Literature DB >> 24196104

A universal protein tag for delivery of SiRNA-aptamer chimeras.

Hong Yan Liu1, Xiaohu Gao.   

Abstract

siRNA-aptamer chimeras have emerged as one of the most promising approaches for targeted delivery of siRNA due to the modularity of their diblock RNA structure, relatively lower cost over other targeted delivery approaches, and, most importantly, the outstanding potential for clinical translation. However, additional challenges must be addressed for efficient RNA interference (RNAi), in particular, endosomal escape. Currently, vast majority of siRNA delivery vehicles are based on cationic materials, which form complexes with negatively charged siRNA. Unfortunately, these approaches complicate the formulations again by forming large complexes with heterogeneous sizes, unfavorable surface charges, colloidal instability, and poor targeting ligand orientation. Here, we report the development of a small and simple protein tag that complements the therapeutic and targeting functionalities of chimera with two functional domains: a dsRNA binding domain (dsRBD) for siRNA docking and a pH-dependent polyhistidine to disrupt endosomal membrane. The protein selectively tags along the siRNA block of individual chimera, rendering the overall size of the complex small, desirable for deep tissue penetration, and the aptamer block accessible for target recognition. More interestingly, we found that extending the c-terminal polyhistidine segment in the protein tag to 18 amino acids completely abolishes the RNA binding function of dsRBD.

Entities:  

Mesh:

Substances:

Year:  2013        PMID: 24196104      PMCID: PMC3819613          DOI: 10.1038/srep03129

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


siRNA is of considerable current interest because it can elicit potent, target-specific knockdown of virtually any mRNA, creating new opportunities for personalized medicine and for addressing a broad range of traditionally undruggable disease targets using small molecules123. Similar to other antisense approaches, however, cell-specific delivery of siRNA technology in vivo still represents a major technical hurdle4. To guide siRNA to diseased cells, targeting ligands such as small molecules, lipids, peptides, and proteins have been identified and linked directly to siRNA or on the surface of siRNA nanocarriers5678910. Considering the complex physical and chemical structures of various formulations, the siRNA-targeting ligand-delivery vehicle complexes face difficulty in large-scale production and regulatory approval for clinical uses. Recently, siRNA-aptamer chimera, employing only RNA molecules, has emerged as a highly promising approach for cell type-specific RNAi, owing to its low immunogenicity, ease of chemical synthesis and modification, small size, and the targeting specificity of aptamers. RNA-based aptamers are identified through in vitro enrichment known as SELEX (systematic evolution of ligands by exponential enrichment)11121314. Similar to antibodies, they are capable of binding to various molecular targets including small molecules, proteins, and cells, while offering key advantages as they can be completely identified and produced with desired chemical modifications in vitro through automated processes. For aptamer-guided siRNA delivery, exciting works by McNamara, Dassie, and coworkers show that chimeras composed of aptamer targeting prostate specific membrane antigen (PSMA) and siRNA targeting anti-apoptotic genes (Plk1) have been made and optimized1516. The aptamer block recognizes PSMA on prostate tumor cell surface and leads to chimera cell internalization, whereas the siRNA block enzymatically cleaved from the chimera promotes cell death. Significantly reduced tumor mass was observed in mouse xenograft models of prostate tumor after administration of the chimera, though the exact mechanism of chimera endosomal escape remains unclear17. This limitation helps explain why high concentrations of chimera were required in these pioneer studies to treat prostate tumors1516. An obvious solution to this problem is to combine chimeras with nanocarriers with endosome rupturing capabilities. Common delivery vehicles include lipids, polymers, and inorganic nanoparticles such as gold, silica, magnetic, and semiconductor nanoparticles1819202122. For siRNA immobilization, condensation, stabilization against enzymatic degradation, and endosomal escape, virtually all these nanocarriers are positively charged, and so are their siRNA complexes. Unfortunately, the electrostatically induced nanocarrier-chimera condensation almost completely defies the purpose of simple formulation for siRNA clinical translation because the final nanoparticles become complex again, with mixed sizes, surface properties, aptamer conformations and orientations, and batch-to-batch variations. For example, the size difference between the original intact chimeras (nanometers) with the final large complexes (typically 100 s nanometers) and the chemical composition of the nanocarriers can drastically change chimera's targeting profile, in vivo biodistribution, and clearance23. Furthermore, it is ideal to make the aptamer loop structure exposed and the siRNA block hidden for specific binding, but electrostatic condensation with cationic nanocarriers does not warrant that selectivity. As demonstrated previously, immobilizing siRNA-aptamer chimeras onto cationic nanoparticles via the siRNA end offers significantly improved silencing effect compared to condensing chimeras onto cationic nanoparticles through random sites24. This is understandable since (1) exposure of the siRNA end would only increase the chances of non-specific binding and reduce the stability siRNA against enzymatic degradation; and (2) interaction between cationic nanocarriers with anionic aptamers could alter aptamers' conformation and targeting capability25. Therefore, it is of critical importance to design a delivery system that is simple for potential regulatory approval and mass production, universal for all siRNA-aptamer chimera, neutral and siRNA-binding specific to ensure aptamer targeting, and small to avoid major alteration of chimera's biodistribution profile. A system simultaneously achieving these features could expedite clinically translation of the highly promising siRNA-aptamer chimera technology. Here, we report the development of a small protein tag for efficient delivery of siRNA-aptamer chimeras. As shown in Figure 1, the protein tag is composed of two functional domains: a dsRBD used as a siRNA docking module and a pH-dependent polyhistidine to help disrupt the endosomal membrane. The dsRBD is the N-terminal region (20 Kda) of human protein kinase that binds dsRNA in a sequence-independent fashion2627. Because aptamers are typically ssRNA with complex secondary structures, dsRBD does not bind with them (dsRBD only tolerates small bulges) and thus will selectively bind chimera through the siRNA end, leaving the aptamer end accessible.
Figure 1

Schematics of protein tags for siRNA-aptamer chimera delivery.

Chimera composed of an aptamer block targeting PSMA and a siRNA block targeting GFP forms a hair-pin like structure. Protein tags specifically bound to the stem region (dsRNA) of the chimera complements it with endosomal escape capability. Protein tags with varying lengths of polyhistidines, as shown in the domain architectures, are engineered to achieve balanced endosomal escape and RNA binding functionalities.

To add endosomal escape functionality, a short histidine (His) oligomer is added to the C-terminus of the dsRBD. His has been incorporated into a number gene carriers because its endosomal buffering capacity promoting drug cytoplasmic release2829. His molecules have a pKa value of approximately 6. At neutral pH (such as in circulation), they are mainly deprotonated (uncharged), which is desirable over positively charged counterparts due to reduced accumulation within the RES (reticuloendothelial system). In acidic compartments such as endosome, His becomes protonated and facilitates osmotic swelling that leads to cargo release, a mechanism proposed as the proton sponge effect30. Overall, this protein tag is equally small, simple, and biodegradable as siRNA-aptamer chimera, while perfectly complementing chimera's functionalities. When complexed together, they remain small in size, discrete and stable in solution, low positive charge for circulation, and simultaneously achieve therapeutic, targeting, and endosomal escaping capabilities.

Results

Expression and characterization of dsBRD-His18 protein tag

To add endosomal escape capability, a short polyhistidine peptide was added to dsRBD. The dsRBD domain comes from the first 172 amino acids of human protein kinase R (hPKR), and has two double-strand RNA binding motifs (dsRBM1 and dsRBM2) for cooperative and dsRNA-specific binding31. Because dsRBM1 towards the N terminal dominates the binding with dsRNA32, we introduced the histidine peptide towards the C terminal (Figure 1) to minimize impact on dsRBD's biological activity. In theory, the endosomal escape capability should increase with longer His chain; on the other hand, long His chain could potentially interfere with dsRBD protein folding and binding. To achieve a balance, dsRBD with C-terminal Histidines of various lengths (Hisn, n = 0, 12, 18, and 24) were cloned into the PET28a (+) vector. BamH1 and Xho1 restriction enzyme sites were introduced to the 5′- and 3′-flanking region by PCR, respectively. Because all the genetic constructs contain His6 at the N-terminal from the cloning vector (this N-terminal His6 has been previously proved to have no impact on dsRBD binding)26, the total numbers of His encoded by the final constructs are 6, 18, 24, and 30, respectively (sequences see Methods). Post expression and purification, the resulted protein tags were analyzed with sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE, Figure 2a). The sizes of four protein tags show in excellent agreement with theoretical values (Figure 1). To assess their dsRNA binding activity, siRNA-aptamer chimera labeled with fluorophore FAM were incubated with the protein tags and probed with gel electrophoresis (1% agarose). As shown in Figure 2b, the dsRNA binding capability of dsRBD with His12 at the C terminus (total His18) is well preserved compared with dsRBD without a C-terminus histag insertion. The minimum RNA length for high affinity binding with dsRBD has been determined to be 16 base-pairs26. At the current RNA length, the siRNA segment and the adjacent short stem in the aptamer structure can bind with 1–2 copies of dsRBD. However, it has been well documented that only the first dsRBD binds to RNA stably, while, at high dsRBD/RNA ratio, a second copy of dsRBD can bind, but at significantly lower affinity2633. Using unmodified dsRBD and siRNA alone, similar dsRBD-siRNA binding profiles have been observed previously by Kim and coworkers, who also show that the enzymatic stability of siRNA is significantly enhanced upon binding with dsRBD34.
Figure 2

Characterization of protein tags with varying lengths of polyhistidine and the siRNA-aptamer chimera.

(a) SDS-PAGE analysis of protein tags composed of a dsRBD binding domain and polyhistidines at the two termini (total number of His: 6, 18, 24, and 30), in reference to protein ladder shown to the left. Motility patterns of the four protein tags are in agreement with their calculated molecular weights of 22.6 kDa (His6), 24.8 kDa (His18), 25.8 kDa (His24), and 26.8 kDa (His30). (b) Characterization of dsRNA binding capability of the four protein tags with agarose gel electrophoresis. Chimera labeled with fluorophore (FAM) was incubated with the protein tags at protein/chimera molar ratios of 1, 2, or 4 for 1 h at 4°C. The dsRNA binding capability of dsRBD-His18 is well preserved compared to the original dsRBD-His6, whereas dsRBD-His24 and dsRBD-His30 completely lose dsRNA binding activity. (c) Evaluation of targeting specificity of the aptamer block in chimera. PSMA-positive LNCaP cells and PSMA-negative PC3 cells are treated with complex of Cy3-labeled chimera and dsRBD-His18 for 12 h. Fluorescence microscopy reveals selective binding of the complex to LNCaP cells, but not PC3 cells. Scale bar: 50 μm. (d) Evaluation of silencing functionality of the siRNA block. The chimera and conventional siRNA targeting GFP (positive control) are transfected into GFP-expressing C4-2 prostate cancer cells using Lipofectamine. The silencing effect of the chimera is indistinguishable with the positive control. Scale bar: 250 μm.

It is important to mention that a key difference of our technology compared to these prior works utilizing dsRBD for siRNA delivery2734 is that we do not introduce highly positively charged peptides. Although positively charged nanocarriers promote siRNA cell entry, it is well known that they are also quickly cleared by the RES, increase non-specific binding with cells and cytotoxicity35. Furthermore, as aforementioned, avoiding positive charges in carrier design is particularly important for siRNA-aptamer chimera because excessive positive charges could non-specifically interact with aptamer and affect its targeting capability. More interestingly, the gel electrophoresis experiments also reveal that extending the C-terminal His by another 6 or 12 amino acids completely abolish dsRBD's binding activity. Therefore, for the following gene expression regulation studies we chose the dsRBD with a total of 18 His due to its balanced dsRNA binding and endosomal escape functionalities, in comparison with the original dsRBD with no C-terminus His as a control.

Design, synthesis, and characterization of siRNA-aptamer chimera

To evaluate the universal protein tag for siRNA-aptamer chimera, we first designed and made a chimera based on the protocols described by Dassie and coworkers, taking advantage of the shortened aptamer sequence for specific targeting of PSMA as well as the optimized siRNA strands with enhanced therapeutic potency15. The PSMA targeting aptamer was kept in our chimera, because PSMA has been identified as one of the most attractive cell surface markers for both prostate epithelial cells and neovascular endothelial cells36. Accumulation and retention of PSMA targeting probes at the site of tumor growth is the basis of radioimmunoscintigraphic scanning (e.g., ProstaScint scan) and targeted therapy for human prostate cancer metastasis. We replaced their siRNA sequence with a siRNA silencing GFP expression, because GFP is the best model for quantitative assessment of the silencing effect using optical imaging and flow cytometry. The long ssRNA composed of PSMA aptamer and siRNA antisense strand (Figure 1) was prepared by in vitro transcription with the presence of 2′ fluoro-modified pyrimidies for improved resistance to ribonucleases. It has been shown previously that 2′-F modification is compatible with dsRBD binding unlike 2′-H or 2′-OCH3 substitutes2637. The transcript was annealed to chemically synthesized siRNA sense strand. Before combining the chimera with our small protein tag, we first tested the activities of the chimera. To test the targeting function of the aptamer block, PSMA-positive LNCaP and PSMA-negative PC3 prostate tumor cells were incubated with dye-labeled chimera. As shown in Figure 2c, the chimera selectively binds and enters LNCaP cells indicating targeting specificity. To test the silencing effect separately, the chimera was transfected into GFP-expressing C4-2 prostate tumor cells (a derivative of LNCaP) using conventional transfection agents, Lipofectamine. As shown in Figure 2d, the silencing effect is indistinguishable with the positive control using siRNA only, proving that chimera can be enzymatically processed intracellularly to generate functional siRNA.

Targeting delivery and silencing in cells

With the biological activities of our protein tag and siRNA-aptamer chimera separately characterized, we proceeded to evaluate the gene silencing effect of this simple yet functionally highly complementary protein tag in siRNA-aptamer chimera delivery. GFP-expressing C4-2 cell line was used as a model because of the advantages of fluorescence imaging techniques such as microscopy and quantitative flow cytometry. Figure 3a–f shows confocal images of the C4-2 cells without treatment, treated with GFP-siRNA alone, chimera alone, a random sequenced siRNA with the protein tag (His18), chimera with protein tag (His6), and chimera with protein tag (His18). Qualitatively, only the experimental treatment, chimera with protein tag (His18), clearly shows GFP silencing, whereas none of the five control treatments leads to significant suppression of GFP expression.
Figure 3

Assessment of gene knockdown with confocal microscopy and flow cytometry.

GFP expressing C4-2 cells are treated with chimera-dsRBD-His18 complex and five controls, and the silencing effect is assessed with confocal microscopy (a–f) and quantified with flow cytometry (g–l). For confocal imaging, the panels from left to right are DIC, fluorescence, and merged images. In contrast to the control conditions (a, g) no treatment, (b, h) scrambled siRNA with dsRBD-His18, (c, i) siRNA against GFP only, (d, j) chimera complexed with dsRBD-His6, (e, k) chimera only (absence of transfection agents), the experimental group of chimera complexed with dsRBD-His18 (f, l) shows significantly higher GFP knockdown. Scale bar as shown in (a) is consistent in the microscopy images, 20 μm.

Quantitative flow cytometry studies further confirm this result (Figure 3g–l). At the current gate value set for GFP fluorescence intensity, the original untreated cells showed a GFP-negative population of 17.4%. Treating the cells with a random sequenced siRNA with protein tag (His18) shows virtually no change in this population (difference: 5.4% of total cell population, within error range) proving sequence-specific silencing of RNAi. For cells treated with GFP siRNA and chimera, the GFP negative cells only increase by 7.6% and 12.2% of the total cell population respectively. Even by increasing the chimera concentration by ten times (1 μM), the total GFP-negative cell population only increase by <20% (Supplementary Figure S1), strongly suggesting the need of carrier materials. Direct comparison of the chimera tagged by dsRBD-His6 and dsRBD-His18 shows major difference in silencing efficiency, too (14.6% and 59.6% change). Taken together, these results clearly indicate that (1) chimera alone at concentration commonly used in RNAi experiments does not lead to effective silencing, and (2) His18 is remarkably more effective than His6 in endosomal destabilization since the dsRBD block is identical in structure and function. To put the silencing efficiency of dsRBD-His18 in the context of those of conventional RNA delivery vehicles such as Lipofectamine, quantitative flow cytometry was also conducted. In agreement with the microscopy results shown in Figure 2d, Lipofectamine reduces GFP-negative cells from the original 17.4% to 91.6% (74.2% change, Supplementary Figure S2), which is slightly more efficient than the protein tag. However, it is important to note that Lipofectamine delivers chimera into cells mainly via electrostatic interactions (positively charged Lipofectamine and negatively charged cell surface, non-targeted delivery), whereas our protein tag delivers chimera by cell type-specific molecular recognition (targeted delivery). It is also worth mentioning that the molar ratio of mixing chimera with protein tag is 1:2 because the siRNA block can bind up to 2 copies of dsRBD, although the second copy has very weak binding affinity. Indeed, changing the binding ratio to 1 or 4 does not affect the RNAi efficiency (Supplementary Figure S3). To further confirm the difference in endosomal escape capability between the two protein tags (dsRBD-His6 and dsRBD-His18), we performed a dual color imaging assay using non-fluorescence LNCaP cells. In this experiment, chimera was labeled with Cy3 and endosome/lysosome was marked with a LysoTracker (spectrally distinguishable green fluorescence). Direct contrast in chimera distribution and intracellular density of endosome/lysosome was observed between the two protein tags. As shown in Figure 4, Cy3-labeled chimera evenly distributes inside cells when tagged by dsRBD-His18, whereas dsRBD-His6 treated cells show much higher density of endosomes and lysosomes and lower level of Cy3 fluorescence. This confocal imaging comparison directly explains the difference between the two protein tags in RNAi efficiency, and unambiguously demonstrates the superior endosome escape capability of dsRBD-His18 over dsRBD-His6.
Figure 4

Comparison of endosomal escape of protein tags, dsRBD-His6 and dsRBD-His18.

Cy3-labeled chimera complexed with the two protein tags are added to LNCaP cells for 12 h, followed by Lysotracker Green staining for 4 h. Confocal laser scanning microscopy reveals homogeneous distribution of fluorescence of chimera tagged with dsRBD-His18 and reduced endosome density compared to chimera complexed with dsRBD-His6.

Cytotoxicity

Lastly, we probed the cytotoxicity of the best performing protein tag dsRBD-His18 using a standard cell viability assay (CellTiter-Blue). The assay is based on the ability of living cells to convert a redox dye (resazurin) into a fluorescent end product (resorufin). Nonviable cells lose metabolic capacity and thus do not generate fluorescent signals. As illustrated in Figure 5, virtually no toxicity was detected up to a concentration four times as high as the one used in the delivery work in reference to the untreated control. This is perhaps not too surprising due to the biocompatibility of dsRBD, a small protein of human origin. More importantly, for future in vivo applications, we envision that the small protein tag would have improved clearance capability compared with synthetic polymers and inorganic nanoparticles used for siRNA delivery.
Figure 5

Cytotoxicity evaluation of the dsRBD-His18 protein tag.

LNCaP cells are treated with the protein tag at various concentrations for 72 h, and the cell variability is quantified with CellTiter-Blue. Remarkably, dsRBD-His18 protein tag exhibits no cytotoxicity throughout the measured concentration range up to 800 nM, which is four times as high as the concentration used in the siRNA delivery experiments. The data represents mean values from triplicate measurements.

Discussion

siRNA-aptamer chimera is one of the most promising approaches for cell type-specific RNAi, owing to its low immunogenicity, ease of chemical synthesis and modification, small size, and the modularity of both the targeting aptamer block and the therapeutic siRNA segment. More importantly, employing only RNA molecules, the simple formulation of chimera-based targeted siRNA therapy leads to outstanding clinical translation1516. Due to the incapability of chimera to efficiently escape endosome, delivery nanocarriers are needed. However, almost all current targeted siRNA delivery formulations involve cationic nanocarriers such as polymers, inorganic nanoparticles, peptides, and proteins71920272838394041424344. Unfortunately, these conventional siRNA nanocarriers are unsuitable for chimera delivery, and, in fact, reverse the signature property of chimera, simple formulation for regulatory approval and clinical translation1516. This is because the charge induced complex formation is basically an aggregation process, which lacks control over aggregate size, shape, stoichiometry, chimera orientation, aptamer functionality, and reproducibility during scale-up production. In addition, the final complexes often carriers positive charges as well, which is unfavorable for systemic uses23. As a result, first clinical trials of siRNA duplexes are mainly limited to local administrations45464748. Our protein tag does not rely on high positive charge to interact with RNA molecules. In fact, it only recognizes relatively long dsRNAs (>16 bp) such as the siRNA segment and the short stem region of the aptamer in our chimera molecule. Extensive biochemistry investigations have shown that for the current length of the chimera, maximum two copies of dsRBD can bind to it with differential affinity (the first copy binds much stronger than the second copy). The gene silencing experiments conducted here reflect this effect since mixing chimera with 1× or 2× protein tags does not affect the silencing efficiency. Considering the molecular weights of the chimera (28.8 kDa) and the protein tag (24.8 kDa), molecular weight of the final complex at 1:1 binding will become 53.6 kDa. Based on well-documented size effect for in vivo drug delivery49, this size is sufficiently large to reduce premature renal clearance while still small enough for deep tissue penetration. For example, by tagging siRNA-aptamer chimera with a 20 kDa PEG, its in vivo circulating half-life has been shown to increase from approximately 30 min to 30 hours15; whereas large nanoparticles (>30 nm) have been shown to be ineffective in tumor treatment except for some hyperpermeable tumors50. In conclusion, to solve the endosome escape problem of the highly promising siRNA-aptamer chimera based therapy, we have designed a dual-block small protein by combining dsRBD and polyhistidine and identified the optimal length of polyhistidine. The resulted protein tag shares the simplicity feature of siRNA-aptamer chimera, yet offers exactly complementary functionalities. The dsRBD selectively binds to the siRNA block, leaving the targeting aptamer accessible. In terms of size, different from conventional cationic delivery vehicles, the dsRBD-His18 tagged chimera remains discrete in solution rather than forming large aggregates. In terms of functionalities, chimera and dsRBD-His18 are highly complementary to each other, and thus offer the complete set of features necessary for targeted siRNA delivery (e.g., targeting, therapeutic, siRNA protection, and endosomal escape). This platform is also universal, able to chaperone any chimera sequences for cell type-specific delivery. Largely based on natural proteins, dsRBD-His18 is an excellent candidate for potential clinical translation because of its simple structure and biodegradability. Further development of this small protein tag with in vivo testing should raise exciting opportunities for siRNA clinical translation and personalized medicine.

Methods

Materials

Vendors for specific chemicals are listed below. In general, restriction enzymes were obtained from New England BioLabs, and cell culture products were purchased from Gibco/Invitrogen.

Chimera composed of aptamer targeting PSMA and siRNA targeting GFP

ssDNA of the PSMA aptamer (39 nucleotides, 5′-GGGAGGACGATGCGGATCAGCCATGTTTACGTCACTCCT-3′) was chemically synthesized by Integrated DNA Technologies (IDT) and used as the template to generate one strand of the siRNA-aptamer chimera. For amplification, PCR was performed with 3′ primer containing the anti-sense strand of GFP siRNA (underlined) and 5′ primer containing T7 RNA polymerase promoter site (bolded). The PCR primer sequences are: 3′ primer: 5′-GGCAAGCTGACCCTGAAGTTCTTTTAGGAGTGACGTAAAC-3′ 5′ primer: 5′-TAATACGACTCACTATAGGGAGGACGATGCGG-3′ The 81 bp PCR product was put into T-A cloning pCR 2.1 vector (Invitrogen). After sequencing, positive plasmids were selected and used as the template for PCR. The resulting PCR product was separated with 2% agarose gel and recovered with QIAEX II Gel Extraction Kit (Qiagen). The purified PCR product was used as the template for in vitro transcription with MEGAscriptT7 Kit (Ambion) according to manufacturer's instruction. 2′ fluoro-modified pyrimidines (TriLink, San Diego) were added to replace CTP and UTP. RNA molecules generated by the transcription reaction were annealed with the sense strand of GFP siRNA (chemically synthesized with or without 5′-Cy3 or FAM by IDT). The sequence is 5′-(Cy3 or FAM)- CAAGCUGACCCUGAAGUUCUU-3′. For annealing, the transcripted RNA and the synthetic siRNA sense strand were mixed at molar ratio 1:1 in duplex buffer (IDT) and incubated at 94°C for 3 min followed by slow cooling to 25°C in 1 hour. The final chimera was store at −80°C.

Construction of dsRBD with varying lengths of polyhistidine

Full-length PKR gene (clone ID 8068981, BC_101475, Homo sapiens) was ordered from Open Biosystems. The DNA sequence for dsRBD is composed of the first 172 amino acids of PKR. To add polyhistidine of varying lengths to the C-terminus, four constructs were developed by PCR. 5′ primer: 5′-AAA GGA TCC ATG GCT GGT GAT CTT TCA GCA-3′, containing BamH1 site (underlined), was applied to all four constructs. The 3′ primers containing Xho1 site (bolded) are: His6: 5′-GGATCATTACACTGAGGTTTCTTCTGATAA-3′ His18: 5′-TTGTGGTGGTGGTGGTGGTGCACTGAGGTTTCTTCTGATAA-3′ His24: 5′-TTGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGCACTGAGGTTTCTTCTGATAA-3′ His30: 5′-TTGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGCACTGAGGTTTCTTCTGATAA-3′. The constructs were cloned into PET28a (+) expression vector (Novagen). The constructs for dsRBD-His6 and dsRBD-His18 were obtained using full-length PKR gene (clone ID 8068981) as PCR template, and the dsRBD-His24 and dsRBD-His30 constructs were made by grafting additional histidines to the dsRBD-His18 plasmid using PCR. The restriction enzyme sites for BamH1 and Xho1 were introduced in the PCR primers for cloning. dsRBD-His6 construct was introduced with two stop codons (TAA and TGA) before the Xho1 site. For the other three constructs, the reading frames cover the His6 sequence in the vector at the C-terminal end before the stop codon. The PCR products and PET28a (+) expression vector were digested with BamH1 and Xho1 enzymes. Ligation was performed with Quick Ligation Kit (BioLabs) for 5 min at room temperature. Ligates were transformed into E. coli BL21 (DE3) competent cells for expression. The plasmids were verified with DNA sequencing. The sequences for the protein tags are dsRBD-His6: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSV dsRBD-His18: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVHHHHHHLEHHHHHH dsRBD-His24: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVHHHHHHHHHHHHLEHHHHHH dsRBD-His30: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVHHHHHHHHHHHHHHHHHHLEHHHHHH Single colonies were selected and grown at 37°C for 12 h in Circlegrow medium containing 30 μg/ml kanamycin. Overnight cultures were diluted at 1:100 (v/v) into fresh medium and incubated at 37°C until the OD600 values reach 0.5–1.0. Expression was induced by addition of isopropyl-β-D-thiogalactopyranoside (IPTG, 1 mM), and cell growth was continued for another 4–5 hour at 30°C. Cells were harvested by centrifugation (Beckman JA-10 rotor) at 10,000 g for 10 min and stored at −20°C. Cells were suspended in Bug-Buster Mix (Novagen) with 5 ml reagent per gram of wet cell paste. Bug Buster Mix was added with protease inhibitor EDTA-free cocktail (Pierce), 10% glycerol, and 1.0 mM THP (Novagen). The cell suspensions were incubated on a shaker platform for 30 min at room temperature. Insoluble cell debris was removed by centrifugation (Beckman TL120) at 20,000× g for 20 min at 4°C. The soluble extracts were loaded onto affinity columns with Ni-charged His Bind Resin (Novagen). Following washing with binding buffer and washing buffer, the desired proteins were eluted with 6 volume elution buffer (Novagen). The eluted proteins were dialyzed with PBS containing 10% glycerol and 0.1% (v/v) β-mercaptoethanol for 24 hours. Purified proteins were probed using 12% SDS-PAGE and stained with Coomassie Brilliant Blue G-250 (Bio-Rad). Protein concentrations were determined with the Bio-Rad Protein Assay with bovine serum albumin as the standard.

Functional characterization of siRNA-aptamer chimera

To test the functionality of the siRNA block, the chimera described above and GFP siRNA control (Qiagen) at a final concentration of 50 nM were transfected into C4-2 prostate cancer cells stably expressing GFP using Lipofectamine RNAi MAX (Invitrogen) following the instructions provided by the manufacturer. To evaluate the targeting specificity of the aptamer block, PSMA-positive LNCaP cells and PSMA-negative PC3 cells were treated with complex of chimera and dsRBD-His18 (chimera/protein tag molar ratio at 1:2, 100 nM chimera) in serum free medium for 2 hours, followed by incubation in complete medium for another 12 h. DAPI (30 nM) was added to stain cell nuclei. Fluorescent images were captured on an Olympus IX-71 inverted microscope equipped with 5 long-pass filters and a colored CCD camera.

Characterization of RNA binding capability of the four protein tags

The binding capabilities of the four polyhistidine modified dsRBD proteins were evaluated by native agarose gel. The chimera was labeled with FAM at the 5′ end of siRNA's sense strand (IDT). To prepare chimera/dsRBD complex, chimera (5 μM, 10 μl) was incubated with the protein tags at protein/chimera molar ratios of 1, 2, or 4 for 1 h at 4°C. Bound chimera and unbound chimera were quantified on 1% agarose gel using a Macro imaging system (Lightools Research, CA).

Evaluation of endosomal escape

PSMA-expressing LNCaP cells were seeded on 35 mm glass-bottom petri dishes (MatTeck Corp) at a density of 5 × 104 cells/well for 24 hours in RPMI 1640 supplemented with 10% FCS. Complexes of chimera labeled with Cy3 (IDT) and protein tags (His6 and His18) were added to LNCaP cells in serum-free medium for 2 hours, followed by incubation in complete medium for 12 hours. LysoTracker Green DND-26 (80 nM, Invitrogen) was then added for 4 hours at 37°C. Images were captured on a confocal laser scanning microscope (LSM 510, Carl Zeiss, Germany).

Microscopy and flow cytometry studies of gene knockdown efficacy

C4-2 prostate cancer cells expressing GFP were seeded into 35 mM glass-bottom petri dishes for confocal imaging or 6-well plates for flow cytometry. Cells were treated with chimera & dsRBD-His18 and compared with five control groups including no treatment, treated with GFP-siRNA alone, chimera alone, a random sequenced siRNA with the protein tag (His18), and chimera with protein tag (His6) for 2 h in serum free media and then incubated in complete media for 60 h. Confocal images were again obtained with LSM 510 confocal microscope equipped with argon (488 nm) and HeNe (543 nm) lasers; and quantitative flow cytometry investigation was done on a BD FACSCantoII flow cytometer.

Cytotoxicity assay

LNCaP cells were seeded in 96-well plate at 4 × 103/well for 24 hours, and then treated with different concentrations of dsRBD-His18 protein tag for 72 hours. CellTiter-Blue reagent (20 μl) was added into each well. After 4 h incubation at 37°C, cell viability was assessed by fluorescence intensity at 590 nm (excitation 570 nm) on a TECAN infinite M200 microplate reader.

Author Contributions

X.H.G. conceived the idea. H.Y.L. and X.H.G. designed the experiments. H.Y.L. performed the experiments. H.Y.L. and X.H.G. analyzed the data and wrote the paper.
  49 in total

1.  The influence of polymeric properties on chitosan/siRNA nanoparticle formulation and gene silencing.

Authors:  Xiudong Liu; Kenneth A Howard; Mingdong Dong; Morten Ø Andersen; Ulrik L Rahbek; Mads G Johnsen; Ole C Hansen; Flemming Besenbacher; Jørgen Kjems
Journal:  Biomaterials       Date:  2007-02       Impact factor: 12.479

2.  Electrostatic ligand coatings of nanoparticles enable ligand-specific gene delivery to human primary cells.

Authors:  Jordan J Green; Eugene Chiu; Elizaveta S Leshchiner; Julie Shi; Robert Langer; Daniel G Anderson
Journal:  Nano Lett       Date:  2007-03-16       Impact factor: 11.189

3.  Emerging application of quantum dots for drug delivery and therapy.

Authors:  Lifeng Qi; Xiaohu Gao
Journal:  Expert Opin Drug Deliv       Date:  2008-03       Impact factor: 6.648

Review 4.  Nanotechnology and aptamers: applications in drug delivery.

Authors:  Etgar Levy-Nissenbaum; Aleksandar F Radovic-Moreno; Andrew Z Wang; Robert Langer; Omid C Farokhzad
Journal:  Trends Biotechnol       Date:  2008-06-19       Impact factor: 19.536

5.  Nucleoside modifications modulate activation of the protein kinase PKR in an RNA structure-specific manner.

Authors:  Subba Rao Nallagatla; Philip C Bevilacqua
Journal:  RNA       Date:  2008-04-21       Impact factor: 4.942

6.  Mechanisms and optimization of in vivo delivery of lipophilic siRNAs.

Authors:  Christian Wolfrum; Shuanping Shi; K Narayanannair Jayaprakash; Muthusamy Jayaraman; Gang Wang; Rajendra K Pandey; Kallanthottathil G Rajeev; Tomoko Nakayama; Klaus Charrise; Esther M Ndungo; Tracy Zimmermann; Victor Koteliansky; Muthiah Manoharan; Markus Stoffel
Journal:  Nat Biotechnol       Date:  2007-09-16       Impact factor: 54.908

Review 7.  Factors affecting the clearance and biodistribution of polymeric nanoparticles.

Authors:  Frank Alexis; Eric Pridgen; Linda K Molnar; Omid C Farokhzad
Journal:  Mol Pharm       Date:  2008-08-04       Impact factor: 4.939

8.  Efficient in vivo delivery of siRNA to the liver by conjugation of alpha-tocopherol.

Authors:  Kazutaka Nishina; Toshinori Unno; Yoshitaka Uno; Takayuki Kubodera; Tadashi Kanouchi; Hidehiro Mizusawa; Takanori Yokota
Journal:  Mol Ther       Date:  2008-02-12       Impact factor: 11.454

9.  Evaluation of the safety, tolerability and pharmacokinetics of ALN-RSV01, a novel RNAi antiviral therapeutic directed against respiratory syncytial virus (RSV).

Authors:  John DeVincenzo; Jeffrey E Cehelsky; Rene Alvarez; Sayda Elbashir; Jens Harborth; Iva Toudjarska; Lubomir Nechev; Veeravagu Murugaiah; Andre Van Vliet; Akshay K Vaishnaw; Rachel Meyers
Journal:  Antiviral Res       Date:  2007-12-26       Impact factor: 5.970

10.  Lung delivery studies using siRNA conjugated to TAT(48-60) and penetratin reveal peptide induced reduction in gene expression and induction of innate immunity.

Authors:  Sterghios Athanasios Moschos; Simon Wyn Jones; Mark Michael Perry; Andrew Evan Williams; Jonas Sten Erjefalt; John James Turner; Peter John Barnes; Brian Stephen Sproat; Michael John Gait; Mark Andrew Lindsay
Journal:  Bioconjug Chem       Date:  2007-08-21       Impact factor: 4.774

View more
  23 in total

Review 1.  Peptide carriers to the rescue: overcoming the barriers to siRNA delivery for cancer treatment.

Authors:  James C Cummings; Haiwen Zhang; Andrew Jakymiw
Journal:  Transl Res       Date:  2019-07-29       Impact factor: 7.012

Review 2.  Aptamers as Therapeutic Agents: Has the Initial Euphoria Subsided?

Authors:  S K Haßel; G Mayer
Journal:  Mol Diagn Ther       Date:  2019-06       Impact factor: 4.074

3.  A ribonucleoprotein octamer for targeted siRNA delivery.

Authors:  Wanyi Tai; Junwei Li; Eva Corey; Xiaohu Gao
Journal:  Nat Biomed Eng       Date:  2018-07-12       Impact factor: 25.671

Review 4.  Functional peptides for siRNA delivery.

Authors:  Wanyi Tai; Xiaohu Gao
Journal:  Adv Drug Deliv Rev       Date:  2016-08-13       Impact factor: 15.470

Review 5.  Aptamer-based targeted therapy.

Authors:  Guizhi Zhu; Xiaoyuan Chen
Journal:  Adv Drug Deliv Rev       Date:  2018-08-17       Impact factor: 15.470

Review 6.  Aptamer-Drug Conjugates.

Authors:  Guizhi Zhu; Gang Niu; Xiaoyuan Chen
Journal:  Bioconjug Chem       Date:  2015-07-14       Impact factor: 4.774

7.  EpCAM Aptamer-siRNA Chimera Targets and Regress Epithelial Cancer.

Authors:  Nithya Subramanian; Jagat R Kanwar; Rupinder K Kanwar; JagadeeshBabu Sreemanthula; Jyotirmay Biswas; Vikas Khetan; Subramanian Krishnakumar
Journal:  PLoS One       Date:  2015-07-15       Impact factor: 3.240

8.  Analysis and Identification of Aptamer-Compound Interactions with a Maximum Relevance Minimum Redundancy and Nearest Neighbor Algorithm.

Authors:  ShaoPeng Wang; Yu-Hang Zhang; Jing Lu; Weiren Cui; Jerry Hu; Yu-Dong Cai
Journal:  Biomed Res Int       Date:  2016-02-03       Impact factor: 3.411

9.  Selective Targeting to Glioma with Nucleic Acid Aptamers.

Authors:  Shraddha Aptekar; Mohit Arora; Clare Louise Lawrence; Robert William Lea; Katherine Ashton; Tim Dawson; Jane Elizabeth Alder; Lisa Shaw
Journal:  PLoS One       Date:  2015-08-07       Impact factor: 3.240

10.  Cell-type-specific, Aptamer-functionalized Agents for Targeted Disease Therapy.

Authors:  Jiehua Zhou; John J Rossi
Journal:  Mol Ther Nucleic Acids       Date:  2014-06-17       Impact factor: 10.183

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.