Literature DB >> 24672236

Chlorotoxin-conjugated graphene oxide for targeted delivery of an anticancer drug.

Hao Wang1, Wei Gu2, Ning Xiao2, Ling Ye2, Qunyuan Xu1.   

Abstract

Current chemotherapy for <span class="Disease">glioma is rarely satisfactory due to low therapeutic efficiency and systemic side effects. We have developed a <span class="Disease">glioma-targeted drug delivery system based on graphene oxide. Targeted peptide chlorotoxin-conjugated graphene oxide (CTX-GO) sheets were successfully synthesized and characterized. Doxorubicin was loaded onto CTX-GO (CTX-GO/DOX) with high efficiency (570 mg doxorubicin per gram CTX-GO) via noncovalent interactions. Doxorubicin release was pH-dependent and showed sustained-release properties. Cytotoxicity experiments demonstrated that CTX-GO/DOX mediated the highest rate of death of glioma cells compared with free doxorubicin or graphene oxide loaded with doxorubicin only. Further, conjugation with chlorotoxin enhanced accumulation of doxorubicin within glioma cells. These findings indicate that CTX-GO is a promising platform for drug delivery and provide a rationale for developing a glioma-specific drug delivery system.

Entities:  

Keywords:  cytotoxicity; glioma; nanosheet; pH-dependent

Mesh:

Substances:

Year:  2014        PMID: 24672236      PMCID: PMC3964034          DOI: 10.2147/IJN.S58783

Source DB:  PubMed          Journal:  Int J Nanomedicine        ISSN: 1176-9114


Introduction

<span class="Chemical">Graphene oxide exists as a two-dimensional nanosheet comprised of sp2 hybridized <span class="Chemical">carbon atoms. The two-dimensional aromatic surface of graphene oxide makes it an ideal substrate for adsorption of antitumor drugs with aromatic rings by π-π stacking interactions, resulting in high drug loading and a stable drug complex.1,2 In addition, its large specific surface area and abundant functional groups (epoxide, hydroxyl, and carboxylic groups) allow conjugation of further functional groups and synthesis of hybrid materials.3–5 Therefore, graphene oxide nanosheets have been increasingly investigated as a promising drug carrier for antitumor drug delivery. <span class="Chemical">Doxorubicin, a typical chemotherapy agent, can be loaded onto <span class="Chemical">graphene oxide via π-π stacking to investigate drug loading, controlled release, and drug delivery. Yang et al6 used graphene oxide as a nanocarrier to load doxorubicin noncovalently and investigated the release of doxorubicin in pH-dependent manner. Recently, Zhang et al7 used graphene oxide nanosheets to load doxorubicin, and found that graphene oxide loaded with doxorubicin had sustained release behavior and antitumor efficacy. <span class="Disease">Glioma is the most common and lethal primary <span class="Disease">brain tumor in humans. Treatment of glioma with chemotherapeutic drugs plays an important role in combination therapies. However, the outcome of chemotherapy is usually unsatisfactory due to poor drug accumulation at the tumor site and severe side effects.8–10 Despite great efforts to incorporate a doxorubicin-loaded graphene oxide (GO/DOX) complex into a drug delivery system, enhancement of drug accumulation at the tumor site is obviously limited using the enhanced permeability and retention effect alone. A well-known strategy for achieving efficient accumulation in tumor tissue is to conjugate drug carriers with specific ligands that can recognize molecular signatures on the cancer cell surface.11–13 Folic acid molecules have been covalently bound to graphene oxide along with antineoplastic drugs for specific targeting to MCF-7 cells overexpressing folate, and cellular uptake experiments indicate efficient and targeted delivery of anticancer drugs into cells via receptor-mediated endocytosis.14 More recently, Liu et al15 synthesized transferrin-modified graphene oxide and confirmed significantly improved therapeutic efficacy in glioma both in vitro and in vivo. Moreover, chlorotoxin, a 36-amino acid peptide isolated from the venom of the giant Israeli scorpion (Leiurus quinquestriatus), has attracted increasing attention due to its high selectivity for glioma and other tumors of neuroectodermal origin by binding to matrix metalloproteinase-2.16 Using chlorotoxin as a targeting ligand could overcome the shortcomings of currently widely used antibodies, which are bulky and show limited tissue penetration and cellular uptake when introduced in vivo.17 However, to date, chlorotoxin-conjugated graphene oxide (CTX-GO), which would be expected to have both high specificity and high drug loading efficiency for glioma-specific drug delivery, remains unexplored. In this work, a <span class="Disease">glioma-targeted <span class="Chemical">CTX-GO-based drug delivery system was developed (Figure 1). Doxorubicin, a chemotherapeutic agent used for treating a wide variety of cancers,18,19 was loaded onto CTX-GO in a noncovalent fashion. The specificity of CTX-GO and the therapeutic efficacy of doxorubicin loaded into CTX-GO was assayed in C6 glioma cells in vitro.
Figure 1

Schematic illustration of the preparation of CTX-GO/DOX.

Abbreviations: GO-COOH, carboxylated graphene oxide; DOX, doxorubicin; CTX, chlorotoxin; CTX-GO/DOX, chlorotoxin-conjugated graphene oxide loaded noncovalently with doxorubicin.

Materials and methods

Materials

<span class="Chemical">Carboxylated graphene oxide (<span class="Chemical">GO-COOH) sheets were purchased from Nanjing XianFeng Nano Material Tech Co, Ltd (Nanjing, People’s Republic of China). Fetal bovine serum and Dulbecco’s Modified Eagle’s Medium were acquired from Gibco (Basel, Switzerland). Cell Counting Kit-8 (CCK-8) was sourced from Dojindo Molecular Technologies, Inc., (Rockville, MD, USA). Doxorubicin hydrochloride was provided by Beijing Huafeng United Technology Co, Ltd (Beijing, People’s Republic of China). Chlorotoxin (TM601) with a sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR was obtained from GL Biochem Ltd (Shanghai, People’s Republic of China). N-hydroxysuccinimide was acquired from Acros Organics (Uppsala, Sweden). N-(3-dimethylaminopropyl)-N’- ethylcarbodiimide hydrochloride was provided by J&K Chemical Ltd (Beijing, People’s Republic of China). Other chemicals and reagents were of analytical grade and used as received.

Conjugation of CTX-GO

First, 150 mg of <span class="Chemical">carboxylated graphene oxide was dispersed in 20 mL of <span class="Chemical">phosphate-buffered saline (0.1 M, pH 6.0), followed by addition of 4 mg of N-hydroxysuccinimide and 6 mg of N-(3-dimethylaminopropyl)-N’-ethylcarbodiimide hydrochloride. After stirring for 30 minutes, the mixture was allowed to react with 15 mg of chlorotoxin at room temperature for 48 hours in phosphate-buffered saline (pH 8.0). The CTX-GO was then collected by centrifugation, washed three times with deionized water, and subjected to lyophilization.

Loading of doxorubicin onto CTX-GO

Loading of <span class="Chemical">doxorubicin onto <span class="Chemical">CTX-GO (CTX-GO/DOX) was done by simply mixing 1 mg of CTX-GO with an appropriate amount of doxorubicin in 5 mL of water for 12 hours in the dark. The CTX-GO/DOX was then collected by centrifugation. To evaluate the loading efficiency of doxorubicin, ultraviolet-visible absorbance spectra for the initial doxorubicin solutions and supernatants were collected and the absorbance values at 485 nm were recorded. The amount of doxorubicin was then calculated according to the standard curve generated from a series of doxorubicin solutions with different concentrations.

Effect of pH on release of doxorubicin

To study the effect of pH on the release of <span class="Chemical">doxorubicin from <span class="Chemical">CTX-GO, 20 mg of CTX-GO/DOX were dispersed in 2 mL of phosphate-buffered saline (10 mM, pH 7.4 and 5.0, respectively). The suspension was then placed in a dialysis bag with a molecular weight cutoff of 14 kDa. Subsequently, the dialysis bag was immersed in 20 mL of phosphate-buffered saline (10 mM, pH 7.4 and 5.0, respectively). At selected intervals, the buffered solution (0.5 mL) outside the dialysis bag was withdrawn and replaced with an equal volume of fresh-buffered solution. The amount of doxorubicin released was analyzed using the ultraviolet-visible spectrophotometer at 485 nm.

Characterizations

Transmission electron microscopic images were obtained on a JEM-2100F system (JEOL, Tokyo, Japan) at an operating voltage of 200 kV. Specimens were prepared for transmission electron microscopic imaging by spreading a drop of sample on <span class="Chemical">copper grids, followed by evaporation under vacuum. The topography and thickness of <span class="Chemical">carboxylated graphene oxide was investigated using an atomic force microscope in contact mode. X-ray diffraction was carried out with a SmartLab X-ray diffractometer (Rigaku, Tokyo, Japan; Cu Kα radiation λ=1.54056 Å) operating at 45 kV and 200 mA. Fourier transform infrared (FTIR) spectra were recorded on an Avatar 300 FTIR spectrometer (Thermo Nicolet Instrument Corporation, Waltham, MA, USA). Pristine graphene oxide or CTX-GO (2 mg) was mixed with KBr (98 mg) and then pressed into a pellet with minimum pressure. One hundred scans were accumulated, with a resolution of 4 cm−1 for each spectrum. Ultraviolet-visible spectra were collected on a UV2550 ultraviolet-visible spectrophotometer (Shimadzu, Kyoto, Japan). The fluorescence spectra were recorded using an F-2500 fluorescence spectrophotometer (Hitachi, Tokyo, Japan) equipped with a 1 cm quartz cell (excitation 485 nm, emission 585 nm).

Cell culture

C6 (<span class="Disease">glioma) cells were routinely maintained in Dulbecco’s Modified Eagle’s Medium supplemented with 10% fetal <span class="Species">bovine serum, streptomycin (100 μg/mL), and penicillin (100 U/mL) at 37°C in a humidified 5% CO2 atmosphere.

In vitro cytotoxicity assay

C6 cells were seeded into a 96-well plate at a density of 1 × 104 cells per well. After incubation for 24 hours, the cell culture medium was exchanged for fresh medium containing various doses of free <span class="Chemical">doxorubicin, GO/<span class="Chemical">DOX, and CTX-GO/DOX, corresponding to equivalent doxorubicin concentrations of 1.0, 2.5, and 5.0 μg/mL, respectively. Carboxylated graphene oxide and CTX-GO representing equivalent graphene oxide doses of 3.0, 7.5, and 15.0 μg/mL, respectively, were used as controls. The cells were then allowed to incubate for a further 24 hours and the CCK-8 assay was performed. Briefly, the cell culture medium was discarded and CCK-8 in fetal bovine serum-free Dulbecco’s Modified Eagle’s Medium (0.1 mg/mL) was added. After incubation for a further hour, the absorbance at 450 nm was measured using a Multiskan spectrum microplate reader (Thermo Electron Corporation, Waltham, MA, USA) and cell viability was calculated.

Confocal laser scanning microscopy

A total of 1 × 105 C6 cells were reseeded on coverslips in each well of a 6-well plate and incubated for 24 hours. The growth medium was then replaced by <span class="Chemical">doxorubicin, GO/<span class="Chemical">DOX, or CTX-GO/DOX containing Dulbecco’s Modified Eagle’s Medium with an equivalent doxorubicin concentration of 0.5 μg/mL. After incubation for a further 24 hours, the cells were rinsed three times with phosphate-buffered saline. The cells were then fixed with methanol for 10 minutes and dried slightly in air. For colocalization studies, the cells were stained with 0.5 μg/mL Hoechst 33258 for 10 minutes to stain the cell nucleus. The cells were washed with phosphate-buffered saline three times, and the coverslips were observed under a TCS SP5 confocal microscope (Leica Microsystems, Wetzlar, Germany). Hoechst 33258 was visualized at an excitation wavelength of 346 nm, and doxorubicin was visualized on excitation at 511 nm. High magnification images of the C6 cells were obtained using a 60× oil-immersion lens.

Statistical analysis

The data are shown as the mean ± standard deviation. Differences were evaluated using the Student’s t-test and considered to be statistically significant at P<0.05.

Results and discussion

The morphology of the <span class="Chemical">carboxylated graphene oxide sheets was characterized by atomic force microscopy and transmission electron microscopy. As seen in Figure 2A, <span class="Chemical">carboxylated graphene oxide had the flake-like shape of corrugated graphene sheets with a lateral width of 200 nm. The crumpled structure was due to the scrolls and multiple folds of the flexible graphene oxide sheet. Note that each fold exhibited only one dark line, confirming that each exfoliated flake was a monolayer of graphene. The thickness of graphene oxide from the atomic force microscopy height profile was about 3 nm (Figure 2B), which is greater than that for a pure graphene oxide sheet as reported in the literature.20 This is probably due to the carboxyl groups on the basal plane of graphene oxide.21
Figure 2

(A) Transmission electron microscopic images of carboxylated graphene oxide (inset: graphene dispersion in phosphate-buffered saline) and (B) atomic force microscopic images of carboxylated graphene oxide.

The presence of <span class="Chemical">carboxyl groups on the <span class="Chemical">graphene oxide sheets was confirmed by FTIR (Figure 3A). The intensive band at 1,390 cm−1 was due to the symmetric stretching of -COO- from the basal plane of the graphene oxide sheets, whereas the band at 1,730 cm−1 originated from the asymmetric stretching of -COOH along the edges of the graphene oxide sheets. These bands diminished upon conjugation of chlorotoxin, and this was accompanied by appearance of amide I and II bands (Figure 3B), implying successful conjugation of chlorotoxin by the reaction of NH2 groups of chlorotoxin with the COOH groups of graphene oxide. The additional new peaks below 1,500 cm−1 observed in Figure 3B could be readily assigned to chlorotoxin by referring to the FTIR spectrum for free chlorotoxin (Figure 3C), further confirming the successful conjugation of chlorotoxin with the graphene oxide sheets.
Figure 3

Fourier-transform infrared spectra of (A) carboxylated graphene oxide, (B) chlorotoxin-conjugated graphene oxide, and (C) chlorotoxin.

The structural information for <span class="Chemical">carboxylated graphene oxide and <span class="Chemical">CTX-GO was assayed by X-ray diffraction, and the patterns obtained for carboxylated graphene oxide and CTX-GO are shown in Figure 4. It can clearly be seen that the graphene oxide sheets had a broad peak centered at 2θ =15.87°, corresponding to the (002) plane. This peak shifted downwards to 10.35° and became sharper on conjugation of chlorotoxin, indicating partial reduction of graphene oxide under alkaline conditions during the chlorotoxin conjugation process. This, to some extent, confirmed successful conjugation of chlorotoxin onto the graphene oxide sheets.
Figure 4

X-ray diffraction patterns of (A) carboxylated graphene oxide and (B) chlorotoxin-conjugated graphene oxide.

To quantify the chlorotoxin conjugated onto the <span class="Chemical">graphene oxide, the C, N and H was content obtained by elemental analysis (Table 1).22 In comparison with <span class="Chemical">carboxylated graphene oxide, CTX-GO showed a significant increase in N content from 0.101% to 2.095%. Given that the N content in chlorotoxin is 18.219%, the increased N content of CTX-GO indicates conjugation of chlorotoxin to graphene oxide. Further, based on the fact that the mass of C in CTX-GO was the sum of the C mass of chlorotoxin and CTX-GO, the amount of chlorotoxin conjugated to graphene oxide was estimated to be 1.88%.
Table 1

Elemental analysis results of GO-COOH and CTX-GO

CHN
GO-COOH28.552.5300.101
CTX-GO29.443.4662.095

Abbreviations: GO-COOH, carboxylated graphene oxide; CTX-GO, chlorotoxin-conjugated graphene oxide.

Next, the <span class="Chemical">CTX-GO sheets were loaded with <span class="Chemical">doxorubicin. Graphene oxide is known to exist as a two-dimensional sheet consisting of sp2 hybridized carbon. The sp2 hybridized π conjugated structure can thereby have π-π stacking interactions with the quinine portion of doxorubicin. In addition, the amine (-NH2) and hydroxyl (-OH) groups on doxorubicin can induce a strong hydrogen-bonding interaction with the -COOH and -OH groups on graphene oxide. Therefore, doxorubicin can be loaded onto CTX-GO in a noncovalent manner23 and the loading efficiency of doxorubicin was found to be around 570 mg doxorubicin per gram CTX-GO. This value is higher than the loading efficiency reported for doxorubicin onto folate-conjugated graphene oxide.24 Release of <span class="Chemical">doxorubicin from <span class="Chemical">CTX-GO at pH 7.4 (physiological pH) and 5.0 (endosomal pH of cancer cells) was determined. The profiles for release of doxorubicin from chlorotoxin are shown in Figure 5. Release of doxorubicin from CTX-GO was clearly pH-dependent. Specifically, doxorubicin was released in a slower and controlled manner from CTX-GO at pH 7.4. A possible explanation for this phenomenon is that the hydrogen-bonding interaction between doxorubicin and graphene oxide is less significant in acidic conditions. Under acidic conditions, protonation of the amine (-NH2) groups in doxorubicin results in partial dissociation of the hydrogen-bonding interaction, hence the amount of doxorubicin released from CTX-GO was greater. However, the percentage of unreleased doxorubicin on CTX-GO sheets after 60 hours was still more than 70%, even under acidic conditions, confirming the presence of strong π-π stacking interactions between CTX-GO and doxorubicin in addition to hydrogen bonding. Nevertheless, the pH-dependent release of doxorubicin from CTX-GO is valuable for drug delivery, given that the microenvironments in the extracellular tissue around tumors and intracellular lysosomes and endosomes are acidic.25
Figure 5

Release profiles of doxorubicin from chlorotoxin-conjugated graphene oxide at pH 7.4 and pH 5.0.

To evaluate specific targeting capacity, the in vitro <span class="Disease">cytotoxicity of GO/<span class="Chemical">DOX and CTX-GO/DOX was compared using the CCK-8 assay. Carboxylated graphene oxide, CTX-GO, and free doxorubicin were used as negative and positive controls, respectively. As shown in Figure 6, both carboxylated graphene oxide and CTX-GO had negligible toxic effects on C6 cells (viability was >80% at all concentrations). However, the difference in cytotoxicity between carboxylated graphene oxide and CTX-GO became more distinct with increasing graphene oxide concentration, implying more cellular uptake of CTX-GO by C6 cells due to the ability of chlorotoxin to target C6 cells. As expected, doxorubicin loaded into either GO/DOX or CTX-GO/DOX had enhanced cytotoxicity compared with free doxorubicin. However, CTX-GO/DOX showed greater cytotoxicity at 2.5 μg/mL and 5 μg/mL. Clearly, the enhancement of inhibition is attributed to the targeting specificity of chlorotoxin, which leads to greater uptake of doxorubicin by C6 cells.
Figure 6

Viability of C6 glioma cells determined by Cell Counting Kit-8 assay after 24 hours of incubation with GO-COOH, CTX-GO, DOX, GO/DOX, and CTX-GO/DOX at various concentrations. Each data represents the mean ± standard deviation of three experiments. Statistically significant differences were evaluated using the Student’s t-test (*P<0.05, **P<0.01, ***P<0.001).

Abbreviations: GO-COOH, carboxylated graphene oxide; CTX-GO, chlorotoxin-conjugated graphene oxide; DOX, doxorubicin; GO/DOX, graphene oxide loaded noncovalently with doxorubicin; CTX-GO/DOX, chlorotoxin-conjugated graphene oxide loaded noncovalently with doxorubicin.

To provide additional evidence of the differential <span class="Disease">cytotoxicity of GO/<span class="Chemical">DOX and CTX-GO/DOX in C6 cells, the morphologies of these cells were observed after incubation with medium alone (control), carboxylated graphene oxide, CTX-GO, GO/DOX, CTX-GO/DOX, and free doxorubicin for 24 hours using optical microscopy. As shown in Figure 7, no significant changes in cell density or morphology were found for graphene oxide or CTX-GO when compared with the control group, suggesting biocompatibility of carboxylated graphene oxide. In contrast, treatment with GO/DOX, CTX-GO/DOX, or free doxorubicin (at an equivalent doxorubicin concentration of 2.5 μg/mL) resulted in significant morphological changes, including cell detachment from the plate, shrinking, and appearance of spherical cells. Moreover, CTX-GO/DOX induced more pronounced cell morphological changes and cell death than GO/DOX or free doxorubicin, indicating the targeting capability of chlorotoxin. These results correlate well with the data obtained from the CCK-8 assay.
Figure 7

Microscopic images of C6 cells treated with (A) medium (control), (B) carboxylated graphene oxide, (C) chlorotoxin-conjugated graphene oxide, and (D) graphene oxide loaded noncovalently with doxorubicin, (E) chlorotoxin-conjugated graphene oxide loaded noncovalently with doxorubicin, and (F) free doxorubicin at an equivalent doxorubicin concentration of 2.5 μg/mL for 24 hours.

The uptaking process (Figure S1, Supplementary material) and the intracellular localization of <span class="Chemical">doxorubicin, GO/<span class="Chemical">DOX, and CTX-GO/DOX in C6 cells was investigated by confocal laser scanning microscopy. As shown in Figure 8, doxorubicin, GO/DOX, and CTX-GO/DOX showed different distribution patterns in C6 cells. Treatment with free doxorubicin produced a bright purple color inside the cell nuclei, suggesting that free doxorubicin was primarily distributed in the nuclei. In contrast, treatment with GO/DOX and CTX-GO/DOX produced a relatively weak fluorescence signal in the cell nuclei and aggregated red dots in the cytoplasm (on differential interference contrast), indicating that only small amounts of doxorubicin were released and entered the cell nuclei. However, compared with GO/DOX, a greater purple fluorescence signal in both the nuclei and cytoplasm were observed for CTX-GO/DOX, confirming that more doxorubicin is delivered into the cell upon conjugation with chlorotoxin. This suggests a chlorotoxin-specific interaction with the receptor distributed on the cell membrane, leading to more accumulation of doxorubicin in C6 cells.
Figure 8

Cellular localization and distribution of DOX, GO/DOX, and CTX-GO/DOX in C6 cells with the equivalent concentration of DOX (0.5 μg/mL) for 24 hours of incubation. The nuclei were stained with Hoechst 33258. Scale bar 10 μm.

Note: The red dots the arrows are pointing to are GO/DOX or CTX-GO/DOX.

Abbreviations: DIC, differential interference contrast; DOX, doxorubicin; GO/DOX, graphene oxide loaded noncovalently with doxorubicin; CTX-GO/DOX, chlorotoxin conjugated graphene oxide loaded noncovalently with doxorubicin.

Conclusion

In summary, <span class="Chemical">CTX-GO sheets were prepared for <span class="Disease">glioma-targeted delivery of the anticancer drug doxorubicin. It was demonstrated that doxorubicin molecules could be efficiently loaded onto CTX-DOX via noncovalent interactions and that the release of doxorubicin from CTX-GO is pH-dependent. The cytotoxicity study demonstrated that CTX-GO/DOX induced the highest rate of glioma cell death compared with GO/DOX and free doxorubicin, probably due to the fact that conjugation with chlorotoxin enhanced the accumulation of doxorubicin within the cells. Our findings suggest that CTX-GO is a potential drug delivery platform and provide a rationale for developing glioma-specific targeted delivery of an antitumor drug. Further in vivo study is still needed and obstacles, such as the blood–brain barrier should not be overlooked. Intracellular localization following 0, 10, 20, 30 minutes of coincubation time in C6 cells with free <span class="Chemical">DOX, GO/<span class="Chemical">DOX, or CTX-GO/DOX with the equivalent concentration of DOX (5.0 μg/mL). The cells were imaged on a Olympic microscope with an UltraVIEW Vox confocal attachment (Perkin Elmer, Boston, MA, USA). Laser lines were used at 488 nm and 560 nm. Abbreviations: <span class="Chemical">DOX, <span class="Chemical">doxorubicin; GO/DOX, graphene oxide loaded noncovalently with doxorubicin; CTX-GO/DOX, chlorotoxin-conjugated graphene oxide loaded noncovalently with doxorubicin; min, minutes.
  20 in total

1.  Multiwalled carbon nanotube-doxorubicin supramolecular complexes for cancer therapeutics.

Authors:  Hanene Ali-Boucetta; Khuloud T Al-Jamal; David McCarthy; Maurizio Prato; Alberto Bianco; Kostas Kostarelos
Journal:  Chem Commun (Camb)       Date:  2007-11-14       Impact factor: 6.222

Review 2.  Modeling the loading and unloading of drugs into nanotubes.

Authors:  Tamsyn A Hilder; James M Hill
Journal:  Small       Date:  2009-03       Impact factor: 13.281

Review 3.  Nanoparticle-based cerebral drug-delivery systems and antiangiogenic approach in gliomas treatment.

Authors:  Giuseppe Raudino; Mariella Caffo; Gerardo Caruso; Concetta Alafaci; Francesco Tomasello
Journal:  Recent Pat Nanotechnol       Date:  2011-11       Impact factor: 1.952

Review 4.  The power and potential of doxorubicin-DNA adducts.

Authors:  Suzanne M Cutts; Abraham Nudelman; Ada Rephaeli; Don R Phillips
Journal:  IUBMB Life       Date:  2005-02       Impact factor: 3.885

5.  Graphene oxide mediated delivery of methylene blue for combined photodynamic and photothermal therapy.

Authors:  Abhishek Sahu; Won Il Choi; Jong Hyun Lee; Giyoong Tae
Journal:  Biomaterials       Date:  2013-05-23       Impact factor: 12.479

6.  Folic acid-conjugated graphene oxide for cancer targeted chemo-photothermal therapy.

Authors:  X C Qin; Z Y Guo; Z M Liu; W Zhang; M M Wan; B W Yang
Journal:  J Photochem Photobiol B       Date:  2012-12-29       Impact factor: 6.252

7.  In vivo MRI detection of gliomas by chlorotoxin-conjugated superparamagnetic nanoprobes.

Authors:  Conroy Sun; Omid Veiseh; Jonathan Gunn; Chen Fang; Stacey Hansen; Donghoon Lee; Raymond Sze; Richard G Ellenbogen; Jim Olson; Miqin Zhang
Journal:  Small       Date:  2008-03       Impact factor: 13.281

8.  Functional graphene oxide as a nanocarrier for controlled loading and targeted delivery of mixed anticancer drugs.

Authors:  Liming Zhang; Jingguang Xia; Qinghuan Zhao; Liwei Liu; Zhijun Zhang
Journal:  Small       Date:  2010-02-22       Impact factor: 13.281

9.  Folic Acid-conjugated Graphene Oxide loaded with Photosensitizers for Targeting Photodynamic Therapy.

Authors:  Peng Huang; Cheng Xu; Jing Lin; Can Wang; Xiansong Wang; Chunlei Zhang; Xuejiao Zhou; Shouwu Guo; Daxiang Cui
Journal:  Theranostics       Date:  2011-04-13       Impact factor: 11.556

10.  Folic acid-tethered Pep-1 peptide-conjugated liposomal nanocarrier for enhanced intracellular drug delivery to cancer cells: conformational characterization and in vitro cellular uptake evaluation.

Authors:  Myung Joo Kang; Sang Han Park; Mean Hyung Kang; Min Jung Park; Young Wook Choi
Journal:  Int J Nanomedicine       Date:  2013-03-15
View more
  24 in total

Review 1.  Multifunctionalization of graphene and graphene oxide for controlled release and targeted delivery of anticancer drugs.

Authors:  Cui-Cui Liu; Jing-Jing Zhao; Rui Zhang; Hui Li; Bo Chen; Ling-Ling Zhang; Hao Yang
Journal:  Am J Transl Res       Date:  2017-12-15       Impact factor: 4.060

Review 2.  Modifications of natural peptides for nanoparticle and drug design.

Authors:  Andrew P Jallouk; Rohun U Palekar; Hua Pan; Paul H Schlesinger; Samuel A Wickline
Journal:  Adv Protein Chem Struct Biol       Date:  2015-03-12       Impact factor: 3.507

3.  Folate-Mediated Targeted Delivery of Combination Chemotherapeutics Loaded Reduced Graphene Oxide for Synergistic Chemo-Photothermal Therapy of Cancers.

Authors:  Raj Kumar Thapa; Yongjoo Choi; Jee-Heon Jeong; Yu Seok Youn; Han-Gon Choi; Chul Soon Yong; Jong Oh Kim
Journal:  Pharm Res       Date:  2016-08-29       Impact factor: 4.200

Review 4.  Graphene-based platforms for cancer therapeutics.

Authors:  Sunny C Patel; Stephen Lee; Gaurav Lalwani; Cassandra Suhrland; Sayan Mullick Chowdhury; Balaji Sitharaman
Journal:  Ther Deliv       Date:  2016-01-15

5.  Fabrication Of Dual pH/redox-Responsive Lipid-Polymer Hybrid Nanoparticles For Anticancer Drug Delivery And Controlled Release.

Authors:  Wanfu Men; Peiyao Zhu; Siyuan Dong; Wenke Liu; Kun Zhou; Yu Bai; Xiangli Liu; Shulei Gong; Can Yang Zhang; Shuguang Zhang
Journal:  Int J Nanomedicine       Date:  2019-10-03

Review 6.  Graphene and graphene-based materials in axonal repair of spinal cord injury.

Authors:  Shi-Xin Wang; Yu-Bao Lu; Xue-Xi Wang; Yan Wang; Yu-Jun Song; Xiao Wang; Munkhtuya Nyamgerelt
Journal:  Neural Regen Res       Date:  2022-10       Impact factor: 6.058

7.  Stimulated myoblast differentiation on graphene oxide-impregnated PLGA-collagen hybrid fibre matrices.

Authors:  Yong Cheol Shin; Jong Ho Lee; Linhua Jin; Min Jeong Kim; Yong-Joo Kim; Jung Keun Hyun; Tae-Gon Jung; Suck Won Hong; Dong-Wook Han
Journal:  J Nanobiotechnology       Date:  2015-03-12       Impact factor: 10.435

Review 8.  Current applications of graphene oxide in nanomedicine.

Authors:  Si-Ying Wu; Seong Soo A An; John Hulme
Journal:  Int J Nanomedicine       Date:  2015-08-26

9.  Preparation and tumor cell model based biobehavioral evaluation of the nanocarrier system using partially reduced graphene oxide functionalized by surfactant.

Authors:  Yimin Wang; Kunping Liu; Zewei Luo; Yixiang Duan
Journal:  Int J Nanomedicine       Date:  2015-07-20

Review 10.  Oxidative Stress and Mitochondrial Activation as the Main Mechanisms Underlying Graphene Toxicity against Human Cancer Cells.

Authors:  Anna Jarosz; Marta Skoda; Ilona Dudek; Dariusz Szukiewicz
Journal:  Oxid Med Cell Longev       Date:  2015-11-15       Impact factor: 6.543

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.