An overview of Brevinin superfamily: structure, function and clinical perspectives.

Antimicrobial peptides are the backbone of first-line defense against various microorganisms in the animal kingdom. Thus, not surprisingly, they are gaining attention in the science and medical fields as a rich repository of new pro-drugs. Below, we focus our attention on the Brevinin family of anuran peptides. While most of them show strong antibacterial activities, some, e.g. Brevinin-2R, appear to be promising anticancer molecules, exhibiting better a therapeutic window than widely-use anticancer drugs like doxorubicin. We briefly introduce the field, followed by highlighting the promising therapeutic properties of Brevinins. Next, we provide information about the cloning and phylogenetic aspects of Brevinin genes. In the final paragraphs of this chapter, we discuss possible large-scale production methods of Brevinins, giving examples of some systems that are already in use. Towards the end, we discuss various means of modification of biologic properties of Brevinins, either by chemical modifications or by amino acid substitution and sequence rearrangements. In this context, also other unique properties of Brevinins are briefly mentioned. Finally, we discuss the future of the Brevinin field, particularly highlighting yet to be answered biologic questions, like for example presumed anti-viral and antitumor activities of Brevinin family members.

Introduction

The discovery of new therapeutic tools is one of the priority areas of biomedical scientific research. Billions of US dollars are spent on the search and development of new medicines every year. Pharmaceutical companies spend an average of $4 billion on the placing of one new drug unit in the market. In some cases, the cost reaches $11 billion (Sources: InnoThink Center for Research in Biomedical Innovation and Thomson Reuters Fundamentals via FactSet Research Systems).

Protection mechanisms of multicellular organisms from an aggressive environment, including bacterial and viral pathogens, have been evolving and improving for millions of years. That is why animal- and plant-derived materials have remained the main sources of leads for new drug development. Plants are the most popular source for searching of new biologically active compounds. Thus, the animal kingdom is actively “mined” for new generations of potentially more effective therapeutics [1].

Members of the Ranidae family of amphibians reside in a wide range of habitats (from tropical to subarctic regions) [2]. The ability of amphibians to survive in such different conditions may be attributed to the evolution of many different morphological, physiological, biochemical and behavioral adaptations. Like for other species, skin is one of the most important organs for amphibians, as it fulfills many functions such as i) respiration, (ii) water regulation and (iii) defense (barrier). Glands are major functional components of the skin of amphibians. Three types of glands are widely distributed in amphibians’ skin: mucus glands, granular glands and the tubulosaccular or alveolar glands [1]. Mucus glands help to maintain a moisture and slippery skin surface. Granular glands are the place of a wide range of chemical compounds synthesis. Their secretions have a protective function against bacterial and fungal infection as well as predators [3]. Main types of amphibian skin biologically active compounds are: biogenic amines, bufodienolides (bufogenines and bufotoxins = steroids), alkaloids, peptides and proteins [4, 5].

Amphibian skin, especially granular gland secretions, is a rich source of novel therapeutic agents such as antimicrobial peptides (AMPs), polypeptides and proteins. An important event in this area was the discovery of magainins peptides isolated from the skin of Xenopus laevis [6]. Magainins exhibit broad-spectrum antimicrobial activity, inhibiting the growth of both Gram positive and Gram negative bacteria, Candida albicans, Cryptococcus neoformansand, Saccharomyces cerevisiae and also demonstrated to induce lysis in several protozoan species [6]. Those discoveries stimulated great interest in amphibian skin peptides [7, 8]. These peptides are stored in granular glands, which are localized mostly in the skin of dorsal area and are surrounded by myocytes and innervated by sympathetic fibers [9, 10]. Adrenergic stimulation of myocytes leads to compression of serous cells, which discharge their contents by a holocrine-like mechanism. As a result, secretions contain not only antimicrobial peptides and other biologically-active agents, but also cytosolic components and cells’ genetic material [11]. The main advantage of using amphibian skin as the object of investigation is the use of gentle methods (e.g. skin stimulation by norepinephrine [12] or gentle electrical stimulation [13] for sample preparation. Hence, there is no need to harm or kill animals for this work.

The ranid frogs synthesize and secrete multiple active components. Skin secretions of the R. palustris contain at least 22 antimicrobial peptides [14]. On the basis of amino acid sequence similarity, antimicrobial peptides from ranid frogs may be divided into 14 families: Brevinin-1, Brevinin-2, Esculentin-1, Esculentin-2, Japonicin-1, Japonicin-2, Nigrocin-2, Palustrin-1, Palustrin-2, Ranacyclin, Ranalexin, Ranateurin-1, Ranateurin-2, and Temporin [15]. In this chapter, we use the modified Simmaco nomenclature [10]. Peptides belonging to a species are named by the initial letter in capitals (or more than one letter in case of uncertainty) of the species to indicate their origin. Lower case letters are used to designate isoforms, e.g. Brevinin-1Ea and Brevinin-1Eb from R. sculenta [15]. In 2012, a new nomenclature for amphibian skin peptides was proposed [16].

Brevinins are among the most ubiquitous antibacterial peptides, which consist of two families: Brevinin-1 (approximately length of 24 residues) and Brevinin-2 (approximately length of 33–34 residues). The first members (and protoplasts) of the Brevinin superfamily peptides were discovered in 1992. They were isolated from Rana brevipoda porsa and called Brevinin-1 (FLPVLAGIAAKVVPALFCKITKKC) and Brevinin-2 (GLLDSLKGFAATAGKGVLQSLLSTASCKLAKTC), respectively. These proteins demonstrated microbicidal activity against a wide range of Gram-positive, Gram-negative bacteria and strains of pathogenic fungi [17]. Since that time about 350 types of Brevinins have been discovered (according to DADP database [18]. Skin secretions of the marsh frog Rana ridibunda exhibited significant healing effects on wound treatment process [19]. Furthermore, the antibacterial properties of two peptides named Temporin-Ra and Temporin-Rb isolated from the aforementioned frog species have justified the potential therapeutic application of AMPs [20].

Specimens of the Brevinin superfamily share some common features. These peptides are linear, amphipathic and cationic. Most of them have a C-terminal disulfide-bridged cyclic heptapeptide (Cys18-(Xaa)4-Lys-Cys24), also called «Rana box» [21]. This sequence was thought to play a crucial role for antibacterial activity of those peptides. However, this hypothesis was refuted after discovery of C-terminal truncated Brevinin-1 and Brevinin-2 family peptides from Rana okinavana [22] and R. septentrionalis, respectively [23]. Those peptides did not have the characteristic C-terminal cyclic heptapeptide domain, but instead contained a C-terminally-amidated residue [22, 23].

The amino acid sequence of Brevinin-1 is poorly conserved across species and has four invariant residues (Ala9, Cys18, Lys23, Cys24) [24]. Pro14 is often present in Brevinin-1 peptides, and it was shown that this residue produces a stable kink in the molecule [25]. Functional activities of antibacterial peptides are largely determined by their structural features. The presence of cationic amino acids facilitates the interaction of Brevinins with the anionic phospholipids of the bacterial membranes and with negatively charged eukaryotic cell membranes (cancer cells, erythrocytes). In aqueous solution, Brevinin-1 exists predominantly as a random coil but adopts an amphipathic α-helical structure in hydrophobic membrane-mimetic environment such as 50 % trifluoroethanol [26]. It has been postulated that the α-helical structure in such an environment leads to perturbation of the phospholipid bilayer of targeted membranes. Such membrane function disturbances lead to growth inhibition or death of the targeted microorganisms. This hypothesis correlates with experimental results performed with synthetic D-amino acids peptides [27]. Biological activity of such analogs were similar to their corresponding native peptides, so a mechanism based on an interaction with chiral binding sites of receptors, enzymes, or other membrane proteins can be ruled out. The number and distribution of positive charges could be the cause of selectivity for some of these peptides to bacterial membranes [9]. Two main mechanisms of amphipathica-helical peptides interactions with membranes were suggested: the “barrel-stave” (Fig. 10.1a) and the “carpet-like” models (Fig. 10.1b) [28, 29]. The primary structure of Brevinin-2 is also poorly conserved with the invariant amino acid residues in the peptide being Lys7, Cys27, Lys28, Cys33 [23].

Fig. 10.1

Three basic models of Brevinins’ antimicrobial and antibacterial activity, based on their mode of interaction with cellular membranes. The channel (barrel-stave) model (a) suggests that antimicrobial peptides form a typical pore. Inner/channel side of such pores would be made of polar residues (blue) of the peptides, whereas the hydrophobic ones (yellow) are in contact with the membrane phospholipids. The “carpet-like” model (b), predicts that peptides accumulate massively at the membrane interphase. Such sequestration of the membrane would lead to the disruption of the membrane integrity. The “two-states” (toroidal) model (c) could be interpreted as a variant of the “carpet-like” model, however with a different final outcome. The massive peptide accumulation creates mechanical tension. To relieve that tension, some peptides are forced to adopt a transmembrane orientation, forming a mixed phospholipid-peptide pore spanning the membrane. In a further step, the pore undergoes a stochastic disruption (loses its wall-integrity,with relocation of the monomers at both sides of the membrane), and thus membrane destabilization leading to the loss of its integrity

Gene Organization and cDNA Cloning

A similar structural organization is being observed in biosynthetic precursors of AMPs including a signal peptide strongly conserved among different AMP families, an intervening region enriched with aspartic and glutamic residues, and an AMP region at the C-terminus [30]. While being well conserved among the members of an AMP family in different frog species, the intervening sequence regions represent considerable variation among peptides of different AMP families. Sequence hyper-variability is observed in the C-terminal AMP coding regions not only in peptides of different families but also in peptides belonging to the same AMP family [31].

Studies on frog skin secretion revealed a huge structural diversity of the antimicrobial peptides from ranid frogs. Using neighbor joining method it was found that peptides from the closely related species segregate together, forming different clades. This suggests that these peptides formed as a consequence of relatively recent gene duplication events after the species diverged from each other. For example, it was found that R. sphenocephala was morphologically and genetically classified as being a close relative of R. pipens. Brevinin-1Sc is found in the R. pipiens clade, but other Brevinin-1Sa and-1Sb are found in the R. berlandieri clade, which suggested unknown phylogenetical relationships [24].

Nowadays, by the use of cDNA cloning technology, the precursors of several AMPs belonging to the Brevinin family have been studied. Protein sequence analysis of cloned cDNA led to the identification of the peptides. On the other hand, the deduced amino acid sequences can then be used as a guide for reverse-phase-chromatography purification of the individual peptides and their amino acid sequences can be uncovered by mass-spectrometry.

Through ‘shotgun’ cloning, AMPs such as Brevinin-1P, Brevinin-1S and Brevinin-1V have been identified from three species of Chinese frogs, including Odorrana schmackeri, Odorrana versabilis and Pelophylax plancyi fukienensis [32]. Wang and colleagues reported the deduced sequences of Brevinin-1LT1 and Brevinin-1LT2 from the skin of Hylarana latouchii using molecular cloning technique. Precursors of Brevinin-1RTa, Brevinin-1RTb, Brevinin-1RTc, Brevinin-2RTa, and Brevinin-2RTb have been identified from the skin-derived cDNA library of Amolops ricketti [33]. After isolating AMPs from skin secretion/extract of amphibians, a number of investigators have been interested in analyzing the expression of dermal peptides using semi-quantitative RT-PCR system. Ohnuma and Conlon have investigated the differential expression of some AMPs such as Preprobrevinin-2 in developing larvae and adult tissues of Rana ornativentris, which highlighted that the expression of amphibian AMP genes is correlated with metamorphosis but is subjected to differential regulation [34].

The Recombinant Expression of AMPs

Large quantities of AMPs are needed to meet the requirement for studies in basic science as well as clinical trials. Procuring the peptides from natural sources and chemical syntheses are not cost-effective. The most attractive tool for large-scale production of antimicrobial peptides is the recombinant approach.

Various AMPs belonging to different families and their cDNAs have been cloned. A prokaryotic expression system such as Escherichia coli is commonly applied. AMPs are expressed in E. coli as fusion proteins to protect the bacterial host from the lethal effect of AMP and the peptide from proteolytic degradation. Several major fusion-protein systems for the expression of AMPs in E. coli have been reported which are summarized here:A few peptides of the Brevinin family have been purified through the thioredoxin fusion system so far. The synthetic gene of Brevinin-2R has been also cloned into the pET32a (+) vector to allow the expression of Brevinin-2R as a Trx fusion protein in E. coli [39]. Brevinin-2GU, an antimicrobial peptide isolated from skin secretion of the Asian frog Hylarana guntheri possesses insulin-releasing activity. The coding sequence of Brevinin-2GU gene has been expressed using pET32a (+) vector as a Trx fusion protein in E. coli to produce over a 45 % yield of the total cell proteins. After purifying the soluble fusion protein by Ni2+-chelating chromatography, the fusion partner was cleaved by Factor Xa protease to release mature Brevinin-2GU [40].

Thioredoxin as a low-molecular weight protein (~12 kDa) has been frequently exploited as carrier protein of antimicrobial peptides. This protein exhibits a chaperon activity that can promote the expression of recombinant peptides in E. coli.

GST (glutathione S-transferase) is a commonly used carrier protein for fusion expression of antimicrobial peptides in E. coli. GST fusion proteins can be quickly purified from crude lysate by glutathione-affinity chromatography. The commercial GST-fusion plasmids usually contain a specific protease recognition site releasing the desired peptide from the fusion protein. Due to the relatively large size (~26 kDa) of GST, the efficiency of the system decreases and makes the fusion highly susceptible to proteolytic degradation as well.

PurF fusion, the protein fragment containing the N-terminal 152 amino acids of PurF (amidophosphoribosyltransferase) is widely used as a carrier for the expression of antimicrobial peptides. Insoluble expression of AMP PurF fusions can not only protect the host cell from the peptides’ intrinsic toxic effects but also effectively protect the peptides from proteolytic digestion. The inclusion bodies of PurF fusions can be easily removed from the cell lysate by centrifugation.

Inteins chitin-binding domain: upon applying intein system, the usage of exogenous proteases or chemicals is eliminated to remove the carrier protein. Consequently, the downstream process of expression is simplified, and the target protein can be obtained at high purity in a one-step purification employing a single column.

Npro fusion technology, which benefits from autoproteolytic function of N-terminal autoprotease, while Npro is originally extracted from classical swine fever virus (CSFV). The target protein/peptide is fused to the C-terminus of Npro and is expressed in inclusion bodies in E. coli. The expressed fusion protein must be dissolved under chaotropic condition. Upon switching to cosmotropic in vitro refolding conditions, the fused partner with an authentic N-terminus is released from the C-terminal end of the autoprotease by self-cleavage. A special Npro mutant called EDDIE has been designed for preparative application, which possesses a better solubility and cleavage rates [35-38].

Anti-pathogen Activity of Brevinins

All peptides belonging to the Brevinin superfamily show high potency against a wide range of Gram-positive and Gram-negative bacteria, and against strains of pathogenic fungi (Table 10.1). Also, it was found that a carboxamidomethylated linearized derivative of Brevinin-1 (CAM-Brevinin) displayed antiviral activity against HSV-1M (35.0 ± 2.8 % protection; ID50 could not be determined; c = 100 mg/ml) and against HSV-2G (71.6 ± 1.8 % protection; ID50 = 75 mg/ml) [41].

Table 10.1

Sequences and minimal inhibitory concentrations (MICs) of peptides isolated from different Rana species

MIC (minimal inhibitory concentration), μM
Origin	Name	Sequence	S. aureus	E. coli	C. albicans	Source
Rana esculenta	brevinin-1E	FLPLLAGLAANFLPKIFCKITRKC	0.6	1.8	NAa	[10]
	brevinin-2E	GIMDTLKNLAKTAGKGALQSLLNK-ASCKLSGQC	2	0>5	NA
Rana luteiventris	Brevinin-1Lb	FLPMLAGLAASMVPKFVCLITKKC	8	16	NDb	[60]
Rana berlandieri	Brevinin-1Ba	FLPFIAGMAAKFLPKIFCAISKKC	2	ND	ND	[60]
	Brevinin-1Bb	FLPAIAGMAAKFLPKIFCAISKKC	1	3	10
Rana pipiens	Brevinin-1Pa	FLPIIAGVAAKVFPKIFCAISKKC	7	14	5	[60]
	Brevinin-1Pb	FLPIIAGIAAKVFPKIFCAISKKC	5	14	7
	Brevinin-1Pc	FLPIIASVAAKVFSKIFCAISKKC	7	5	7
	Brevinin-1Pd	FLPIIASVAANVFSKIFCAISKKC	27	78	29
Rana pirica	Brevinin-2PRa	GLMSLFKGVLKTAGKHIFKNVGGSLLD-QAKCKITGEC	25	6	NA	[61]
Hylarana guntheri	brevinin-2GUb	GVIIDTLKGAAKTVAAELLRKAHCKLTNSC	64	32	64	[49]

anot attested

bnot determined

Unfortunately most Brevinins, perhaps with the exception of Brevinin-2R, have strong hemolytic properties that impede their application as antimicrobial agents. However, some experiments indicate that this negative effect could be decreased by certain structural modifications. It was shown, for example, that transposition of brevinin-1E (FLPLLAGLAANFLPKIFCKITRKC), which was isolated from the skin secretion of Rana Esculenta, C-terminal sequence CKITRKC to central position (FLPLLAGLCKITRKCAANFLPKIF) leads to considerable reduction of its hemolytic activity without loss of antibacterial activity [42]. Replacement of Leu18 to Lys in the Brevinin-2-related peptide GIWDTIKSMGKVFAGKILQNL-NH2 from Lithobates septentrionalis resulted in a higher level of erythrocyte integrity. It was also shown that the analogs of GIWDTIKSMGKVFAGKILQNL-NH2: (Lys4, Lys18) and (Lys4, Ala16, Lys18) retained activity against Acinetobacter baumannii (MIC = 3–6 μM) and had very low hemolytic activity (LC50 > 200 μM) [43]. Structure–activity studies also revealed that a linear acetamidomethylcysteinyl analog of Brevinin-1E had appreciably less hemolytic activity in comparison with the native peptide [26].

Effect of Brevinins on Cytokine Release

Activation of innate immunity system results in the stimulation pro-inflammatory cytokines release, including interferon-γ (IFN-γ), tumor necrosis factor-alpha (TNF), and interleukin (IL)-8 by mononuclear cells via Toll-like receptor-2 (TLR-2) pathway [44]. The effect of two AMPs belonging to the Brevinin family (Brevinin-2GU, and B2RP-ERa) on the release of pro-inflammatory and anti-inflammatory cytokines from peripheral blood mononuclear cells (PBM) have been assessed in the presence of 1 and 20 μg/ml of AMPs. Brevinin-2GU, and B2RP-ERa significantly reduced release of TNF from concanavalin A (ConA)-stimulated PBM cells while Brevinin-2GU reduced IFN-γ release from unstimulated PBM cells [44]. On the other hand, secretion of the anti-inflammatory cytokines including TGF-β, IL-4, and IL-10 from both control- and ConA-treated PBM cells was significantly increased by B2RP-ERa [44]. The potent activities of AMPs in the regulation of anti-inflammatory cytokines release suggest a possible therapeutic role of these peptides.

Anticancer Activity of Brevinins

A unique peptide Brevinin-2R (KLKNFAKGVAQSLLNKASCKLSGQC) was isolated from Rana ridibunda. This peptide consists of 25 amino acids and has strong homology with Brevinin-2Ej and -2Ee. The antimicrobial spectrum of Brevinin-2R displayed activities against: S. aureus, M. luteus, Bacillus spKR-8104, E. coli, S. typhimurium, P. aeruginosa, K. pneumonidae and fungi, such as C. albicans and C. tropicalis. The most important property of Brevinin-2R peptide is low hemolytic activity (no more than 2.5 % of dead cells at up to 200 μg/ml of the peptide) [45]. This fact allowed the researchers to consider Brevinin-2R as a new potential therapeutic agent. Brevinin-2R kills different tumor cells (Jurkat, BJAB, MCF-7, L929, A549) at 1–10 μg/ml concentration, and exerts higher cytotoxicity in comparison with commercial doxorubicin and cisplatin drugs (P < 0.0001). In experiments with normal cell lines (CD3+ T cells from human donor and lung fibroblast), the level of cytotoxicity was approximately two times lower [45]. Brevinin-2 kills cells in a caspase-independent manner, implying cell death mechanisms other than classical apoptosis. After treatment with Brevinin-2R, a decrease of both the mitochondrial membrane potential (ΔΨm) and the ATP level was observed [45].

The main mechanism of its anticancer action is most likely the same as for pathogens namely the modification of membrane properties, especially membrane permeability. Brevinins preferentially interact with cancer cells because the outer membrane surface of these cells has an additional negative charge due to the presence of higher levels of O-glycosylated mucines [46], negatively charged phosphatidylserines [47] or higher number of microvilli, which leads to increasing of membrane surface area [48]. Also it was found that Brevinin-2R interacts with the lysosomal compartment, initiating lysosomal damage and cathepsin leakage into the cytosol, which leads to cell damage. These data suggest that Brevinin-2R-induced cell death also involves autophagy processes [45].

Other Activities of Brevinins

Experiments carried out on the rat BRIN-BD11 clonal β-cell line revealed a novel activity of several Brevinins: the stimulation of insulin release. This new function may give an additional protection for frogs by stimulating insulin secretion and causing hypoglycemia in attacking predators [13]. Examples of such insulin-releasing peptides belonging to the Brevinin family include: Brevinin-2GUb from Hylarana güntheri [49], Brevinin-2-related peptide (B2RP) from Lithobates septentrionalis [50], Brevinin-1 peptides from Lithobates palustris [13], Pelophylax saharicus [51] and Glandirana emeljanovi frog (insulin releasing stimulatory effect was shown on RINm5F insulinoma derived cells) [52].

Brevinin-1CBb (FLPFIARLAAKVFPSIICSVTKKC) provided a significant (p < 0.05) stimulation of insulin release (269 % of basal rate at a concentration of 1 μM with a maximum response of 285 % of basal rate at a concentration of 3 μM) from BRIN-BD11 clonal β-cells [12]. At the same condition, B2RP (Brevinin-2-related peptide GIWDTIKSMGKVFAGKILQNL-NH2) showed 148 % of basal rate at a concentration of 1 μM with a maximum response of 222 % of basal rate at a concentration of 3 μM [50]. These values were comparable to those produced by insulinotropic peptides, GLP-1 and GIP (under the same experimental conditions). Unfortunately, however, the peptides were cytotoxic at the tested concentrations [53]. Also, it was shown that increasing the cationicity of B2RP (Asp4 → Lys) enhanced the insulin-releasing potency (137 % of basal rate at a concentration of 0.3 μM; p < 0.05), while increasing amphipathicity and hydrophobicity showed reduced insulin-releasing potency of analog [50]. Those proteins might represent promising candidates for the development of therapeutically valuable agents for the treatment of patients with type 2 diabetes. Most investigators assumed that stimulation of insulin release was caused not only by the capacity of Brevinins to destabilize cell membranes but rather via other, as yet unidentified, mechanisms.

About 2,000 biologically active anuran peptides have been found and characterized (according to DADP database [18]). Due to the high sequence variability and a wide range of functional activities, these proteins constituted a strong basis for theoretical and experimental research leading to the design of new biologically active peptides and peptidomimetica.

Functionalization of Nanostructures with Peptides

Functionalization of nanostructures with various biomolecules including DNA, Herceptin, carbohydrates, lipids, peptides and proteins has multiple potential applications in biomedical imaging, clinical diagnosis, antimicrobial therapy, drug delivery and cancer treatment [54]. Several researches have been developing/discovering novel effective antimicrobial reagents to fight the increase of antibiotic-resistant in microorganisms [55]. Liu and colleagues introduced core-shell nanoparticles formed by self-assembly of amphiphilic peptide with potential antimicrobial activity against a broad spectrum of pathogens including bacteria and fungi [56]. Peptides, particularly cationic peptides, belonging to the Brevinin family represented antimicrobial effect against several multi-drug resistant microorganisms [45]. Recent reports clearly demonstrated that peptide-functionalized nanoparticles can considerably enhance the antibacterial activity of biomolecules [54]. Thus, a Brevinin functionalized nanostructure would be of great importance from the objective of developing advanced functional bionanomaterials with antimicrobial properties. Researchers reported the functionalization of a novel gold-based nanocarrier with a therapeutic application (PMI (p12)) as well as a receptor-targeted (CRGDK) peptide to investigate the biological and medicinal effects of conjugated gold nanoparticles on breast cancer cells [57]. Lia et al. have developed AuNPs (gold nanoparticles) to make not only hybrid model system for selective target binding along with cancer therapeutic effects but also sensitive probes for sensing/imaging various analytes/targets such as ions and molecules [58].

Biomedical imaging is another field of application of peptide-functionalized nanoparticles. Synthesis of water-soluble gold nanoparticles functionalized with a Tat protein-derived peptide sequence facilitates the transfer of nanoparticles across the cell membrane, and therefore simplify the visualization of cellular or tissue components as well as nuclear targeting by electron microscopy [59]. The combined results of these studies have implications for functionalizing or decorating Brevinin-2R as an antimicrobial peptide onto nanostructure surfaces to create a hybrid model system for biological purposes.

Closing Remarks

Anuran bioactive peptides show great medical potential and will undoubtedly enter the clinic in a not so distant future. Major challenges to their large scale production, and also to research in this area as a whole, are fixed secondary structures achieved by those peptides, when secreted naturally. These secondary structures (i.e. cyclization) are often difficult to mimic, when peptides are produced in procaryotic expression system. These problems are, however, possible to overcome using current biochemical methods.

While most AMPs exhibit strong antibacterial activities, few of them (i.e. Brevinin-2R) show anticancer properties and low hemolytic activity, thus making them potentially compatible with an in vivo use. Noticeable hemolytic activity of most AMPs may be overcome either by structural modifications or simply by applying such drugs externally, directly on the site of infection, thus minimizing systemic load.

We have summarized the typical antibacterial activities of various AMPs (see Table 10.1). Interestingly, virtually no research has so far been done on antiviral activity of AMPs. With the growing demand for effective antiviral drugs (i.e. SARS, HIV, West Nile Virus, Ebola-virus), lipid-membrane-directed activities of AMPs may prove an effective antiviral drugs. Thus, the authors predict strong scientific and commercial interest in antiviral testing of AMPS.