Literature DB >> 23667664

Serum peptidome variations in a healthy population: reference to identify cancer-specific peptides.

Kun He1, Xin-Yu Wen, Ai-Ling Li, Tao Li, Jie Wang, Hong-Xia Wang, Na Wang.   

Abstract

The emergence of mass spectrometry (MS)-based signatures as biomarkers has generated considerable enthusiasm among oncologists. However, variations in normal individuals also exist, and a better understanding of serum peptide patterns of healthy individuals will be important for further exploring disease-specific serum peptide patterns. Following development of a serum peptide pattern platform, we analyzed 500 serum samples obtained from healthy individuals. Samples from breast (n = 84), lung (n = 70), and rectal (n = 30) cancer patients were also examined. Extensive data analysis revealed negligible contributions of age to serum peptide patterns except in healthy individuals between 20-30 and 60+ years of age. Gender-related variations in the serum patterns of healthy individuals were only observed in 20-30 year-old individuals. Our results revealed substantial variation in individual peptide profiles, but 65 peptides were detected at a 20% higher frequency in the healthy population. A peptide profile was developed for each type of cancer, containing 10 discriminating peptides not prevalent in healthy individuals. Sequence identification of 111 signature peptides revealed that they fell into several tight clusters and most were exopeptidase products of serum resident proteins. We have obtained a MS-based serum peptide profile for healthy individuals, providing a reference for observing the occurrence of cancer-specific peptides.

Entities:  

Mesh:

Substances:

Year:  2013        PMID: 23667664      PMCID: PMC3648468          DOI: 10.1371/journal.pone.0063724

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

The emergence of mass spectrometry (MS)-based signatures as biomarkers has generated considerable enthusiasm among oncologists and analytical chemists [1]. MS techniques permit the resolution of hundreds of small- to medium-sized peptides from only microliters of serum. Villanueva and colleagues demonstrated that cancer can be detected and classified based on serum peptides generated as a result of tumor protease activity [2]. These so-called proteomic patterns entered mainstream proteomics with the publication of a Lancet study in 2002, which was quickly followed by a significant number of research studies and reviews. Several recent reports have highlighted MS-based determinations of specific peptide patterns that indicate the presence of tumors with very high sensitivity and specificity [3]–[16]. These studies have been performed on high resolution instruments using matrix-assisted laser desorption/ionization (MALDI) ion sources and time-of-flight (TOF) ion detectors [2], [10]–[16]. More sophisticated instrumentation such as Fourier Transform (FT) MS/MS permits identification of a larger number of peptide sequences15. Recently, affinity bead–based purification has been developed and adopted by some investigators, since spherical beads have larger combined surface areas and a higher binding capacity than small-diameter spots [14]–[19]. The pattern of serum peptides produced by various disease states holds a great deal of disease-specific diagnostic information. It is hoped that panels of tens to hundreds of peptide markers can transcend the heterogeneity of serum samples to generate a high level of diagnostic specificity. Measuring panels of peptidome markers might be more sensitive and specific than conventional biomarker approaches. However, critics have voiced concerns regarding several sources of bias in serum proteomics-based biomarker discovery. Among them, age and gender are the main sources of bias that may affect the composition and relative abundance of serum peptides [20]. Therefore, a better understanding of peptide patterns in serum from healthy individuals will be important for further exploring disease-specific serum peptide profiles. In this study, we address whether the parameters of gender and age influence serum peptide patterns in healthy individuals. The study included 500 serum samples from healthy men and women between 20 and 80 years of age. Samples from breast, lung, and rectal cancer patients were examined as well. Extensive data analysis revealed negligible contributions of age to serum peptide patterns except in healthy individuals between 20–30 and 60+ years of age. and that gender-related variation in serum patterns in healthy individuals occurred only between 20–30 years of age. Our results showed that peptide profiles varied individually, but that 65 peptides were detected at a 20% higher frequency in the healthy population. A peptide profile was developed for each type of cancer, containing 10 discriminating peptides not prevalent in healthy individuals. Sequence identification of 111 signature peptides revealed that they fell into several tight clusters and most were exopeptidase products of serum resident proteins

Materials and Methods

Reagent

Purification kit copper-chelated magnetic bead was prepared from our lab[21]. Calibration standards containing nine peptides were used as artificial markers (Bruker Daltonik) and consisted of the following molecules with average molecular masses given in parentheses: angiotensin II (1046.54180), angiotensin I (1296.68480), substance P (1347.73540), bombesin (1619.82230), ACTH clip1-17 (2093.08620), ACTH clip18–39 (2465.19830), somatostatin (3147.47100), Ins bov(5734.55700), ubiquitin(8565.88500).

The ethics statement

After we obtained approval from the ethics committee of 301 General Hospital and the ethics committee of the first clinical hospital of Jilin university, all donors had signed the consent forms.

Serum samples

Blood samples from healthy volunteers and were collected from 301 General Hospital and subjected to physical examination and defined as clinical healthy. Patients diagnosed with lung cancer, breast cancer and rectal cancer were collected from the first clinical hospital of Jilin university (Table S1, Table S2 and Table S3). All samples were collected following standard clinical protocol. The no-anticoagulated blood samples were collected in the morning before the donors had breakfast and allowed to clot at room temperature for two hours, and centrifuged at 1500–2000 rpm for 15 min. Sera were transferred to four cryovials, and stored frozen at −80°C until further use. For the reproducibility experiments, sera from blood samples of 10 healthy volunteers were pooled as quality control sera. When serum arrived the mass spectrometry (MS) lab, each cryovial of sample was thawed on ice and used to generate ten smaller aliquots (20 µL each) in micro-eppendorf tubes and stored at −80°C until further use. Each serum sample had therefore been frozen and thawed twice before it was subjected to peptide extraction and MS analysis.

Copper-chelated magnetic beads peptide extraction and MALDI-TOF-MS (Mass Spectrometry)

Copper-chelated magnetic beads prepared in our lab were used for extracting peptides of serum. A 5-µL aliquot of a homogeneous magnetic beads solution was transferred to a 0.2-mL thin-walled PCR tube, and 50 µL of binding solution was added and mixed thoroughly. The tubes were placed in a magnetic bead separator (MBS) to fix the magnetic beads, and the supernatant was aspirated. After the binding step, 20 µL binding solution was added and mixed in the PCR-tube. Then, 5 µL serum sample was added, mixed and then placed in the MBS device. The supernatant was aspirated, and 100 µL of wash solution was added and mixed with the magnetic beads. After final washing step, bound peptides were eluted by incubation of 20 µL elution solution for 10 min before collecting the elution solution using the MBS device. 1 µL of the eluent was mixed with 1 µL of matrix (HCCA) solution. 1 µL was spotted onto a 600 µm-diameter spot size 384 MTP target plate (Bruker Daltonik) and left to dry. The peptide and protein calibration standard (1 µL) in the same matrix was applied to target spots in proximity to the serum samples for external calibration of the instrument. The processed samples were analyzed by a liner MALDI-TOF/TOF mass spectrometer (Ultraflex; Bruker Daltonics) equipped with a pulsed ion extraction source. The MALDI-TOF-MS system was controlled by flex control software v.2.0 (Bruker Daltonics). Ionization was achieved by irradiation with a nitrogen laser (337 nm) operating at 4 Hz. Ions were accelerated at 20 kV with 250 ns of pulsed ion extraction delay. Each spectrum was detected in linear positive mode and was externally calibrated using a mixture of peptide/protein standards between 1000 and 10000 Da.

Peptide sequencing

FT-ICR tandem mass spectrometer (Bruker Daltonics) is equipped with a 9.4 T superconducting magnet and nano HPLC system. We used nanoESI source equipped with an angled off-axis spraying system in the positive ion mode. The voltage applied to the metal-coated capillary entrance of the electrospray source was set between-1200 V and −1600 V. The extracted peptides were desalted and sequenced by autoMSn mode with MS/MS boost function. The Q FTMS was set up to do MS/MS scan. The selected ion was fragmented by collision-induced dissociation (CID). All mass spectra were acquired in the broadband mode in the mass range from m/z 300 to 3000 with 512 k data points. The spectra were calibrated externally with Agilent ES tuning mix (catalog number G2421A, Palo Alto, CA) by four-point calibration. The instrument was controlled using software Apex 1.0 and the data was analyzed by DataAnalysis 3.4. (Bruker Daltonics). All MS/MS data in a run were deconvoluted and then transferred to a file (.mgf), and were input into the search engine Mascot (www.matrixscience.com). Peptide mass tolerance was set at 10 ppm, fragment ion mass tolerance was set at 0.01, and the mass type of parent peptide and peptide fragment were set at monoisotopic.

Signal processing

Spectra were converted into excel file format included m/z value and signal intensities using the FlexAnalysis 2.0 software. Every single spectrum was smoothed curve, baseline subtraction and peak labeling. All spectra qualified mass peaks (signal-to-noise ratio>5) with mass-to-charge ratios (m/z) between 1000 and 10000 Dalton were compiled labeled. All peak intensities were normalized to the total ion current of m/z and all spectra were then taken for alignment. We normalized and aligned peaks from distinct spectra using our MatchPeaks software. Alignment starts with the first peak [whose mass to-charge ratio (m/z) is denoted by X] as an “anchor”. If another peak has m/z  =  Y, we define the relative mass error to be |X _ Y|/X. The software identifies two peaks if the relative mass error is >0.3%. After normalization and alignment, peak lists were then binned by using the resolution of the peaks and a spreadsheet was created for further statistical analysis.

Classification

SIMCA P+™ software, developed in Umetrics, was also used for visualization and statistical analysis different age groups of 500 healthy individuals. After signal processing, a graphical viewer for spectra in excel format. The SIMCA P+ software begin to analyze data using statistical algorithm, Principle Component Analysis (PCA), Partial Least Square (PLS) and Orthoganal Signal Correction (OSC) and then export Mass Spectra Viewer, a visual interface for processed spectral data, plots. Finally in this paper, we analyzed all data using a straightforward chemometric approach called Partial Least Squares- Discriminant Analysis (PLS-DA)

Results

Serum peptide profiling

The serum profile of copper-chelated magnetic bead-binding peptides was detected using MALDI-TOF MS (Figure 1A) and displayed according to mass:charge ratio (m/z) (Figure 1B). Sample handling after collection was uniform, involving 2 freeze-thaw cycles to store and aliquot samples for peptide extraction and MS analysis. Peptides were extracted on copper-chelated magnetic beads, and were washed, eluted, mixed with matrix, and deposited on the MALDI target plate, followed by MALDI-TOF MS analysis. The system reproducibility was first determined with respect to relative peak intensities (Figure 1B). Samples from 500 healthy individuals of various ages were randomly distributed during processing and analysis. After the processed spectra were aligned, the data for each sample was statistically analyzed. Peptide profiles for all samples were analyzed using the Partial Least-Squares (PLS) algorithm (Figure 1A) contained in the SIMCA P+ software package. The coefficient of variance (CV) for peak intensity was calculated using 10 randomly chosen peaks with a signal:noise ratio >5 and m/z 1–10 kDa representing low-, medium-, and high-molecular weight peptides. Maximum mass shifts over the range 1–10 kDa were 0.012% for the peptide calibration mixture and 0.018% for the pooled serum sample. These results correlate with a variation of <1Da in the absolute mass shift for signals <3000 Da. The within-day (Figure 1B, Table S4) and between-day (Table S4) CVs for direct MS analysis of the peptides were both <15%.
Figure 1

Peptide profiles in healthy subjects.

(A) Study overview. The diagram shows the design of the healthy serum peptidome demographic study, and the statistical analysis approach used for gender and different age groups. (B) Example of within-run reproducibility of mass spectra. Serum from a pooled healthy sample (10 individuals) was prepared with copper-chelated magnetic bead extraction. Six in one day randomly selected spectra obtained by MALDI-TOF MS and pseudo gel spectra used in the analysis. The analysis m/z range is from 1 KD to 10 KD. (C) Age distribution of 500 healthy subjects. The colored fields indicate the five age groups used throughout this study. The black horizontal lines represent medians for each cohort. (D) Distribution of 65 peptides with their molecular weight ranges.

Peptide profiles in healthy subjects.

(A) Study overview. The diagram shows the design of the healthy serum peptidome demographic study, and the statistical analysis approach used for gender and different age groups. (B) Example of within-run reproducibility of mass spectra. Serum from a pooled healthy sample (10 individuals) was prepared with copper-chelated magnetic bead extraction. Six in one day randomly selected spectra obtained by MALDI-TOF MS and pseudo gel spectra used in the analysis. The analysis m/z range is from 1 KD to 10 KD. (C) Age distribution of 500 healthy subjects. The colored fields indicate the five age groups used throughout this study. The black horizontal lines represent medians for each cohort. (D) Distribution of 65 peptides with their molecular weight ranges.

Serum peptidome variability

To evaluate serum peptidome diversity and the possible effects of major demographic parameters such as gender and age on serum peptide profiling, we collected blood from 500 healthy volunteers and prepared the samples using a standard clinical protocol. Volunteers were selected for the study to yield five age groups: 20–30 years old (61 women and 22 men), 30–40 years old (68 women and 52 men), 40–50 years old (78 women and 92 men), 50–60 years old (48 women and 56 men), and over 60 years old (13 women and 10 men) (Figure 1C). Serum peptide profiles with similar chelating motifs were affinity-retrieved simultaneously. The overall peptide profiles of all samples were analyzed. Though the peptide profiles varied individually, 65 peptides were detected in a frequency of more than 20% in the healthy population, and their m/z and frequency of occurrence are listed in Figure 2. The majority of the selected peaks corresponded to peptides with molecular mass less than 5,000 Da (Figure 1D).
Figure 2

Occurrence frequency of 65 peptides in the sera of healthy individuals and patients with three types of cancer.

m/z (mass:charge ratio) indicates protonated average molecule weight (M+H) in linear MALDI-TOF-MS. Red: zero frequency in cancers; Green: <20% frequency; Blue: 20–50% frequency; Grey: >50%.

Occurrence frequency of 65 peptides in the sera of healthy individuals and patients with three types of cancer.

m/z (mass:charge ratio) indicates protonated average molecule weight (M+H) in linear MALDI-TOF-MS. Red: zero frequency in cancers; Green: <20% frequency; Blue: 20–50% frequency; Grey: >50%. To investigate whether the 65 peptides represented the serum peptide pattern of a healthy population, we also analyzed the occurrence frequency of the 65 peptides in sera of breast (n = 84), lung (n = 70), and rectal (n = 30) cancer patients. Our results showed that the majority of the 65 peptides were detected in the cancer patients with a frequency that was significantly different from the healthy population (Figure 2). It suggests that the 65 peptides can be developed into a signature for healthy individuals and provide a reference for defining cancer-specific peptide patterns. On the other hand, we discovered 3 sets of 10 distinctive peptides with a high frequency in the three different cancers respectively (Figure 3), and found that they had not been observed in the healthy population (Figure 2).
Figure 3

Peptides with >20% frequency in the sera of cancer patients and <20% frequency in healthy individuals.

Red asterisk: occurrence in three cancers with >20% frequency; Blue asterisk: occurrence in two of the three cancers with >20% frequency.

Peptides with >20% frequency in the sera of cancer patients and <20% frequency in healthy individuals.

Red asterisk: occurrence in three cancers with >20% frequency; Blue asterisk: occurrence in two of the three cancers with >20% frequency. The gender-associated serum peptide variability was negligible in the 500 samples (Figure 4A), except in the group of 20–30 year-olds. In the 20–30 age group, the first five PLS components had an R2 value of 0.82. With increasing age, the gender variability became lower, and the first five PLS components had R2 values less than 0.5. Our study also showed negligible age-associated variability in comparisons between most groups. Figure 4B contains 3D scatter plots of the first three PLS components of every pair of age groups. A significant difference appeared only in the pairing between the 20–30 and 60–80 year-old groups, where the first five PLS components had an R2 value of 0.64. Overall, the closer two age groups were, the less the variability (Figure 4B).
Figure 4

PLS analysis on the age and gender-related variations of the serum peptide profiles of healthy individuals.

(A) 3D scatter plots of PLS analysis on the serum peptide profiles derived from male (blue) and female (red) donors with different age ranges. (B) 3D scatter plots of PLS analysis on age-related variation of serum peptide profiles.

PLS analysis on the age and gender-related variations of the serum peptide profiles of healthy individuals.

(A) 3D scatter plots of PLS analysis on the serum peptide profiles derived from male (blue) and female (red) donors with different age ranges. (B) 3D scatter plots of PLS analysis on age-related variation of serum peptide profiles.

Serum peptide identification

To get higher confidence peptide identifications, we employed a hybrid FT-ICR MS/MS with a 9.4 T superconducting magnet and nano-HPLC system to acquire accurate mass measurements (within 2 ppm). Of the peptides from healthy individuals and the three groups of cancer patients, 111 were positively identified by database searches using MASCOT (Table 1). Note that the m/z values listed in Table 1 are monoisotopic and average isotopic values + H [M+H] (consistent with the results obtained with MALDI). Figure 5 depicts a typical example of the data obtained for the peptide SSSYSKQFTSSTSYNRGDSTFESKSY (Fibrinogen α), which was identified as a triple-charged ion with mass accuracy of 0.3 ppm. The 111 peptides were derived from 20 naturally occurring serum proteins, including fibrinopeptide α (FPA), ITIH4 and C3f. Interestingly, all but a few peptide sequences clustered into sets of overlapping fragments aligned within each group at either the C or N terminus and with ladder-like truncations at the opposite ends. The sequence assignments either had above-threshold scores or were unequivocally assigned as the precursor ion mass, and selected fragment ion masses (y or b) matched a particular rung in the ladder.
Table 1

Identification of serum peptides.

Protein nameNo.Mmon Mavg+HSequence
Fibrinogen a11535.691537.58ADSGEGDFLAEGGGVR
21464.651466.50DSGEGDFLAEGGGVR
31349.621351.42SGEGDFLAEGGGVR
41262.591264.34GEGDFLAEGGGVR
51205.571207.29EGDFLAEGGGVR
61076.531078.17GDFLAEGGGVR
71019.501021.12DFLAEGGGVR
81308.551310.32DSGEGDFLAEGGGV
91193.521195.23SGEGDFLAEGGGV
10920.42921.98GDFLAEGGGV
11863.40864.93DFLAEGGGV
12748.38749.84FLAEGGGV
13649.31650.71FLAEGGG
14707.31708.75DFLAEGG
151389.621391.44NRGDSTFESKSY
162552.092554.60SSSYSKQFTSSTSYNRGDSTFES
172767.222769.85SSSYSKQFTSSTSYNRGDSTFESKS
182930.282933.03SSSYSKQFTSSTSYNRGDSTFESKSY
193189.423192.40SSSYSKQFTSSTSYNRGDSTFESKSYKM
204783.094786.97SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTK
214996.215000.21SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTKRG
225333.355337.55SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHA
235900.705905.24SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV
243522.533525.67GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA
253238.523241.49SYKMADEAGSEADHEGTHSTKRGHAKSRPV
262671.172673.80SYKMADEAGSEADHEGTHSTKRGHA
272249.952252.34SYKMADEAGSEADHEGTHSTK
282121.852124.16SYKMADEAGSEADHEGTHST
292988.422991.23KMADEAGSEADHEGTHSTKRGHAKSRPV
302874.342877.08MADEAGSEADHCH3EGTHSTKRGHAKSRPV
312860.332863.06MADEAGSEADHEGTHSTKRGHAKSRPV
322761.262763.93MADEAGSEADHEGTHSTKRGHAKSRP
332292.982295.37MADEAGSEADHEGTHSTKRGHA
342729.292731.86ADEAGSEADHEGTHSTKRGHAKSRPV
352161.942164.17ADEAGSEADHEGTHSTKRGHA
362658.252660.78DEAGSEADHEGTHSTKRGHAKSRPV
372559.182561.65DEAGSEADHEGTHSTKRGHAKSRP
382090.902093.09DEAGSEADHEGTHSTKRGHA
392019.862022.01DEAGSEADHEGTHSTKRGH
401882.801884.87DEAGSEADHEGTHSTKRG
412543.222545.69EAGSEADHEGTHSTKRGHAKSRPV
422343.142345.50GSEADHEGTHSTKRGHAKSRPV
432815.322817.99GSESGIFTNTKESSSHHPGIAEFPSRG
C3f442020.102022.32SSKITHRIHWESASLLR
451305.691307.50SKITHRIHWE
461776.961779.05SKITHRIHWESASLL
471689.931691.97KITHRIHWESASLL
481448.751450.64THRIHWESASLL
49977.48979.09THRIHWE
501347.701349.54HRIHWESASLL
511054.541056.21IHWESASLL
52941.46943.05HWESASLL
53955.48957.07HCH3WESASLL
54828.38829.89HWESASL
C3 precursor55667.37668.77ASHLGLA
561854.851856.94SEETKENEGFTVTAEGK
C4a571895.021897.15RNGFKSHALQLNNRQI
581497.781499.67NGFKSHALQLNNR
59895.45896.98SHALQLNN
603199.793202.72GLEEELQFSLGSKINVKVGGNSKGTLKVLR
612703.442706.07GLEEELQFSLGSKINVKVGGNSKGTL
622304.202306.58GLEEELQFSLGSKINVKVGGNS
632377.202379.64DDPDAPLQPVTPLQLFEGRRN
ITIH4643271.633274.73MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF
652723.382726.07PGVLSSRQLGLPGPPDVPDHAAYHPF
662626.332628.95GVLSSRQLGLPGPPDVPDHAAYHPF
672357.162359.61SSRQLGLPGPPDVPDHAAYHPF
682183.092185.45QLGLPGPPDVPDHAAYHPFR
692026.992029.26QLGLPGPPDVPDHAAYHPF
701785.851787.97GLPGPPDVPDHAAYHPF
711170.571172.28GLPGPPDVPDHA
721099.531101.20GLPGPPDVPDH
731000.461002.07PGPPDVPDHA
74903.41904.96GPPDVPDHA
75832.37833.88GPPDVPDH
763155.623158.59NVHSGSTFFKYYLQGAKIPKPEASFSPR
771388.711390.60GSEMVVAGKLQDR
apoA-I783374.743377.81AELQEGARQKLHELQEKLSPLGEEMCH3RDRA
793181.733184.70QGLLPVLESFKVSFLSALEEYTKKLNTQ
802052.072054.31ATEHLSTLSEKAKPALEDL
apoA-IV812507.352509.83ISASAEELRQRLAPLAEDVRGNL
822754.362756.99GNTEGLQKSLAELGGHLDQQVEEFR
Kininogen HMW832208.052210.34KHNLGHGHKHERDQGHGHQ
841942.901945.03NLGHGHKHERDQGHGHQ
852126.012128.28GHGLGHGHEQQHGLGHGHKF
Transthyretin862450.202452.69ALGISPFHEHAEVVFTANDSGPR
873156.613159.52DSGPRRYTIAALLSPYSYSTTAVVTNPKE
882040.042042.29ALLSPYSYSTTAVVTNPKE
891395.691397.53SYSTTAVVTNPKE
901409.701411.55SYSTTAVVTNPKCH3E
Antichymotrypsin914622.494626.49SALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA
924464.424468.34LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA
934351.334355.18VETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA
942735.442738.29LMIIVPTDTQNIFFMSKVTNPKQA
952491.312493.93IIVPTDTQNIFFMSKVTNPKQA
α-1 antitrypsin964772.554776.77LEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK
974118.214121.95SIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK
982488.322491.00LMIDQNTKSPLFMGKVVNPTQK
proapolipoprotein991365.711367.54LEEYTKKLNTQ
Cytokeratin1001811.851813.88SRSGGGGGGGLGSGGSIRSSY
Protein c inhibitor1013888.153891.63SARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP
1022195.182197.62SARLNSQRLVFNRPFLMF
1032048.112050.44SARLNSQRLVFNRPFLM
prealbumin1041437.831439.70VKVLDAVRGSPAIN
105785.43786.90VVTNPKE
serum albumin1061295.641297.42DAHKSEVAHRF
1071538.761540.68DAHKSEVAHRFKD
SAA1081524.781526.74PNHFRPAGLPEKY
SP401094266.294269.96PITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
apolipoprotein CI1101461.861463.76FQKVKEKLKIDS
C1-inhibitor1111063.521065.24MGRVYDPRA

Mmon is the monoisotopic molecular weight. Mavg+H is protonated average molecule weight as listed under m/z in Figure 2 and 3.

Figure 5

NanoLC-FT-ICR MS/MS identification of a peptide, which is a fragment of protein Fibrinogen α, with sequence SSSYSKQFTSSTSYNRGDSTFESKSY and molecular weight 2930.2842 Da.

(A) Base peak ion chromatogram of serum peptides. The arrow indicates the peak including the triple-charged peptide at m/z 977.7690 (B) Mass spectrum of the ion chromatography peak indicated in (A), the diamond indicates the precursor ion at m/z 977.7690. The insert is a magnified view of the precursor ion showing a triple-charged ion at high mass accuracy (0.3 ppm). (C) Tandem mass spectrum of the triple-charged peptide at m/z 977.7690 with amino acid sequence deduced from the y ion series. Note that y ions originate at the C terminus and the sequence therefore reads backwards.

NanoLC-FT-ICR MS/MS identification of a peptide, which is a fragment of protein Fibrinogen α, with sequence SSSYSKQFTSSTSYNRGDSTFESKSY and molecular weight 2930.2842 Da.

(A) Base peak ion chromatogram of serum peptides. The arrow indicates the peak including the triple-charged peptide at m/z 977.7690 (B) Mass spectrum of the ion chromatography peak indicated in (A), the diamond indicates the precursor ion at m/z 977.7690. The insert is a magnified view of the precursor ion showing a triple-charged ion at high mass accuracy (0.3 ppm). (C) Tandem mass spectrum of the triple-charged peptide at m/z 977.7690 with amino acid sequence deduced from the y ion series. Note that y ions originate at the C terminus and the sequence therefore reads backwards. Mmon is the monoisotopic molecular weight. Mavg+H is protonated average molecule weight as listed under m/z in Figure 2 and 3.

Discussion

Serum peptidome diversity contains a rich variety of disease-specific diagnostic information. The composition of the serum peptidome is a true mirror of ongoing cellular and organ system function. Although this means that subsets of the serum peptidome can potentially reflect subtle disease events in small tissue volumes, it also means that the peptidome is constantly fluctuating in response to ongoing daily physiological events [1], [22]. Oncologists and clinical chemists fear that the level of individual peptides can be greatly influenced by various non-disease-related epidemiological factors and normal physiological conditions. Variations in normal individuals also exist and likely contribute to the difficulty in identifying disease-specific signals in serum peptide profiles. Thus, as with any biomarker discovery, great care is needed to reduce bias. In doing so, a large number of healthy individuals must be measured to define a healthy serum peptide profile. We have developed a unique platform to study a large cohort of identically collected and processed samples from 500 healthy men and women aged 20 to 80 years. Extensive analysis of MALDI-TOF MS data has suggested a negligible gender contribution to serum peptide patterns in all but those 20–30 years old. Our results further showed that there was a significant difference in peptide composition only in the pairing between the 20–30 and 60–80 year-old age groups. Moreover, the variability decreased as groups became closer in age. Age and gender are the principal potential sources of bias that may affect the molecular patterns being evaluated for diagnostic and prognostic utility. Serum peptide profiles are affected by variations in gene expression and post-transcriptional events. Recently, Villanueva reported negligible differences in serum patterns among different age groups, but divided his data into age ranges of 20–35, 35–50 and 50–80 years (20). In our experiments, age groups were divided into 10-year cohorts except above age 60, and the comparisons produced consistent results for all groups except those between 20–30 and over 60 years of age. Consistent with the report by Villanueva, gender-related variations of serum profiles in healthy individuals were observed only in those 20–30 years old. Since the lung, breast and rectal cancer patients in our study were predominantly 40 or older, age and gender are unlikely to bias the cancer serum profiles. However, age and gender-related variations should be considered when studies involve cancer patients younger than 30 years old. Other potential bias sources included sample collection, processing and storage, MS detection, and data analysis methods. These sources have been examined in previous studies and remedied in our experiments. Critically important sources of variation include blood collection tubes, clotting times and temperature, and the number of freeze-thaw cycles. Other sources include batch to-batch inconsistency of the magnetic beads, MALDI sample crystallization, and level of laser irradiation [17], [23], [24]. In addition, careful quality control procedures ensured constant peptide extraction and MS detection conditions. The magnetic bead reagent prepared in our lab displayed negligible variation between batches. The high sensitivity and reproducibility of the magnetic-bead-based platform for serum profiling, which was advocated by a recent study from Villanueva et al, were also achieved in our study [14]–[16], [18]. Peptides known to vary naturally with a high incidence (e.g., the 65 peptides observed in over 20% of the healthy cohort in Figure 2) can either be eliminated as diagnostic markers or more rigorously scrutinized for unique variants specific to disease. In contrast, peptides found to vary at a low frequency are of greater interest to biomarker discovery efforts. We observed 3 sets of signatures, each containing 10 discriminating peptides. Each set of 10 peptides was strongly associated with a particular cancer and was not present in the serum profile pattern of the healthy population. We believe the approach and findings described in this report will add to the understanding of serum peptide diversity and have subsequent applications in clinical proteomics. The identities of both normal serum peptidomes and the peptides comprising the discriminatory ions can potentially lead to insights concerning their sources and relationships to the underlying physiology and pathology. Although advances in MS now make it possible to identify small- to medium-sized peptides in serum using only microliter-volume samples, this technology remains a significant barrier to application to clinical proteomics. The direct identification of peptides in tryptic-digested serum remains difficult because of the complexity of samples. A direct MS/MS identification of the peptides using MALDI TOF/TOF is not possible because of the presence of multiple peptides, even in small mass windows. Although offline nanoLC-MALDI could solve this problem, we think that the best method to identify peptides in complex mixtures is Fourier transform MS (FT-MS), in which the exact mass of the peptide of interest is obtained [25]–[27]. Using FT-MS and enrichment strategies to characterize the low-molecular-weight region of the proteome, we have identified 111 peptides, including 20 peptides with > 20% frequency in healthy sera (Figure 2, Figure 3 and Table 1), 6 discriminatory ions for lung cancer, 4 for rectal cancer, and 8 for breast cancer (Figure 3 and Table 1). Villanueva et al. reported that sequence identification of 61 signature peptides revealed that they fall into several tight clusters, and most are generated by exopeptidase activities that confer cancer type-specific differences [2]. The serum peptides employed as cancer signatures are not classical markers, but they may serve as an endogenous substrate pool for the real biomarkers, i.e. proteases. Because they are not released by cancers, they likely represent a nonspecific epiphenomenon associated with the presence of cancer [1], [2], [23]. We demonstrated that the majority of the peptides identified in both healthy individuals and cancer patients were clustered into sets of overlapping fragments aligned with ladder-like truncations; most are exopeptidase products of serum resident proteins. How peptide profiling may contribute mechanistically to both cancer-specific and cancer type-specific classifications remains unexplained and may require a great deal of future study to understand. Nonetheless, the differences are statistically significant, holding important information that may have direct clinical utility as surrogate biomarkers in the form of proteome metabolomic products. We believe that proteolytic degradative patterns in the serum peptidome of both cancer patients and healthy controls hold information important for defining cancer-specific peptide profiles that may have direct clinical utility as surrogate biomarkers. Breast cancer patient demographics. (DOC) Click here for additional data file. Rectal cancer patient demographics. (DOC) Click here for additional data file. Non-small-cell lung cancer patient demographics. (DOC) Click here for additional data file. Reproducibility of mass spectra profiled by copper-chelated beads and MALDI-TOF analysis. (DOC) Click here for additional data file.
  25 in total

1.  The use of plasma surface-enhanced laser desorption/ionization time-of-flight mass spectrometry proteomic patterns for detection of head and neck squamous cell cancers.

Authors:  Scott G Soltys; Quynh-Thu Le; Gongyi Shi; Robert Tibshirani; A J Giaccia; Albert C Koong
Journal:  Clin Cancer Res       Date:  2004-07-15       Impact factor: 12.531

2.  Plasma protein profiling for diagnosis of pancreatic cancer reveals the presence of host response proteins.

Authors:  John M Koomen; Lichen Nancy Shih; Kevin R Coombes; Donghui Li; Lian-chun Xiao; Isaiah J Fidler; James L Abbruzzese; Ryuji Kobayashi
Journal:  Clin Cancer Res       Date:  2005-02-01       Impact factor: 12.531

3.  Standardized approach to proteome profiling of human serum based on magnetic bead separation and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry.

Authors:  Sven Baumann; Uta Ceglarek; Georg Martin Fiedler; Jan Lembcke; Alexander Leichtle; Joachim Thiery
Journal:  Clin Chem       Date:  2005-04-21       Impact factor: 8.327

Review 4.  Tandem mass spectrometry for peptide and protein sequence analysis.

Authors:  Joshua J Coon; John E P Syka; Jeffrey Shabanowitz; Donald F Hunt
Journal:  Biotechniques       Date:  2005-04       Impact factor: 1.993

5.  Evaluation of serum protein profiling by surface-enhanced laser desorption/ionization time-of-flight mass spectrometry for the detection of prostate cancer: I. Assessment of platform reproducibility.

Authors:  O John Semmes; Ziding Feng; Bao-Ling Adam; Lionel L Banez; William L Bigbee; David Campos; Lisa H Cazares; Daniel W Chan; William E Grizzle; Elzbieta Izbicka; Jacob Kagan; Gunjan Malik; Dale McLerran; Judd W Moul; Alan Partin; Premkala Prasanna; Jason Rosenzweig; Lori J Sokoll; Shiv Srivastava; Sudhir Srivastava; Ian Thompson; Manda J Welsh; Nicole White; Marcy Winget; Yutaka Yasui; Zhen Zhang; Liu Zhu
Journal:  Clin Chem       Date:  2005-01       Impact factor: 8.327

6.  Use of proteomic patterns in serum to identify ovarian cancer.

Authors:  Emanuel F Petricoin; Ali M Ardekani; Ben A Hitt; Peter J Levine; Vincent A Fusaro; Seth M Steinberg; Gordon B Mills; Charles Simone; David A Fishman; Elise C Kohn; Lance A Liotta
Journal:  Lancet       Date:  2002-02-16       Impact factor: 79.321

7.  Proteomics and bioinformatics approaches for identification of serum biomarkers to detect breast cancer.

Authors:  Jinong Li; Zhen Zhang; Jason Rosenzweig; Young Y Wang; Daniel W Chan
Journal:  Clin Chem       Date:  2002-08       Impact factor: 8.327

8.  Analysis of the low molecular weight fraction of serum by LC-dual ESI-FT-ICR mass spectrometry: precision of retention time, mass, and ion abundance.

Authors:  Kenneth L Johnson; Christopher J Mason; David C Muddiman; Jeanette E Eckel
Journal:  Anal Chem       Date:  2004-09-01       Impact factor: 6.986

9.  Serum diagnosis of pancreatic adenocarcinoma using surface-enhanced laser desorption and ionization mass spectrometry.

Authors:  Jens Koopmann; Zhen Zhang; Nicole White; Jason Rosenzweig; Neal Fedarko; Sanjay Jagannath; Marcia I Canto; Charles J Yeo; Daniel W Chan; Michael Goggins
Journal:  Clin Cancer Res       Date:  2004-02-01       Impact factor: 12.531

10.  Serum peptide profiling by magnetic particle-assisted, automated sample processing and MALDI-TOF mass spectrometry.

Authors:  Josep Villanueva; John Philip; David Entenberg; Carlos A Chaparro; Meena K Tanwar; Eric C Holland; Paul Tempst
Journal:  Anal Chem       Date:  2004-03-15       Impact factor: 6.986

View more
  5 in total

Review 1.  Contribution of the plasma and lymph Degradome and Peptidome to the MHC Ligandome.

Authors:  Laura Santambrogio; Hans-Georg Rammensee
Journal:  Immunogenetics       Date:  2018-10-20       Impact factor: 2.846

2.  Delineation of concentration ranges and longitudinal changes of human plasma protein variants.

Authors:  Olgica Trenchevska; David A Phillips; Randall W Nelson; Dobrin Nedelkov
Journal:  PLoS One       Date:  2014-06-23       Impact factor: 3.240

3.  Quantity - but not diversity - of secreted peptides and proteins increases with age in the tree frog Pithecopus nordestinus.

Authors:  Douglas O Mariano; Juliana M Sciani; Marta M Antoniazzi; Carlos Jared; Katia Conceição; Daniel C Pimenta
Journal:  J Venom Anim Toxins Incl Trop Dis       Date:  2021-04-02

4.  Calbindin S100A16 Promotes Renal Cell Carcinoma Progression and Angiogenesis via the VEGF/VEGFR2 Signaling Pathway.

Authors:  Ning Wang; Rongjiang Wang; Jianer Tang; Jianguo Gao; Zhihai Fang; Meng Zhang; Xufeng Shen; Lingqun Lu; Yu Chen
Journal:  Contrast Media Mol Imaging       Date:  2022-09-15       Impact factor: 3.009

5.  MALDI-TOF analysis of blood serum proteome can predict the presence of monoclonal gammopathy of undetermined significance.

Authors:  Francisca Barceló; Rosa Gomila; Ivan de Paul; Xavier Gili; Jaume Segura; Albert Pérez-Montaña; Teresa Jimenez-Marco; Antonia Sampol; José Portugal
Journal:  PLoS One       Date:  2018-08-02       Impact factor: 3.240

  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.