the 62 compounds were LSHTM40, LSHTM50, and LSHTM52. They had IC50 values below 100 μM (Figure 8B, Table 3), at 63.1 ± 8.8 μM, 60.1 ± 4.7 μM, and 44.1 ± 6.9 μM, respectively, showing a good efficacy against C. difficile SrtB activity.
Table 3
Structure of most effective inhibitors of SrtB
Δ
Compound
Structure
IC50
LSHTM-0040
63.1 ± 8.8 μM
LSHTM-0050
60.1 ± 4.7 μM
LSHTM-0052
44.1 ± 6.9 μM
Structure of most effective inhibitors of SrtB
Δ
Discussion
C. difficile infection is invariably associated with the disruption of the normal intestinal microflora by the administration of broad spectrum antibiotics. Thus there is a pressing need to develop therapies that selectively target C. difficile while leaving the intestinal microflora intact. The C. difficile reference strain 630 encodes a single predicted sortase, CD630_27180, which has strong amino acid similarity with SrtB of S. aureus and B. anthracis [24]. Sortase substrates frequently contribute toward pathogenesis via their involvement in attachment to specific tissues during infection [17,41-44], as well as the bacteria’s ability to evade the immune response of the host [32,36]. Sortases, although not essential for growth or viability of the organism, are often essential for virulence in Gram-positive organisms; inactivation of sortases reduces colonization in mice [8,13,44,45], and decreases adhesion and invasion in vitro [8,10,14,46,47]. Sortases and their substrates are considered promising targets for the development of new anti-infective compounds [10,14,48]. Unusually for Gram-positive bacteria, C. difficile appears to possess a single sortase enzyme that is likely to be important for the viability of the pathogen as we have been unable to construct a C. difficile strain 630 SrtB defined mutant (unpublished data). Inhibiting the C. difficile sortase could prove to be a strategy to specifically target C. difficile.In this study, we cloned, expressed and characterized the sortase encoded by CD630_27180 of C. difficile 630, a predicted class B sortase (SrtB). Sortase nomenclature is based on sequence similarity to the known classes of sortase, A-F [7]. Sortases of class B typically are involved in heme-iron uptake and tend to be expressed in operons with their substrates [17,18]. Genes encoding class A sortases are not found in proximity to their substrates, which consist of a variety of surface proteins with diverse biological functions. Several exceptions to these rules have already been described, notably a class B sortase that polymerizes pilin subunits in S. pyogenes [49], and a class E sortase from C. diphtheriae that serves a housekeeping function [50]. The potential C. difficile sortase substrates identified in this paper comprise a diverse range of surface proteins, suggesting that SrtB may serve as a housekeeping sortase in C. difficile, a function usually reserved for class A sortases.These potential sortase substrates in C. difficile strain 630 comprise of seven proteins, all containing an (S/P)PXTG motif, that are predicted to be surface localized and are conserved across C. difficile strains. Recently it was proposed that a C. difficile collagen binding protein, CbpA, may be sorted to the cell surface by sortase recognizing an NVQTG motif [30]. In this study, we developed a FRET-based assay to demonstrate that SrtB of C. difficile recognizes and cleaves the (S/P)PXTG motif between the threonine and glycine residues, and that cleavage is dependent on a single cysteine residue at position 209. SrtBΔN26 does not appear to cleave the S. aureus SrtA and SrtB motifs, LPXTG and NPQTN, respectively, nor the NVQTG motif in vitro, suggesting that CbpA from C. difficile may be attached to the cell surface by another mechanism.The FRET-based assay enabled us to determine kinetic parameters for the recombinant C. difficile SrtB. Although the catalytic activity appears low, low catalytic efficiency is observed for most sortases in vitro [40,51]. The kinetic and cleavage data we report for SrtBΔN26 is consistent with this trend. In vivo, the sorting motifs are part of a larger protein, and the transpeptidation substrates are part of a cell wall precursor or mature peptidoglycan [5,6,39]. The transpeptidation reaction has been observed in vitro for sortases from bacteria with a Lys-type peptidoglycan, where cross-linking occurs through a peptide bridge [52,53] such as S. aureus and Streptococcus species [4,40,54], but not for bacteria with Dap-type peptidoglycan such as Bacillus with direct cross-linkages through m-diaminopimelic acid [55]. The likely cell wall anchor of the C. difficile SrtB substrates is the diaminopimelic acid cross-link [56], similar to Bacillus. When transpeptidation is observed in vitro, the cleavage efficiency of sortase increases.This study revealed that recombinant SrtBΔN26 cleaves the (S/P)PXTG motifs with varying levels of efficiency, cleaving the sequences PPKTG and SPQTG with the greatest efficiency. Apparent preferential cleavage efficiency of certain substrate sequences in vitro has been observed in other sortases. For example, in B. anthracis, BaSrtA cleaves LPXTG peptides more readily than a peptide containing the sequence LPNTA [15]. The biological significance of this peptide sequence preference is unknown.Small-molecule inhibitors with activity against SrtA and SrtB have been reported that prevent cleavage of fluorescently-labelled peptide compounds by sortase in vitro [57]. These compounds inhibit cell adhesion to fibronectin, yet, they have no effect on in vitro growth. Inhibitors tested against SrtA, SrtB and SrtC in B. anthracis irreversibly modified the active cysteine residue [58]. Several compounds identified in this study had an inhibitory effect on C. difficile SrtB activity. However, these lead compounds had no direct effect on in vitro C. difficile growth (data not shown), which is consistent with observations in S. aureus [57]. Inhibition of bacterial growth is not considered vital in the development of sortase-based drug therapies. In both Staphylococcus and Bacillus, sortase inhibitors show good suitability for further development as therapeutics despite their lack of bactericidal activity. When mice challenged with S. aureus were treated with sortase inhibitor compounds, infection rates and mortality were reduced [59], despite these compounds having no effect on staphylococcal growth [57]. The use of in silico approaches such as the LeadBuilder method employed by this study to screen databases of putative small-molecule inhibitors for further analysis has been validated. Further analysis of the structural similarities between the hit compounds could lead to a refinement of SrtB inhibitor design and increased potency in vitro.
Conclusions
In conclusion, we demonstrate that C. difficile encodes a single sortase, SrtB, with in vitro activity. We have confirmed the C. difficile SrtB recognition sequence as (S/P)PXTG, and show that C. difficile SrtB cleaves the (S/P)PXTG motif within peptides between the threonine and glycine residues. The cysteine residue within the predicted active site is essential for activity of the enzyme, and the cleavage of fluorescently-labelled peptides can be inhibited by MTSET, a known cysteine protease inhibitor. SrtB inhibitors identified through our in silico screen show a greater level of efficacy then MTSET at inhibiting the protease activity of C. difficile SrtB. Such inhibitors provide a significant step in successfully identifying C. difficile SrtB inhibitor compounds, which can be further refined to enhance their efficacy, and may contribute towards the development of novel selective therapeutics against CDI.
Methods
Bacterial culture
C. difficile strain 630 [24] was cultured on Brazier’s agar (BioConnections) supplemented with 4% egg yolk (BioConnections) and 1% defibrinated horse blood (TCS Biosciences Ltd.). Liquid cultures were grown in brain heart infusion broth (Oxoid Ltd.) supplemented with 0.05% L-cysteine (BHIS broth). All media was supplemented with C. difficile antibiotic supplement (250 μg/ml D-cycloserine and 8 μg/ml cefoxitin, BioConnections). C. difficile cultures were incubated at 37°C for 24–48 hours in a Whitley MG500 anaerobic workstation (Don Whitley Scientific Ltd.).One Shot Top10® (Invitrogen) and XL-1 Blue (Agilent) Escherichia coli were used for all cloning steps, and NiCo21(DE3) E. coli (NEB) was used for the expression of recombinant proteins [60]. E. coli strains were grown at 37°C on Luria-Bertani (LB) agar (Novagen) or in LB broth (Difco). Media was supplemented with 100 μg/ml ampicillin or 50 μg/ml kanamycin as required.
Genomic DNA isolation
Genomic DNA was isolated from C. difficile strain 630 [24,61] by phenol chloroform extraction as previously described [29] and used as a template for cloning. The annotated genome sequences from C. difficile strains R20291 and CD196 (RT027) [29], M68 and CF5 (RT017) [20], M120 (RT078) [20], and CD305 (RT023) (unpublished, Wellcome Trust Sanger Institute) were used for analysis.
Identification of sortase substrates
All proteins encoded by C. difficile strain 630 [24,61] were searched for the patterns (S/P)PXTG [11] and NVQTG [30] positioned 17–45 amino acid residues from the C-terminus [31]. The resulting candidate protein list was assessed for the known features of a sortase substrate: (i) a suitable N-terminal signal peptide sequence, as predicted by SignalP 4.1 Server (http://www.cbs.dtu.dk/services/SignalP/) [62], (ii) a potential transmembrane segment following the C-terminal “LPXTG-like” sequence, as predicted by TMHMM Server v. 2.0 (http://www.cbs.dtu.dk/services/TMHMM/) [63], and (iii) at least two consecutive basic residues (arginine or lysine) at the C-terminus [31-33].
Genetic manipulation
A list of primers and plasmids used in this study can be found in Tables 4 and 5, respectively. The coding sequence for srtB (CD630_27180) was codon-optimized for expression in E. coli by Celtek Bioscience, LLC (Nashville, TN, USA). The resulting fragment was cloned into the NcoI/XhoI sites of pET28a using primers pET_3 and pET_4 to create pET28a-srtB. To improve soluble SrtB yield, the N-terminal transmembrane anchor domain (residues 2–25) was replaced with a six-histidine tag. The truncated gene srtBΔN26 was amplified from pET28a-srtB using primers pET_17 and pET_16, and cloned into the NcoI/XhoI sites of pET28a to create pET28a-srtBΔN26. The mutant protein SrtBΔN26,C209A was generated using the QuikChange Site-Directed Mutagenesis kit (Agilent) in accordance with the manufacturer’s instructions using pET28a-srtBΔN26 as a template and primers C209A and C209A_antisense. Successful construction of recombinant plasmids was confirmed by DNA sequencing using primers T7F and T7R (Source BioScience).
Codon optimized srtB, synthesized and cloned in pQE30xa
Obtained from Celtek Bioscience, LLC
pET28a
Commercial protein expression vector
Provided by Neil Fairweather
pET28a- srtB
Codon optimized srtB cloned in pET28a
This work
pET28a- srtBΔN26
srtB with residues 2–25 replaced with a six-histidine tag
This work
pET28a- srtBΔN26,C209A
Same as above, with C209A substitution
This work
Primers used in this studyPlasmids used in this study
RT-PCR analysis
Total RNA was isolated from C. difficile 630 grown in BHIS at early exponential phase (t = 3 hours, OD600 = 0.4-0.5), late exponential phase (t = 5 hours, OD600 = 0.8-0.9), and stationary phase (t = 24 hours, OD600 = 0.6-0.8) using RNAprotect Bacteria Reagent (Qiagen) and the FastRNA Pro Blue Kit (MP Biomedicals LLC., Illkirch, France) in accordance with the manufacturer’s instructions. Genomic DNA was removed from total RNA samples using TURBO DNase (Life Technologies). Equal amounts of RNA were reverse transcribed into complementary DNA (cDNA) for expression analysis. Briefly, one μg random primers (Invitrogen) and 40 units RNasin Plus RNase inhibitor (Promega) was added to one μg RNA in a final volume of 10 μl, and incubated at 65°C for 10 min followed by room temperature for 30 min. The following first-strand mixture was added for cDNA synthesis: four μl of 5x first-strand buffer (Invitrogen), two μl 0.1 M DTT (Invitrogen), two μl 10 mM dNTP mix (New England BioLabs), and 1.5 μl Superscript II (Invitrogen). The reaction mixture was incubated at 25°C for 10 minutes, 42°C for 1 h, and finally 70°C for 15 minutes. RT-PCRs were performed with gene specific primers (Additional file 2: Table S1) using cDNA as a template.
Purification of recombinant protein
Expression constructs were transformed into E. coli NiCo21(DE3) (NEB). Cultures grown at 37°C were induced for expression with 1 mM IPTG when the OD600 reached 0.6, and harvested after 5 hours. Cell pellets were resuspended in lysis buffer [1× Bugbuster (Novagen), 50 mM NaH2PO4, 300 mM NaCl, 40 mM imidazole, 1 mM DTT, 1 mg/ml lysozyme, and 25 U/ml Benzonase nuclease (Novagen) (pH 7.5)]. Lysates were sonicated on ice for 2 min (15 sec on/off) at 50% Vibra Cell™ high intensity ultrasonic processor (Jencon, Leighton Buzzard, Bedfordshire, UK) before centrifugation at 10,000 rpm for 45 min. The supernatant was passed through a 0.22 μM filter before applying to a 1 ml HisTrap HP column (GE Healthcare), pre-equilibrated with buffer (50 mM NaH2PO4, 300 mM NaCl, 40 mM imidazole, 1 mM DTT, pH 7.5). SrtBΔN26 was eluted with an imidazole gradient (40 – 500 mM) over 25 column volumes. Fractions containing SrtBΔN26 (as identified by SDS-PAGE) were pooled and injected onto a HiLoad 16/60 Superdex 200 column (GE Healthcare) pre-equilibrated with buffer F (5 mM CaCl2, 50 mM Tris–HCl (pH 7.5), 150 mM NaCl, 1 mM DTT). Eluted fractions containing SrtBΔN26 were pooled and concentrated using an Amicon Ultra-15 (10 kDa) centrifuge filter unit (Millipore). Protein samples were quantified using Bradford reagent (Thermo Scientific) and analyzed by SDS-PAGE. The mutant protein SrtBΔN26,C209A was expressed and purified following the above method. Expression of SrtBΔN26 and SrtBΔN26,C209A was confirmed by MALDI fingerprinting.
Immunoblotting
Samples were resolved on Novex NuPage 10% Bis-Tris SDS-PAGE gels (Invitrogen) before transferring to Hybond-C Extra nitrocellulose (GE Healthcare). Membranes were probed with rabbit antiserum directed against 6xHis-tag (1:5000, Abcam), followed by goat anti-rabbit IRDye conjugated secondary antibody (1:7500, LI-COR Biotechnology). Blots were visualized using an Odyssey near-infrared imager (LI-COR Biotechnology).
In vitro analysis of sortase activity
SrtBΔN26 activity was monitored using a fluorescence resonance energy transfer (FRET) assay [58] in buffer F (5 mM CaCl2, 50 mM Tris–HCl (pH 7.5), 150 mM NaCl, and 1 mM DTT). Fluorescently self-quenched peptides tagged with 5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid (Edans) as a fluorophore and 4-([4-(Dimethylamino)phenyl]azo)benzoic acid (Dabcyl) as a quencher [35], and containing the predicted sorting signals of SrtB were purchased from Protein Peptide Research Ltd and solubilized in DMSO (Table 2). The FRET-based assay was performed in a final volume of 100 μl buffer F containing 10 μM SrtBΔN26 and 20 μM fluorogenic peptide in clear-bottomed, black polystyrene 384-well plates (Nunc). Plates were incubated for 48 hours at 37°C, during which fluorescence (excitation = 340 nm, emission = 490 nm) was measured using a SpectraMax M3 plate reader (Molecular Devices). Five mM 2-(trimethylamonium)ethylmethanethiosulfonate (MTSET, Affymetrix) was added to the reaction as indicated. Each experiment was performed in triplicate with a minimum of three biological replicates, and the results are presented as the means and the standard error of the data obtained. The two-tailed Student’s T-test was used to analyze the data. MALDI analysis of FRET reaction samples was performed by the Protein and Nucleic Acid Chemistry Facility (University of Cambridge) to determine exact cleavage site within each peptide.
Kinetic measurements
Kinetic data for SrtBΔN26 were obtained by incubating varying concentrations of peptide (8, 10, 20, 40, 80, 160, 200 and 240 μM) with 10 μM SrtBΔN26. All reactions were performed as described above, with fluorescence monitored every ten minutes over a 13 hour period. To correlate fluorescence signal, expressed as arbitrary relative fluorescence units (RFU), with the concentration of product formed, standard curves of the fluorophore Edans were collected. The linear segment of the fluorophore standard curve generated a conversion ratio of 703.9 RFU/ μM Edans. Initial velocities (V) were determined from the progress curves and plotted against substrate concentration [S]. The data were fitted to a modified version of the Michaelis-Menten equation incorporating substrate inhibition using SciPy 0.11.0 in Python 2.7.3, where V is the maximal enzymatic velocity, K is the Michaelis constant, and K is the inhibitor dissociation constant for unproductive substrate binding. All data points were collected in triplicate, and the overall assay was run in duplicate.
Identification of SrtB inhibitors
The proprietary LeadBuilder virtual screening method (Domainex, Ltd) was used to interrogate a database (PROTOCATS) of 80,000 potential compounds which had been pre-selected as protease inhibitors. The virtual screening protocol used pharmacophoric and docking filters derived from analysis of the BaSrtB crystal structure (with which the C. difficile SrtB shows 70% identity and 90% similarity at the active site). Sixty-two compounds identified in this screen as potential SrtB inhibitors were obtained from Enamine, ChemBridge, and Key Organics, and solubilized in DMSO. Selected compounds and MTSET were incubated with 10 μM SrtBΔN26 at a range of concentrations in the FRET-based assay conditions described above, so that final DMSO concentrations were ≤ 3.75%, a concentration shown to have no significant effect on control fluorescence (data not shown). IC50 values were determined by non-linear least squares fit to a four parameter sigmoidal function using SciPy 0.11.0 in Python 2.7.3.
Authors: Stephan Pritz; Yvonne Wolf; Oliver Kraetke; Jana Klose; Michael Bienert; Michael Beyermann Journal: J Org Chem Date: 2007-04-14 Impact factor: 4.354
Authors: Paul R Race; Matthew L Bentley; Jeff A Melvin; Allister Crow; Richard K Hughes; Wendy D Smith; Richard B Sessions; Michael A Kehoe; Dewey G McCafferty; Mark J Banfield Journal: J Biol Chem Date: 2009-01-06 Impact factor: 5.157
Authors: Marc Monot; Caroline Boursaux-Eude; Marie Thibonnier; David Vallenet; Ivan Moszer; Claudine Medigue; Isabelle Martin-Verstraete; Bruno Dupuy Journal: J Med Microbiol Date: 2011-02-24 Impact factor: 2.472
Authors: Lorenza Tulli; Sara Marchi; Roberto Petracca; Helen Alexandra Shaw; Neil F Fairweather; Maria Scarselli; Marco Soriani; Rosanna Leuzzi Journal: Cell Microbiol Date: 2013-04-11 Impact factor: 3.715
Authors: Oleg I Klychnikov; Tatiana M Shamorkina; Stephen D Weeks; Hans C van Leeuwen; Jeroen Corver; Jan W Drijfhout; Peter A van Veelen; Nikolai N Sluchanko; Sergei V Strelkov; Paul J Hensbergen Journal: J Biol Chem Date: 2018-05-23 Impact factor: 5.157
Authors: Lisa F Dawson; Johann Peltier; Catherine L Hall; Mark A Harrison; Maria Derakhshan; Helen A Shaw; Neil F Fairweather; Brendan W Wren Journal: Sci Rep Date: 2021-02-05 Impact factor: 4.379
Authors: Johann Peltier; Helen A Shaw; Edward C Couchman; Lisa F Dawson; Lu Yu; Jyoti S Choudhary; Volkhard Kaever; Brendan W Wren; Neil F Fairweather Journal: J Biol Chem Date: 2015-08-17 Impact factor: 5.157