Literature DB >> 23023003

Structure-function dissection of the frizzled receptor in Drosophila melanogaster suggests different mechanisms of action in planar polarity and canonical Wnt signaling.

David Strutt1, Daisy Madder, Varun Chaudhary, Peter J Artymiuk.   

Abstract

Members of the Frizzled family of sevenpass transmembrane receptors signal via the canonical Wnt pathway and also via noncanonical pathways of which the best characterized is the planar polarity pathway. Activation of both canonical and planar polarity signaling requires interaction between Frizzled receptors and cytoplasmic proteins of the Dishevelled family; however, there has been some dispute regarding whether the Frizzled-Dishevelled interactions are the same in both cases. Studies looking at mutated forms of Dishevelled suggested that stable recruitment of Dishevelled to membranes by Frizzled was required only for planar polarity activity, implying that qualitatively different Frizzled-Dishevelled interactions underlie canonical signaling. Conversely, studies looking at the sequence requirements of Frizzled receptors in the fruit fly Drosophila melanogaster for canonical and planar polarity signaling have concluded that there is most likely a common mechanism of action. To understand better Frizzled receptor function, we have carried out a large-scale mutagenesis in Drosophila to isolate novel mutations in frizzled that affect planar polarity activity and have identified a group of missense mutations in cytosolic-facing regions of the Frizzled receptor that block Dishevelled recruitment. Interestingly, although some of these affect both planar polarity and canonical activity, as previously reported for similar lesions, we find a subset that affect only planar polarity activity. These results support the view that qualitatively different Frizzled-Dishevelled interactions underlie planar polarity and canonical Wnt signaling.

Entities:  

Mesh:

Substances:

Year:  2012        PMID: 23023003      PMCID: PMC3512140          DOI: 10.1534/genetics.112.144592

Source DB:  PubMed          Journal:  Genetics        ISSN: 0016-6731            Impact factor:   4.562


FRIZZLED (Fz) proteins constitute a family of predicted sevenpass transmembrane receptors phylogenetically related to the G-protein coupled receptor (GPCR) superfamily and conserved throughout the animal kingdom (Barnes ; Fredriksson ; Wang ). A characteristic feature is the amino-terminal extracellular domain containing a cysteine-rich domain (CRD) that mediates binding to ligands of the Wnt family (Bhanot ; Wang ). Whether Fz receptors act as bona fide GPCRs is controversial, although evidence that Fz proteins can act directly as ligand-dependent guanine nucleotide exchange factors for G-proteins, in the normal manner of GPCRs, has recently been presented (reviewed in Koval ; Malbon 2011). Nevertheless, it remains unclear whether such an activity is obligatory for all or any of Fz receptor signaling functions. Activation of Fz receptors leads to a variety of downstream responses, of which the best characterized is the so-called “canonical” signaling pathway that leads to stabilization and nuclear translocation of β-catenin and activation of transcription, in addition to a range of less-well-understood β-catenin-independent “noncanonical” outputs that include the so-called “Wnt/Ca2+” and planar cell polarity (PCP) pathways (reviewed in Angers and Moon 2009; Van Amerongen and Nusse 2009). Of particular interest is the role of the multidomain cytoplasmic proteins of the Dishevelled (Dsh in flies and frogs, Dvl in other vertebrates) family, which appear to mediate most—if not all—downstream responses to Fz receptors, by interacting with a variety of downstream effectors (reviewed in Wharton 2003; Wallingford and Habas 2005). The fruit fly Drosophila melanogaster has been an important in vivo model for dissection of Fz function. The fruit fly genome encodes four Fz proteins, of which only two, Fz itself (also known as Fz1) and Fz2 are known to couple to downstream signaling pathways. Mutations in the gene result in viable adults that exhibit so-called “planar polarity” defects in the orientation in the plane of the tissue of cuticle structures such as hairs and bristles, and non-cell-autonomous effects are observed when loss of gene activity is studied in genetic mosaics (Gubb and García-Bellido 1982; Vinson and Adler 1987). Notably, a small class of alleles show only a cell-autonomous defect in cuticle polarity and do not show the nonautonomous effects, leading to the conclusion that has two activities that can be separated by mutation, functioning both in the transmission and in the reception/interpretation of planar polarity signals (Adler ; Vinson and Adler 1987). In addition to this role in planar polarity, Fz also acts redundantly with Fz2 to mediate canonical β-catenin-dependent signaling in response to binding of the Wnt ligand Wingless (Wg) (Bhat 1998; Kennerdell and Carthew 1998; Bhanot ; Chen and Struhl 1999; Müller ), and acting together with the co-receptor Arrow (Arr) a homolog of vertebrate LRP5/6 (Wehrli ). Unlike Fz, Fz2 shows no activity in planar polarity specification; however, it has been implicated in other poorly understood signaling events (Cohen ; Mathew ; Mosca and Schwarz 2010). The fruit fly genome encodes a single Dsh protein, which is absolutely required for both planar polarity and β-catenin-dependent signaling downstream of Fz and Fz2 (Klingensmith ; Siegfried ; Krasnow ). Different domains of Dsh have been implicated in coupling to the two different downstream pathways: the Dishevelled, Egl-10, Pleckstrin (DEP) domain and to a lesser extent the PSD95, Dlg1, ZO-1 (PDZ) domain are required for planar polarity activity, whereas different regions of the DEP domain and the PDZ and DIX domains are needed for β-catenin-dependent signaling (Axelrod ; Boutros ; Penton ). Given the importance of Fz receptors, there is great interest in understanding their mechanism of function and, in particular, the structural requirements necessary to mediate Dsh recruitment and the different downstream responses. This has led to numerous studies in both Drosophila and other organisms, which are summarized below. The amino-terminal extracellular domain of Fz receptors, including the 120 amino acid CRD that mediates binding to Wnt ligands, is generally assumed to be important for signaling activity, although the precise roles are controversial. For canonical function, the extracellular domains of Drosophila Fz and Fz2 are interchangeable, although that of Fz2 confers a greater ability to activate signaling, most likely due to a stronger affinity for Wnt ligands (Rulifson ; Strapps and Tomlinson 2001). However, the CRD itself is at least partly dispensable for canonical activity (Chen ; Povelones and Nusse 2005; Wu and Mlodzik 2008), leading to the suggestion that Wnt binding to the CRD does not itself stimulate Fz receptor activity but instead serves to locally increase the concentration of Wnt. Wnt ligand binding does not seem to be necessary for planar polarity activity in Drosophila (Lawrence ; Chen ), and as no point mutations in the CRD have been isolated by random mutagenesis, it has been suggested that the CRD may not be required for planar polarity activity (Rulifson ; Povelones ). However, point mutations elsewhere in the extracellular domain, or deletion of the entire CRD, do affect planar polarity activity (Jones ; Boutros ; Chen ; Wu ; Povelones ; Wu and Mlodzik 2008), and it has been proposed that it may directly mediate intercellular communication by interacting with the partner protein Strabismus in neighboring cells (Strutt and Strutt 2008; Wu and Mlodzik 2008), although others have disputed this (Chen ). Numerous lines of evidence indicate the importance of the seven transmembrane domains (hereafter TM1–7) and the associated three extracellular loops (ECL1–3) and intracellular loops (ICL1–3), collectively referred to as the 7TM region. Within the 7TM region, the extracellular loops appear to be least important, as in random mutagenesis experiments in Drosophila, only two point mutations have been isolated in these regions that only weakly affect receptor activity (Povelones ), and in vitro mutagenesis of ECL1 and ECL3 in a vertebrate Fz receptor also does not significantly affect canonical activity (Cong ). A small number of mutations in the TM domains that affect Drosophila Fz function have been isolated. Interestingly, none of these lie in TM1–3. Mutations in TM4–7 affect both canonical and planar polarity function, and almost all show reduced protein levels, possibly indicative of deficits in protein maturation or stability (Adler ; Jones ; Povelones ). The intracellular loops and intracellular C-terminal tail are the most intensively studied regions of Fz receptors, due to their possible roles in interacting with intracellular effectors of signaling. Systematic substitution of pairs of amino acids in ICL1–3 to alanines in a vertebrate Fz receptor has revealed that all three are required for canonical signaling (Cong ). Similarly, studies of Drosophila Fz have also identified amino acid changes in ICL1–3 that affect both planar polarity and canonical signaling activity (Jones ; Povelones ; Wu ). The most critical region in the C-terminal tail appears to be the “KTxxxW” motif lying just downstream of the end of TM7 (Drosophila Fz residues 557–561). Mutation of the lysine, threonine, and tryptophan residues results in loss of canonical activity in vertebrate receptors (Umbhauer ; Cong ) and loss of canonical and planar polarity activity in Drosophila receptors (Wu ). Also close to the end of TM7 and interleaved with the KTxxxW motif are two serine residues that have been identified as potential protein kinase C (PKC) phosphorylation sites, and such phosphorylations have been proposed to regulate Fz activity (Djiane ). Conversely, there seems to be little essential function for residues downstream of the KTxxxW. Although this region has been implicated in the correct subcellular localization and canonical activity of Drosophila Fz2 (Wu ; Wu ), truncation of a Xenopus receptor does not alter canonical function, albeit in an overexpression assay (Umbhauer ). The only conserved structural motif identified beyond the KTxxxW motif in Fz receptors is a predicted C-terminal PDZ-binding motif, and several studies in different organisms have found no role for this (Sawa ; Itoh ; Umbhauer ; Strutt 2001; Wong ; Wu ), although another study has suggested a function in downregulating Drosophila Fz planar polarity activity (Djiane ). A major role of the intracellular loops and intracellular C-terminal tail is in mediating interactions with Dsh. In vertebrate receptors, mutations in ICL1, ICL3 and the KTxxxW motif have been shown to block Dsh binding (Umbhauer ; Wong ; Cong ; Tauriello ). Weak interactions occur between the PDZ domain of Dsh proteins and the KTxxxW region (Wong ; Tauriello ), but multiple lines of evidence suggest that the main interactions are mediated by the Dsh DEP domain (Axelrod ; Rothbächer ; Axelrod 2001; Shimada ), most likely binding cooperatively to both the intracellular loops and the C-terminal tail (Tauriello ). As the same regions of Fz receptors mediate Dsh recruitment and signaling via both canonical and planar polarity pathways, the simplest model is that this recruitment is essential for activity in both cases. Nevertheless, it has also been proposed that membrane recruitment of Dsh may in fact be required only for planar polarity, as DEP domain lesions that block recruitment show a deficit in planar polarity but not canonical signaling, and the ability of vertebrate Fz homologs to recruit Dsh proteins does not necessarily equate with activation of canonical signaling (Axelrod ; Boutros ; Rothbächer ; Axelrod 2001; Simons ). Conversely, other studies suggest a correlation between the ability of Dsh proteins to bind Fz receptors, possibly via the PDZ rather than the DEP domain, and the ability to mediate canonical signaling (Umbhauer ; Wong ; Cong ; Wu ; Tauriello ). With regard to the requirement of Fz receptors to interact with Dsh in planar polarity signaling, an intriguing observation is that mutation of proline-278 in ICL1 of Drosophila Fz gives rise to a protein expressed at normal levels but cannot recruit Dsh to cell membranes (Jones ; Axelrod 2001; Amonlirdviman ) and that this leads specifically to a disruption of the cell-autonomous planar polarity activity of but does not disrupt cell–cell transmission of polarity information. Similarly, a mutation in the KTxxxW motif of Drosophila Fz that blocks Dsh binding also results in a protein that is deficient only in cell-autonomous planar polarity activity (Wu ; Wu and Mlodzik 2008). Taken together these results suggest that it may be a general property of Fz receptors that they need to bind to Dsh to mediate cell-autonomous planar polarity activity, but not to pass polarity information to neighboring cells (Amonlirdviman ). Based on the described studies, two groups have proposed similar models for Fz receptor function, which suggest that there is a common mechanism underlying activation of canonical signaling and planar polarity specification. This is based on the twin observations of a correlation between the strength of deficit in canonical signaling or planar polarity activity for individual mutant alleles (Povelones ) and that a failure to recruit Dsh to membranes equates with failure to signal in both pathways, suggesting that common Fz–Dsh interactions underlie both activities (Wu ). Although these models are plausible, they are based on the analysis of relatively small numbers of mutations (Table 1). It remains a major question whether the primary role of the intracellular loops and the C-terminal intracellular domain is to recruit Dsh and whether a failure to do so always similarly compromises both canonical and planar polarity activities. Similarly, there is still only sparse evidence for the suggestion that receptors that localize to the membrane but fail to recruit Dsh always show a deficit in only cell-autonomous planar polarity function. Other outstanding issues that might be answered by analysis of a larger number of mutations include the roles of the extracellular domain and CRD, the extracellular loops, and the C-terminal tail after the KTxxxW motif.
Table 1 

Properties of amino acid changes in Drosophila Fz

AlleleAmino acid changeRegion of proteinOriginPlanar polarity phenotypePlanar polarity nonautonomyCanonical phenotypeProtein levelsExtra tarsal jointsaCanonical phenotype (wing margin)aComments
fzP21I70delCRDEMSStrongbYesbNoneb2.9 ± 0.6Strongfz21 (FlyBase)
fzHE11C229YExtraEMSStrongbYesbWeakcNormalb2.1 ± 0.6
Weakc
fzI12P278LICL1EMSStrongbNobModeratecNormalb, c2.0 ± 0.2Intermediatefz16, fz19 (FlyBase)
fzJ22Moderateb
fzF31P278SICL1EMSModeratedNoeWeakcNormalc1.6 ± 0.5Nofz13, fz20 (FlyBase)
fzN21Weakc
fzR53A374GICL2EMSWeakb,cPartialbWeakcNormalb,cfz24 (FlyBase)
fzTTH383YTM4ENUWeakcWeakcNormalc
fzSYG405DECL2ENUWeakcWeakc
fzEDC412RECL2ENUWeakcWeakcNormalc
fzGL31P429LTM5EMSStrongbYesbStrongcLowerb,c
V454FICL3EMSModerateb
fzHB41V454FICL3EMSStrongbYesbLowerb
fzHB52
fzR54M469RICL3EMSStrongdYeseModeratecLowerc2.8 ± 0.4Strongfz25 (FlyBase)
W500RECL3Moderateb
fzM469RM469RICL3TransgeneStrongfStrongfαTub84B promoter
fzKWI472KTM6ENUModeratecModeratecLowerc2.3 ± 0.5
fzHD21G485RTM6EMSModeratebYesbModeratec (25°)Lowerb,c (25°)Temperature sensitive
Weakc (25°)
fzH51W500XECL3EMSStrongbYesbNormal (smaller)b3.9 ± 0.3Strongfz15 (FlyBase)
fzHC52G545RTM7EMSStrongbYesbLowerb
fzMPG545ETM7ENUModeratecModeratecLowerc
fzΔSKTΔ S555 –T557C-termTransgeneStrongfStrongfαTub84B promoter
fzΔSWRNFΔ S560 –F564C-termTransgeneStrongfNogStrongfαTub84B promoter
fz565StopV565XC-termTransgeneNonefWeakfαTub84B promoter

This work.

Jones .

Povelones .

Adler .

Vinson and Adler (1987).

Wu .

Wu and Mlodzik (2008).

Materials and Methods

Fly strains and transgenes

Fly strains are described in FlyBase, except for transgenes generated for this study. P{w, Act5C-fz} flies were generated by cloning the wild-type coding sequence into the vector pP{w+, Act5C-FRT-PolyA-FRT} (Strutt 2001), generating transgenic flies, and excising the FRT-PolyA-FRT cassette in vivo. Other transgenes were generated by in vitro mutagenesis of the coding sequence fused to EGFP or EYFP (Clontech) and cloning into pP{w+, Act5C-FRT-PolyA-FRT}. transgenes were generated by adding the coding sequence for three Myc epitope tags just upstream of the mature peptide, preceded by the signal peptide sequence from the rat CD2 protein. In vitro mutagenesis was used to introduce any desired changes, before cloning into a transformation vector under control of the promoter as previously described (Strutt 2001). For use in the mutagenesis screen, a P{w, Act5C-fz} transgene insertion on the second chromosome was selected that, when crossed into a fz background, showed no phenotype in the adult leg, notum, or eye down a dissecting microscope. Inspection of adult wings on the compound microscope showed that this transgene rescues through much of the wing, but does show weak swirls toward the distal tip, possibly due to overexpression of . This transgene also fully rescues the wing margin phenotype of fz clones. Levels of expression in the pupal wing were verified by Western blotting using rabbit anti-Fz (Bastock and Strutt 2007) and mouse monoclonal anti-actin AC-40 (Sigma) as loading control.

Mutagenesis to identify loss-of-function mutations in a fz transgene

Males of genotype ; P{w, Act5C-fz}; fz were mutagenized with either 35 mM ethyl methanesulphonate (EMS) or 4 mM N-ethyl-N-nitrosourea (ENU) as described (Grigliatti 1998) and mated to females of genotype ; fz, P{w+; hs-hid}, . Males were remated to fresh females every day, before being discarded on the fourth day. Progeny were heat-shocked during larval stages for 2 hr at 38° to kill TM3, P{w+; hs-hid}, bearing progeny. Remaining progeny of genotype ; P{w, Act5C-fz}/+; fz were scored for visible planar polarity phenotypes under a dissecting microscope once they emerged as adults. Flies showing a planar polarity phenotype were recrossed to flies of genotype ; fz to select for mutations that could be recovered in the germline.

Analysis of mutations isolated

To identify changes in the coding region of mutagenized transgenes, genomic DNA was isolated from 20 adult flies and the coding region isolated by PCR using primers specific for flanking regions in the transgene, before sequencing using internal primers. Adult tarsal phenotypes were assessed in males of genotype ; P{w, Act5C-fz}/+; fz raised at 25°. Rescue of canonical signaling activity in the adult wing margin was assessed in flies of genotype ; P{w, Act5C-fz*}/vg, UAS-flp; fz, y, which harbor clones of fz homozygous mutant cells that can be identified in the wing margin by lack of expression of , if the clones survive to adulthood by virtue of being rescued by the presence of the P{w, Act5C-fz*} transgene. Pupal wing planar polarity phenotypes were assessed in flies of genotype y w Ubx-FLP/+; P{w, Act5C-fz*}/+; fz; arm-lacZ FRT80B. Activities of in vitro mutagenized transgenes were analyzed in the same way, using transgene insertions on the second chromosome. Similarly, activities of existing mutations in the locus were analyzed using the same genotypes, except the allele was substituted for fz and no transgene was present. Mosaic patches of expression from transgenes expressing GFP-tagged proteins were generated by crossing the transgene-bearing flies to Ubx-FLP (to excise any FRT-PolyA-FRT cassette that might be present) and the Δ2–3 transposase source (to mobilize the transgene, thus causing mosaic expression). To assess numbers of extra tarsal joints, adult male first legs from at least 10 flies were examined under the compound microscope and the number of joints between tarsal segments counted (with partial joints that extended at least halfway into the segment being counted as 1). In Tables 1 and 3, the number of extra tarsal joints is expressed as the average plus or minus the standard deviation. To assess the strength of canonical signaling the defect in the anterior wing margin was examined under the compound microscope. At least six wings were examined for each genotype and the proportions of the wing margin containing mutant bristles and “notches” with no bristles present were measured. The proportions of the wing margin showing either notching or rescued patches of bristles varied widely both within and between genotypes, probably due to stochastic variation in rate and time of clone induction. For rescue using P{w, Act5C-fz} transgenes, genotypes that showed on average >10% notching of the anterior wing margin were scored as “strong,” and those with no notches and ∼20% or more occupied by mutant bristles (representing rescued fz fz2 tissue) were scored as “rescued,” with those with smaller notched regions and/or less rescued tissue scored as “intermediate” (see Supporting Information, Table S1). For rescue using P{w, ArmP-Myc-fz2} transgenes (which express relatively weakly, such that a wild-type coding region rescues notching, but gives only ∼10% of the anterior wing margin containing mutant bristles), >10% notching was scored as strong and 0–10% notching as “moderate.”
Table 3

Summary of properties of fz mutations examined in this study

AlleleAmino acid changeRegion of proteinPlanar polarity phenotype (extra tarsal joints)Canonical phenotype (wing margin)Frizzled localizationDishevelled localizationFlamingo localizationPlanar polarity nonautonomy
Alleles isolated by mutagenesis of Act5C-fz transgene on second chromosome
68G2C53FCRD2.7 ± 0.5IntermediateLost/CytoplasmicLostReducedStrong
70A2.1C53YCRD3.5 ± 0.5StrongLost/CytoplasmicLostReducedStrong
26C1C107YCRD2.9 ± 0.3StrongLost/CytoplasmicLostReducedStrong
25A3P112LCRD2.3 ± 0.8IntermediateLost/CytoplasmicLostReducedStrong
73A2R274CICL11.6 ± 0.5RescuedAt junctionsLostAt junctionsNone
27C2R274HICL10.8 ± 0.4RescuedAt junctionsLostAt junctionsNone
39B21.1 ± 0.3RescuedAt junctionsLostAt junctionsNone
17A1P278LICL11.8 ± 0.4IntermediateAt junctionsLostAt junctionsNone
30E22.3 ± 0.8IntermediateAt junctionsLostAt junctionsNone
18B3P278SICL11.0 ± 0.0RescuedAt junctionsReducedAt junctionsNone
79F31.0 ± 0.0RescuedAt junctionsReducedAt junctionsNone
8A4E279KICL13.3 ± 0.8RescuedAt junctionsLostAt junctionsNone
4C3E373KICL21.0 ± 0.0RescuedAt junctionsReducedAt junctionsNone
11A20.9 ± 0.3RescuedAt junctionsReducedAt junctionsNone
72A4H383LTM41.3 ± 0.5RescuedAt junctionsReducedAt junctionsNone
37E2H383YTM41.7 ± 0.5RescuedAt junctionsLostAt junctionsNone
26C2P390LTM42.4 ± 0.5IntermediateReduced/Cytopl.LostReducedModerate
30A32.3 ± 0.5IntermediateReduced/Cytopl.LostReducedModerate
8F2G444RTM51.9 ± 0.6StrongAt junctionsLostAt junctionsNone
70B4I451FICL32.1 ± 0.6RescuedAt junctionsLostAt junctionsNone
50E1M469KICL32.3 ± 0.5StrongAt junctionsLostAt junctionsNone
7A3M469TICL31.0 ± 0.0RescuedAt junctionsLostAt junctionsMild
G477ATM6
39D1I472KTM61.8 ± 0.8RescuedAt junctionsLostAt junctionsNone
76B1G545RTM72.6 ± 0.9StrongLost/CytoplasmicLostReducedStrong
19D3Y553XC-term2.3 ± 0.8IntermediateReduced/Cytopl.LostReducedModerate
25B2S554FC-term2.3 ± 0.7StrongAt junctionsLostAt junctionsNone
6E3W561XC-term2.4 ± 0.5RescuedAt junctionsLostAt junctionsNone
14B22.2 ± 0.4RescuedAt junctionsLostAt junctionsNone
47B32.9 ± 0.4IntermediateLostLostReducedStrong
70A2.3W561RC-term2.1 ± 0.3RescuedAt junctionsLostAt junctionsNone
Existing fz alleles
fzP21I70delCRD2.9 ± 0.6StrongLostLostReducedStrong
fzJ22P278LICL12.0 ± 0.2IntermediateAt junctionsLostAt junctionsNone
fzN21P278SICL11.6 ± 0.5RescuedNDNDNDND
fzR54M469RICL32.8 ± 0.4StrongReducedLostReducedModerate
W500RECL3
fzH51W500XECL33.9 ± 0.3StrongLostLostNDND
In vitro generated mutations in Act5C-fz-EGFP transgene insertions
fzIE > AA #4I375AICL22.8 ± 0.4StrongNDNDNDND
E376A
fzIE > AA #5I375AICL22.7 ± 0.5StrongNDNDNDND
E376A
fzKL > AA #2K464AICL32.5 ± 0.5StrongNDNDNDND
L465A
fzKL > AA #3K464AICL32.6 ± 0.7StrongNDNDNDND
L465A
fzAAXXXA #1K556AC term2.8 ± 0.4StrongReducedLostReducedStrong
T557A
W561A
fzAAXXXA #2K556AC term3.0 ± 0.02StrongNDNDNDND
T557A
W561A
fzW561Y #1W561YC term0.1 ± 0.3RescuedNDNDNDND
fzW561Y #7W561YC term0.1 ± 0.3RescuedNDNDNDND
This work. Jones . Povelones . Adler . Vinson and Adler (1987). Wu . Wu and Mlodzik (2008). To verify that the tarsal joint phenotype of mutations correlates with the strength of the ommatidial polarity defect, eyes from three mutations isolated in the screen that gave different strength tarsal phenotypes were sectioned. 7A3 gives a weak tarsal phenotype (1.0 extra joints) and showed a weak ommatidial polarity defect (9% misoriented), 14B2 gives an intermediate tarsal phenotype (2.2 extra joints) and an intermediate ommatidial polarity defect (28% misoriented) and 24C1 gives a strong tarsal phenotype (3.4 extra joints) and a strong ommatidial polarity defect (35% misoriented). Pupal wings were dissected, immunolabeled, and imaged as previously described (Strutt 2001). Phalloidin conjugated to Alexa-568 (Molecular Probes) was used to label F-actin. Primary antibodies used were mouse monoclonal anti-ßgal (Promega), rabbit anti-ßgal (Cappel), rabbit anti-GFP (Abcam), mouse monoclonal anti-Arm [Developmental Studies Hybridoma Bank (DSHB)], mouse monoclonal anti-Fmi#74 (DSHB) (Usui ), rabbit anti-Fz (Bastock and Strutt 2007), and rat anti-Dsh (Strutt ). Adult wings and legs were mounted in Gary’s Magic Mountant (GMM).

Modeling of Fz receptor structure

No experimental structure of Fz is yet known, although those of other distantly related GPCRs including rhodopsin (Palczewski ) and β2-adrenergic receptor (Cherezov ) are available. Therefore, to investigate the possible structural consequences of the missense mutations isolated, the sequence of Fz was submitted to the iterative threading assembly refinement (I-TASSER) WebServer (Zhang 2007; Roy ), which used multiple threading alignments and structure assembly simulations to produce a homology-based model of the protein. The figures based on the model were made using Pymol (http://www.pymol.org). The resulting model conforms to the expected 7TM pattern, with seven transmembrane helices, three intracellular loops, and a cytoplasmic C-terminal region. Note that in Tables 1, 2, and 3, the positions of residues to transmembrane regions or loops are based on predictions of protein topology generated using TMHMM (Krogh ) and that these predictions do not precisely agree with the predictions from the homology model (e.g., TMHMM places M469 in ICL3 rather than within a transmembrane helix). The degree of conservation at each position as shown in Figure 6D was calculated from the SIFT data (Ng and Henikoff 2001). The SIFT algorithm assigns each possible substitution at a particular residue a “normalized” value such that if the substitution is completely tolerated the value is 1.0 and if not tolerated at all the value is 0. The sum of the 20 probabilities for each possible residue substitution was calculated, and the reciprocal of this sum was used as a measure of conservation.
Table 2

Summary of nucleotide and amino acid changes induced in the Act5C-fz transgene

AlleleaNucleotide changeMutagenAmino acid changeRegionSIFT scoreb
22E1G5AEMSW2XExtra
6H4C40TEMSQ14XExtra
68G2G158TENUC53FExtra (CRD)0.00
70A2.1G158AENUC53YExtra (CRD)0.00
26C1G320AEMSC107YExtra (CRD)0.00
25A3C335TEMSP112LExtra (CRD)0.00
3A2C355TEMSR119XExtra (CRD)
19B2ΔT413–G708EMSM138–172XcExtra (CRD)
49D2C739TENUR247XTM1
19A3G746AEMSW249XTM1
37F3G746AEMSW249XTM1
27C2G821AEMSR274HICL10.00
39B2G821AENUR274HICL10.00
73A2C820TENUR274CICL10.00
17A1C833TEMSP278LICL10.00
30E2C833TEMSP278LICL10.00
18B3C832TEMSP278SICL10.03
79F3C832TENUP278SICL10.03
8A4G835AEMSE279KICL10.01
68B1T869AENUL290XTM2
20F4C985AEMSQ329XECL1
9C2C994TEMSR332XECL1
12F1G1061AEMSW354XTM3
16A3T1091AEMSL364XTM3
15D4G1110AEMSW370XICL2
53D3G1110AENUW370XICL2
4C3G1117AEMSE373KICL20.00
11A2G1117AEMSE373KICL20.00
37E2C1147TEMSH383YTM40.00
72A4A1148TENUH383LTM40.00
24C1G1161AEMSW387XTM4
34A3G1160AEMSW387XTM4
63E1G1159AENUW387XTM4
26C2C1169TEMSP390LTM40.00
30A3C1169TENUP390LTM40.00
8F2G1330AEMSG444RTM50.00
70B2A1351TENUI451FICL30.00
5E2ΔG1382–T1394EMST462S–464XcICL3
50E1T1406AENUM469KICL30.00
7A3T1406C, G1430CEMSM469T, G477AICL3, TM60.00, 0.01
29D2C1411TEMSR471XTM6
39D1T1415AEMSI472KTM60.05
6D2ΔT1421–C1425EMSF475W–496XcTM6
63D2T1457AENUL486XTM6
8D4G1500AEMSW500XECL3
53B4G1500AENUW500XECL3
78A1G1500AENUW500XECL3
76B1G1633CENUG545RTM70.00
19D3T1659AEMSY553XIntra
14D3C1661TEMSS554FIntra0.00
25B2C1661TEMSS554FIntra0.00
6E3G1682AEMSW561XIntra
14B2G1683AEMSW561XIntra
47B3G1683AENUW561XIntra
70A2.3T1681CENUW561RIntra0.00

Missense mutations indicated in boldface type.

SIFT score is shown for missense mutations and represents the normalized probability of the amino acid substitution occurring in a homologous protein (Ng and Henikoff 2001). Substitutions with probabilities of ≤0.05 are predicted to be deleterious.

Deletions that cause frameshifts. In 6D2, amino acids from codon 475 onward are replaced with WTVHSARRGITGLLVLRVLQLX. In 5E2, amino acids from codon 462 onward are replaced with SDX. In 19B2, amino acids from codon 138 are replaced with ILPGERLDCSSILGWILGSGLCCQLLVYGAHLLDX.

Figure 6 

Views of the Fz homology model. (A) Cartoon representation of the model with extracellular loops colored in white, transmembrane helices in dark gray, ICL1 in light orange, ICL2 in light green, ICL3 in light blue, and the C-terminal tail in light purple. Residues where mutation gave a strong effect on planar polarity but not on canonical activity are colored in magenta and the remaining residues in turquoise. (B) Space filling representation, orthogonal to A, of the cytoplasmic face of the model, colored as in A. (C) View as in B but with residues colored olive that cannot be mutated by GC:AT substitutions to give a deleterious change according to the SIFT algorithm (Ng and Henikoff 2001). (D) View as in B and C but with amino acids colored on a scale from red (highly conserved) to white (unconserved). Degree of conservation is based on using the SIFT algorithm to determine how tolerant a position is to a change in identity of the amino acid present in the wild-type Fz coding sequence.

Missense mutations indicated in boldface type. SIFT score is shown for missense mutations and represents the normalized probability of the amino acid substitution occurring in a homologous protein (Ng and Henikoff 2001). Substitutions with probabilities of ≤0.05 are predicted to be deleterious. Deletions that cause frameshifts. In 6D2, amino acids from codon 475 onward are replaced with WTVHSARRGITGLLVLRVLQLX. In 5E2, amino acids from codon 462 onward are replaced with SDX. In 19B2, amino acids from codon 138 are replaced with ILPGERLDCSSILGWILGSGLCCQLLVYGAHLLDX.

Results

Generation of novel fz mutations in vivo by chemical mutagenesis

To further explore Fz receptor function, we generated a large collection of randomly induced mutations that compromise Drosophila fz planar polarity activity. As is not essentially required for viability, such mutations can be easily scored in an “F1” screen on the basis of polarity defects on the adult cuticle (Adler ; Jones ; Povelones ). However, unlike in previous studies, we did not screen for mutations in the endogenous locus, but instead assayed for loss of activity of a transgene located on the second chromosome expressing a cDNA under the heterologous Actin5C () promoter. Immunoblot analysis shows that a single copy of this transgene expresses Fz at severalfold the level found in wild-type flies (Figure S1); nevertheless, the transgene fully rescues the null Planar polarity phenotype in adult tissues (Figure 1A) with the exception of a region toward the distal tip of the wing (see Materials and Methods) and also rescues lack of fz fz2 activity in canonical signaling in the wing (Figure 1G). This transgene-based strategy has the advantage that due to the lack of introns in the transgene, it is easier to identify the induced DNA sequence changes, and the presence of the transgene on the second chromosome greatly simplifies testing for a deficit in canonical signaling activity in subsequent assays.
Figure 1 

Adult planar polarity and canonical signaling phenotypes of existing fz alleles. (A–F) Distal regions of adult male first legs of the indicated genotypes. Solid arrowheads indicate complete joints between tarsal segments, and shaded arrowheads indicate partially formed joints. Note complete rescue of ectopic joint phenotype seen in fz by the Act5C-fz transgene. (G–L) Whole adult male wings, or enlargements of distal margin (G’–L’), containing loss-of-function clones lacking activity of an allelic series of fz alleles in combination with fz2. Distal is to the right and anterior is up. Clones marked by presence of yellow bristles (lighter in color and indicated by solid arrowheads in G’–L’). Most alleles cause notching or distortion of the wing margin with loss of yellow bristles in the mutant tissue; however, rescue by the Act5C-fz transgene (G) or the presence of fz (L) leads to rescue of yellow bristles in clone tissue indicating that canonical signaling activity is present.

Adult planar polarity and canonical signaling phenotypes of existing fz alleles. (A–F) Distal regions of adult male first legs of the indicated genotypes. Solid arrowheads indicate complete joints between tarsal segments, and shaded arrowheads indicate partially formed joints. Note complete rescue of ectopic joint phenotype seen in fz by the Act5C-fz transgene. (G–L) Whole adult male wings, or enlargements of distal margin (G’–L’), containing loss-of-function clones lacking activity of an allelic series of fz alleles in combination with fz2. Distal is to the right and anterior is up. Clones marked by presence of yellow bristles (lighter in color and indicated by solid arrowheads in G’–L’). Most alleles cause notching or distortion of the wing margin with loss of yellow bristles in the mutant tissue; however, rescue by the Act5C-fz transgene (G) or the presence of fz (L) leads to rescue of yellow bristles in clone tissue indicating that canonical signaling activity is present. Initially mutations were induced by exposure of flies to the alkylating agent EMS, which induces largely GC:AT DNA base changes (Ashburner ). However, such changes are predicted only to result in deleterious missense mutations in ∼30% of amino acids in the Fz coding sequence (Figure S2). We therefore switched to the mutagen ENU, which is reported to induce both GC:AT and AT:GC changes (Ashburner ) and potentially raises the number of codons that are predicted to suffer a deleterious change to ∼55% (Figure S2). A total of ∼100,000 F1 progeny of the appropriate genotype from fathers treated with EMS were screened, as well as ∼110,000 from fathers treated with ENU. A total of 148 single flies showing a putative lesion were identified, as assayed by the appearance of a planar polarity phenotype visible on the notum, legs, or eyes down a dissecting microscope. After recrossing to confirm the presence of a phenotype and transmission through the germline, a total of 55 stable lines were recovered bearing mutations that lead to a loss of Planar polarity activity (Table 2). The coding sequence of the transgene in these strains was isolated by PCR and sequenced, and in all cases at least one DNA change was found. Nonsense mutations leading to a premature stop codon and truncation of the predicted protein product were found in 25 strains and missense mutations leading to an amino acid change were found in 27 strains. Three strains harbored deletions leading to a change of reading frame and shortly afterward a premature stop codon. ENU did not yield AT:GC changes or missense mutations at a higher rate than EMS (Table 2). Notably, all of the amino acid mutations produced by the missense mutations are predicted to be mutagenic, using the SIFT tool, which sorts intolerant from tolerant substitutions on the basis of conservation of the particular amino acid in related proteins (Ng and Henikoff 2001). This is consistent with the induced mutations being the cause of the mutant phenotype. Focusing on the missense mutations, and nonsense mutations lying in or beyond the end of TM7, it is notable that as for the previous two screens (Jones ; Povelones ) (Table 1), most of our mutations map to the intracellular loops and C-terminal tail (Figure 2). However, we also obtained four lying in the extracellular CRD (C53F, C53Y, C107Y, and P112L). In common with the previous studies, we found no missense mutations in TM1–3, but also in common with these studies did find mutations in TM4–7. Overall we have approximately doubled the number of missense mutations in identified by chemical mutagenesis (compare Tables 1–3).
Figure 2 

Topology of Fz and the location of selected mutations. The diagram depicts the amino acid sequence of Fz, showing the positions of amino acids in the extracellular region (top, “Out”), the transmembrane regions (middle), and the intracellular loops and C-terminal tail (bottom, “In”). Colored amino acids indicate missense mutations and nonsense mutations in TM7 and further C-terminal, isolated in our screen. Red indicates amino acid changes that give rise to Fz proteins that do not stably localize to junctions. Turquoise and magenta indicate changes where Fz protein still localizes to junctions at apparently normal levels and that show either phenotypes consistent with similar defects in canonical and planar polarity activity (turquoise) or a strong defect in planar polarity activity but normal canonical activity (magenta).

Topology of Fz and the location of selected mutations. The diagram depicts the amino acid sequence of Fz, showing the positions of amino acids in the extracellular region (top, “Out”), the transmembrane regions (middle), and the intracellular loops and C-terminal tail (bottom, “In”). Colored amino acids indicate missense mutations and nonsense mutations in TM7 and further C-terminal, isolated in our screen. Red indicates amino acid changes that give rise to Fz proteins that do not stably localize to junctions. Turquoise and magenta indicate changes where Fz protein still localizes to junctions at apparently normal levels and that show either phenotypes consistent with similar defects in canonical and planar polarity activity (turquoise) or a strong defect in planar polarity activity but normal canonical activity (magenta).

Assays for phenotypic analysis of in vivo and in vitro-generated fz mutations

To characterize the mutations isolated, we carried out a number of assays, looking both at adult phenotypes and effects on planar polarity establishment in the developing pupal wing. Truncations in the Fz protein prior to TM7 are known to cause complete loss of activity, with rare exceptions that may be caused by translational read-through of stop codons (Jones ; Povelones ). We therefore focused our analysis of alleles from our screen on missense mutations, and nonsense mutations that introduce stop codons only after TM7 (Figure 2 and Table 3). We also carried out some assays on existing alleles and a number of transgenes expressing in vitro mutagenized forms of , which we generated.

Assaying planar polarity activity using an adult phenotype:

To quantify the strength of the adult planar polarity phenotype, we initially sought to establish a simple and robust assay. Although planar polarity is most often studied in the wing, in this tissue the main phenotype is a swirling of the trichomes, which is difficult to quantify, and so in past studies the alternative measure of the number of cells showing multiple trichomes (“multiple hair cells”) has been used (Adler ; Povelones ). However, the production of multiple trichomes is believed to be a only secondary effect of altering hair polarity (Adler ; Wong and Adler 1993) and is also very sensitive to genetic modifiers in the background of the stock (Adler ; Jones ). An alternative tissue where planar polarity defects can be readily quantified is the adult eye, where numbers of ommatidia showing polarity defects can be counted (e.g., Zheng ), but this requires the production of semithin histological sections. For these reasons, we turned to a third adult tissue, the leg. mutant flies show polarity defects in their legs both in terms of the orientation of bristles, but also in the arrangement of the five tarsal segments at the distal end of the leg, exhibiting extra and mirror-image duplicated joints between segments (Held ). We note that the number of additional joints (above the normal number of four) correlates well with the allele strengths determined in other assays (Figure 1, B–F, and Table 1; see Materials and Methods).

Assaying canonical signaling activity using an adult phenotype:

We also quantified the ability of the mutated transgenes to transduce canonical Wg signaling. In a previous study this was done by measuring the ability of maternally contributed activity to rescue the cuticle phenotype of fz fz2 double mutant embryos (Povelones ). In our experiments, as the mutations were induced in a transgene inserted in a different chromosome from the and loci, we were able to directly assay for the rescuing ability of zygotic gene activity. As it is a well-characterized, easy to score phenotype (Figure 1, G–L), we measured the ability of Fz Fz2 transduction of Wg signaling to specify bristle fate in the adult wing margin (Chen and Struhl 1999; Chen ).

Investigating pupal wing phenotypes:

To gain insights into the mechanistic basis underlying the defects in canonical and planar polarity signaling observed, we studied effects on protein distribution and trichome polarity in the pupal wing. As points of reference we use existing endogenous alleles (Figure 3, A–I), in particular the strong fz allele that harbors a nonsense mutation producing a early truncation of the protein and the cell-autonomous fz allele that has the P278L substitution in ICL1 that is known to block Dsh recruitment to junctions (Jones ; Axelrod 2001).
Figure 3 

Pupal wing phenotypes of existing fz alleles. (A–I) Confocal microscope images of 28 hr (A, B, D, E, G, H, I) or 32 hr (C and F) pupal wings containing loss-of-function clones for the indicated genotypes marked by lack of lacZ expression (green labeling), showing distribution of Fz (red or white in A, D, G), Dsh (red or white in B, E, H), Fmi (blue or white in B, E, I), or labeled with phalloidin to reveal F-actin (red in C and F). Distal is to the right; arrows in C and F indicate trichome polarity in nonmutant cells on distal side of clones, showing nonautonomous effect on polarity of fz but not fz.

Pupal wing phenotypes of existing fz alleles. (A–I) Confocal microscope images of 28 hr (A, B, D, E, G, H, I) or 32 hr (C and F) pupal wings containing loss-of-function clones for the indicated genotypes marked by lack of lacZ expression (green labeling), showing distribution of Fz (red or white in A, D, G), Dsh (red or white in B, E, H), Fmi (blue or white in B, E, I), or labeled with phalloidin to reveal F-actin (red in C and F). Distal is to the right; arrows in C and F indicate trichome polarity in nonmutant cells on distal side of clones, showing nonautonomous effect on polarity of fz but not fz. Marked mosaic patches (“clones”) of cells lacking endogenous activity were generated in wings uniformly expressing the mutagenized transgene, and four characteristics were assessed: The levels and distribution of Fz protein produced by the transgene in otherwise fz mutant tissue. This gives a measure of both the amounts of Fz produced that can correctly localize to the adherens junctions regions and the ability of this protein to localize asymmetrically in the plane of the tissue and correctly specify planar polarity (Strutt 2001). Previous studies have measured total levels of mutant Fz proteins by Western blotting (Jones ; Povelones ). However, we believe that measuring junctional levels by immunolabeling is a more relevant assay, as this appears to be the functional population, at least for planar polarity activity. The distribution of Dsh in the junctional region. In the absence of fz activity, Dsh is not recruited to junctions, but additionally there are Fz mutant proteins that localize to junctions but fail to recruit Dsh (Axelrod 2001; Shimada ; Amonlirdviman ; Wu ). The distribution of Fmi in the junctional region. Reducing fz activity is known to result in Fmi remaining localized to the adherens junction region of cells, but losing its characteristic asymmetric distribution to proximal and distal cell boundaries (Usui ). Strong loss of fz activity also results in reduction of the levels of Fmi at junctions and some redistribution to apical cell membranes (Strutt and Strutt 2008). The orientation of trichomes around the fz clones expressing the mutated transgene: alleles that disrupt nonautonomous function result in trichomes outside the fz clone pointing inwards toward the clone (Vinson and Adler 1987; Adler ).

Comparison of the effects of different mutations on fz activity

As expected, the missense alleles from our screen had a range of strengths of planar polarity defect, showing from about one to almost four additional tarsal joints (Table 3 and Figure S3). Comparison with existing strong alleles such as fz, fz, and fz (Adler ; Jones ), which show around three or more additional joints (Figure 1, B–D, Tables 1 and 3), suggests that our strongest missense alleles can be considered to lack planar polarity activity. Three missense changes isolated in our screen also exist in extant endogenous alleles, these being P278L (fz, fz and 17A1, 30E2), P278S (fz, fz and 18B3, 79F3), and I472K ( and 39D1). These provide points of comparison for the effects of amino acid changes in the context of endogenous alleles or our transgenes. The endogenous alleles generally show slightly higher numbers of additional joints (∼0.5; Tables 1 and 3), suggesting a weaker effect of changes in the context of the transgene, most likely due to higher expression levels than from the endogenous locus. Thus our screen will probably tend to underestimate the effects of particular amino acid changes.

Strong loss-of-function mutations:

Nine alleles from our screen, affecting seven residues, behaved as strong loss-of-function mutations, showing defects in canonical signaling and autonomous and nonautonomous planar polarity activities (marked in Figure 2 and Figure S3). Considering the pupal wing phenotypes, all behave qualitatively the same as strong loss-of-function alleles such as fz, showing little or no Fz or Dsh at junctions, reduced symmetric Fmi junctional labeling and significant Fmi localized apically, and repolarization of trichomes outside the clone (Table 3, Figure 3, A–C, Figure 4, and Figure 5). Four such substitutions lay in the CRD (C53F, C53Y, C107Y, P112L) and from the Fz immunolabeling appeared to still produce a protein that could be seen in the cytoplasm but failed to localize to junctions. Three mutations are substitutions in TM4 and TM7 (P390L, G545R) and a truncation at the start of the C-terminal tail (Y553X), which again appear to compromise junctional localization or stability of the Fz protein. In addition, a similar result was seen for one of our mutant lines bearing a more C-terminal truncation of the tail (mutation 47B3 containing a W561X change); however, as two other lines that bear the same mutation (6E3, 14B2) show Fz immunolabeling at junctions, we conclude that 47B3 most likely bears a second-site regulatory mutation that fails to produce Fz protein.
Figure 4 

Pupal wing phenotypes of fz clones in presence of indicated mutagenized transgenes. (A–AJ) Confocal microscope images of 28-hr (A, B, D, E, G, H, J, K, M, N, P, Q, S, T, V, W, Y, Z, AB, AC, AE, AF, AH, AI) or 32-hr (C, F, I, L, O, R, U, X, AA, AD, AG, AJ) pupal wings containing loss-of-function clones of fz marked by lack of lacZ expression (green labeling), in the presence of the mutagenized transgenes bearing the indicated amino acid change. Immunolabeling reveals distribution of Fz (red or white in A, D, G, J, M, P, S, V, Y, AB, AE, AH), Dsh (blue or white in A, D, G; red or white in K, N, Q, T, W, Z, AC, AF, AI), Fmi (red or white in B, E, H; blue or white in K, N, Q, T, W, Z, AC, AF, AI). Phalloidin labeling reveals distribution of F-actin (red in C, F, I, L, O, R, U, X, AA, AD, AG, AJ). Distal is to the right; arrows indicate trichome polarity in nonmutant cells on distal side of clones, showing nonautonomous effect on polarity of C53F, C53Y, C107Y, and P112L amino acid changes.

Figure 5 

Pupal wing phenotypes of fz clones in presence of indicated mutagenized transgenes. (A–AJ) Confocal microscope images of 28 hr (A, B, D, E, G, H, J, K, M, N, P, Q, S, T, V, W, Y, Z, AB, AC, AE, AF, AH, AI) or 32 hr (C, F, I, L, O, R, U, X, AA, AD, AG, AJ) pupal wings containing loss-of-function clones of fz marked by lack of lacZ expression (green labeling), in the presence of the mutagenized transgenes bearing the indicated amino acid change. Immunolabeling reveals distribution of Fz (red or white in A, D, G, J, M, P, S, V, Y, AB, AE, AH), Dsh (blue or white in P; red or white in B, E, H, K, N, T, W, Z, AC, AF, AI), Fmi (red or white in Q; blue or white in B, E, H, K, N, T, W, Z, AC, AF, AI). Phalloidin labeling reveals distribution of F-actin (red in C, F, I, L, O, R, U, X, AA, AD, AG, AJ). Distal is to the right; arrows indicate trichome polarity in nonmutant cells on distal side of clones, showing nonautonomous effect on polarity of P390L, G545R, and Y553X. One of three W561 mutations also showed loss of Fz at junctions and resulted in nonautonomous defects, but as the other two W561 mutations produced visible protein it is likely that this allele contains other regulatory mutations.

Pupal wing phenotypes of fz clones in presence of indicated mutagenized transgenes. (A–AJ) Confocal microscope images of 28-hr (A, B, D, E, G, H, J, K, M, N, P, Q, S, T, V, W, Y, Z, AB, AC, AE, AF, AH, AI) or 32-hr (C, F, I, L, O, R, U, X, AA, AD, AG, AJ) pupal wings containing loss-of-function clones of fz marked by lack of lacZ expression (green labeling), in the presence of the mutagenized transgenes bearing the indicated amino acid change. Immunolabeling reveals distribution of Fz (red or white in A, D, G, J, M, P, S, V, Y, AB, AE, AH), Dsh (blue or white in A, D, G; red or white in K, N, Q, T, W, Z, AC, AF, AI), Fmi (red or white in B, E, H; blue or white in K, N, Q, T, W, Z, AC, AF, AI). Phalloidin labeling reveals distribution of F-actin (red in C, F, I, L, O, R, U, X, AA, AD, AG, AJ). Distal is to the right; arrows indicate trichome polarity in nonmutant cells on distal side of clones, showing nonautonomous effect on polarity of C53F, C53Y, C107Y, and P112L amino acid changes. Pupal wing phenotypes of fz clones in presence of indicated mutagenized transgenes. (A–AJ) Confocal microscope images of 28 hr (A, B, D, E, G, H, J, K, M, N, P, Q, S, T, V, W, Y, Z, AB, AC, AE, AF, AH, AI) or 32 hr (C, F, I, L, O, R, U, X, AA, AD, AG, AJ) pupal wings containing loss-of-function clones of fz marked by lack of lacZ expression (green labeling), in the presence of the mutagenized transgenes bearing the indicated amino acid change. Immunolabeling reveals distribution of Fz (red or white in A, D, G, J, M, P, S, V, Y, AB, AE, AH), Dsh (blue or white in P; red or white in B, E, H, K, N, T, W, Z, AC, AF, AI), Fmi (red or white in Q; blue or white in B, E, H, K, N, T, W, Z, AC, AF, AI). Phalloidin labeling reveals distribution of F-actin (red in C, F, I, L, O, R, U, X, AA, AD, AG, AJ). Distal is to the right; arrows indicate trichome polarity in nonmutant cells on distal side of clones, showing nonautonomous effect on polarity of P390L, G545R, and Y553X. One of three W561 mutations also showed loss of Fz at junctions and resulted in nonautonomous defects, but as the other two W561 mutations produced visible protein it is likely that this allele contains other regulatory mutations.

Mutations that produce Fz protein but fail to recruit Dsh:

The remaining amino acid changes induced in our screen that we analyzed in the pupal wing were 16 unique missense mutations affecting 12 different amino acids, all lying close to or within ICL1–3 or the C-terminal tail of Fz (turquoise and magenta in Figures 2 and 6A–C). Interestingly, all of these resemble the cell-autonomously acting fz allele (Figure 3, D–F), producing Fz protein that localizes symmetrically at apicolaterally junctions together with Fmi, failing to recruit Dsh to junctions and not causing nonautonomous trichome polarity defects in surrounding tissue (Table 3, Figures 4 and 5). In addition, the same phenotype was seen for two of our mutant lines that bear a W561X mutation that truncates the C-terminal tail within the KTxxxW motif. Views of the Fz homology model. (A) Cartoon representation of the model with extracellular loops colored in white, transmembrane helices in dark gray, ICL1 in light orange, ICL2 in light green, ICL3 in light blue, and the C-terminal tail in light purple. Residues where mutation gave a strong effect on planar polarity but not on canonical activity are colored in magenta and the remaining residues in turquoise. (B) Space filling representation, orthogonal to A, of the cytoplasmic face of the model, colored as in A. (C) View as in B but with residues colored olive that cannot be mutated by GC:AT substitutions to give a deleterious change according to the SIFT algorithm (Ng and Henikoff 2001). (D) View as in B and C but with amino acids colored on a scale from red (highly conserved) to white (unconserved). Degree of conservation is based on using the SIFT algorithm to determine how tolerant a position is to a change in identity of the amino acid present in the wild-type Fz coding sequence. Notably, alleles in this class showed a significant variation in strength of the polarity phenotype, ranging between around one and three additional tarsal segments. This may indicate that there are subtle differences in the ability of the proteins to localize to junctions or recruit Dsh, which are not easily detected by immunolabeling, but which influence the level of activity. Surprisingly, although this class of alleles shows negligible ability to recruit Dsh to junctions, many fully rescue fz fz2 activity in wing margin patterning, indicating that they retain canonical signaling ability. In particular, five alleles with strong planar polarity defects (i.e., more than two extra tarsal segments) completely rescue fz fz2 clones (magenta in Figure 2 and Figure S3). An important issue that might affect these results is that expression levels from our transgene may not be appropriate for rescuing canonical activity. We note that when assaying for planar polarity activity, our transgene insertions provide better rescue than endogenous alleles, and this may also account for the observed rescue of canonical activity. To investigate further, we tested the canonical signaling strength of existing alleles, by recombining them with a strong mutation and generating loss-of-function clones in the wing margin. Under these conditions, fz behaved similarly to alleles isolated in our screen bearing the same P278L mutation, showing only weak notching. Similarly, fz, bearing a P278S change, showed full rescue, as seen for P278S-bearing alleles from our screen. We conclude that the ability of this class of alleles to rescue canonical signaling is not simply an artifact of our assay system.

Mapping the position of missense mutations on a Fz homology model

To seek to understand the different behaviors of the isolated missense mutations in and around the 7TM region, we generated a homology-based model of the structure of Drosophila Fz (see Materials and Methods) and mapped the positions of the affected residues onto this (Figure 6, A and B). All of the mutated residues are situated in the lower half of the molecule, that is, toward the cytoplasmic face of the receptor (Figure 6A). Six of these residues (H383, P390, G444, M469, I472, and G545) are positioned in transmembrane helices and their mutation most likely affects signaling indirectly by altering the precise positioning of exposed amino acids in the intracellular loops. The other seven mutated residues are situated within the intracellular loop regions or in the C-terminal tail. A space-filling representation of the cytoplasmic face (Figure 6B) shows that two of the non-TM residues (I451, W561) are not exposed on the cytoplasmic face but appear to face upward toward the membrane (Figure 6A), and so their effect on binding is also likely to be indirect. Another three residues (E279, M469, and S554) line the inside of a deep surface pocket formed at the interface of the three intracellular loops and the C-terminal region (Figure 6B). The remaining amino acids (R274, E373, H383, and P278) form a distinct, broader cluster of residues situated close to one side of the deep pocket (Figure 6B, turquoise).

Comparison with in vitro generated mutations in fz

As previous reports have suggested a correlation between the ability of Fz receptors to recruit Dsh and function in canonical signaling, we sought to investigate the matter further by making more extreme changes to residues implicated in interacting with Dsh. On the basis of mutations made in vertebrate receptors that blocked canonical signaling, we substituted two alanines into ICL2 or ICL3 or replaced the KTxxxW motif with AAxxxA (Umbhauer ; Cong ). These mutations resulted in moderate to strong reduction in planar polarity activity (Table 3, Figure 7, A and D) and no longer retained canonical signaling activity (Table 3). However, when we examined the subcellular localization of the mutated proteins, we found that they localized poorly to junctions (Figure 7, A, E, and F), suggesting that their conformation or stability may be compromised.
Figure 7 

Activity of in vitro mutagenized fz transgenes in the pupal wing. (A–D) Confocal microscope images of 28 hr (A, B, C) or 32 hr (D) pupal wings containing loss-of-function clones of fz marked by lack of lacZ expression (green labeling), in the presence of an Act5C-fz transgene, immunolabeled for distribution of Fz (red or white in A), Dsh (red or white in B), Fmi (red or white in C), or with phalloidin labeling to show distribution of F-actin (red or white in D). Note nonautonomous trichome phenotype in tissue on distal side of clone (arrow in D). (E–G) Mosaic patches of expression (green or white labeling) of indicated mutant Fz protein from an Act5C-fz-EGFP transgene in a wild-type background, colabeled for Fmi (red in E and F) or Armadillo (red in G). Note clear asymmetric localization of FzW561Y to junctions, compared to poorer localization of FzIE > AA and FzKL > AA.

Activity of in vitro mutagenized fz transgenes in the pupal wing. (A–D) Confocal microscope images of 28 hr (A, B, C) or 32 hr (D) pupal wings containing loss-of-function clones of fz marked by lack of lacZ expression (green labeling), in the presence of an Act5C-fz transgene, immunolabeled for distribution of Fz (red or white in A), Dsh (red or white in B), Fmi (red or white in C), or with phalloidin labeling to show distribution of F-actin (red or white in D). Note nonautonomous trichome phenotype in tissue on distal side of clone (arrow in D). (E–G) Mosaic patches of expression (green or white labeling) of indicated mutant Fz protein from an Act5C-fz-EGFP transgene in a wild-type background, colabeled for Fmi (red in E and F) or Armadillo (red in G). Note clear asymmetric localization of FzW561Y to junctions, compared to poorer localization of FzIE > AA and FzKL > AA. In comparison, a single point mutation in an equivalent transgenic construct (W561Y) produced a protein that localizes asymmetrically to junctions and can fully rescue canonical signaling and also shows only negligible planar polarity defects (Table 3 and Figure 7G). This supports the previous finding in vertebrates that changing this tryptophan residue in the KTxxxW motif to a tyrosine residue does not disrupt canonical signaling of Fz receptors (Cong ).

Comparison with in vitro-generated mutations in fz2

As Fz is not the primary receptor acting in canonical Wg signaling in flies, we also analyzed the effect of amino acid substitutions in Fz2 on Wg signal transduction. In the context of a vertebrate receptor, mutations in all three intracellular loops and the KTxxxW motif in the C-terminal tail have been shown to be important (Umbhauer ; Cong ). We generated a series of changes in the intracellular loops and KTxxxW motif of Fz2, and as a control also mutated the fourth conserved cysteine of the CRD (C118Y, equivalent to C107Y in Fz). These proteins were expressed in flies under a heterologous promoter. To increase the sensitivity of the assay, the relatively weak promoter was used, which provides a level of activity such that a wild-type Fz2 coding sequence barely rescues the wing notch phenotype of fz fz2 clones (see Materials and Methods). To control for effects of insertion site, at least two transgene insertions were assayed for each mutation. As expected, our results show a requirement for C118 in canonical signaling (Table 4) and also confirm roles for residues in ICL1–3, including the equivalent of the P278L mutation in Fz (P349L). We also found a critical role for the initial lysine of the KTxxxW motif (K608A), but only a partial role for the threonine (T609A) and tryptophan residues (W613A), in disagreement with the previous report that the tryptophan was essential for canonical signaling (Umbhauer ).
Table 4

Summary of properties of fz2 mutations examined in this study

AlleleAmino acid changeRegion of proteinEquivalent change in FzCanonical phenotype (wing margin)
fz2C118Y #6C118YCRDC107YStrong
fz2C118Y #8C118YCRDC107YStrong
fz2R345A #1R345AICL1R274AModerate
fz2R345A #2R345AICL1R274AStrong
fz2P349L #3P349LICL1P278LStrong
fz2P349L #7P349LICL1P278LStrong
fz2IT > AA #1I433A, T434AICL2I375A, E376AStrong
fz2IT > AA #3I433A, T434AICL2I375A, E376AStrong
fz2L528A #2L528AICL3L465AStrong
fz2L528A #3L528AICL3L465AStrong
fz2K608A #5K608AC-termK556AStrong
fz2K608A #8K608AC-termK556AStrong
fz2T609A #5T609AC-termT557AModerate
fz2T609A #7T609AC-termT557AModerate
fz2W613A #2W613AC-termW561AModerate
fz2W613A #8W613AC-termW561AModerate
As the assay method and set of mutations analyzed was not the same for Fz and Fz2, the results cannot be directly compared. Nevertheless, the equivalent C107Y/C118Y, P278L/P349L. and IE > AA/IT > AA ICL2 changes were tested in both contexts and in each case cause a moderate to strong loss of canonical signaling activity. Overall these results suggest that there are similar sequence requirements in the Fz and Fz2 receptors for canonical signaling.

Discussion

Previous data have led to two contrasting models for how Fz interacts with Dsh, and how this affects canonical and planar polarity activities. On one hand it was suggested that as mutant forms of Dsh that are not recruited to membranes by Fz receptors can still mediate canonical signaling, Dsh recruitment was absolutely required only for planar polarity activity (Axelrod ; Boutros ; Rothbächer ; Simons ). These observations suggest that Fz receptors exhibit different mechanisms of action when activating different downstream signaling pathways via Dsh, which fits with the differential requirement for Wnt ligands and coreceptors in canonical and noncanonical signaling. Conversely, others have suggested that there is a requirement for Dsh binding to Fz for canonical signaling (Umbhauer ; Wong ; Cong ; Wu ), and together with other data this has led to the suggestion of a common mode of Fz receptor activation (Povelones ). It should be noted that it may be important to make the distinction between the ability of Fz receptors to recruit Dsh to membranes, possibly in stoichiometric quantities, as observed in planar polarity complex formation, and the possibility of more transient Fz-Dsh interactions that might conceivably underlie canonical signaling. Indeed, much of the evidence for recruitment of Dsh to membranes during canonical signaling comes from overexpression experiments. For instance, in Drosophila this model was proposed on the basis of experiments in which GFP-tagged Dsh was recruited by mutant Fz receptors overexpressed in a stripe of cells in the wing (Wu ). Such methodologies may mask quantitative or qualitative differences in Fz–Dsh interactions. By analyzing a much larger collection of missense alleles than was previously available, we present evidence that supports the first model of different modes of receptor activation. Specifically, we have identified amino acid changes in the intracellular loops and the proximal C-terminal tail that strongly affect planar polarity activity but are functional for canonical activity in a wing margin assay. Nevertheless, we did also find missense alleles that affected both canonical and planar polarity activity. Povelones based their hypothesis of a common mechanism of Fz receptor action on the observation that a range of alleles showed quantitatively similar defects in canonical and planar polarity signaling. Many of the alleles analyzed either were truncations early in the coding sequence or showed reduced protein levels, and so a deficit in both pathways is not surprising. However, six were missense alleles showing normal protein levels. One of these is fz, which both in our hands and the previous study showed a moderate defect in both planar polarity and canonical signaling. Notably, the remaining five (, fz, fz, , ) showed only weak defects in planar polarity and also only weak defects in canonical signaling as assayed by the maternal contribution assay used. Using our wing margin assay for canonical signaling, we find that fz, which harbors the same change as fz (P278S), gives no defect in canonical signaling. Similarly, we obtained alleles with H383Y and H383L changes, comparable to the allele with a H383Y change, and these again showed no defect in canonical signaling. From this we conclude that the maternal effect assay used by Povelones to assay canonical signaling is more sensitive to weak deficits in activity, possibly due to the more stringent requirement for maternally provided gene function to rescue a zygotic phenotype. Taking our data and that of Povelones et al. together, there is clear evidence for amino acid changes that affect both canonical and noncanonical signaling to similar degrees, but we have also found examples of changes that have strong effects on planar polarity without a similar strong effect on canonical signaling (E279K, I451F, W561R, W561X). This class of amino acid changes that shows large differences between planar polarity and canonical activity is seen only relatively rarely following chemical mutagenesis, most likely explaining why it was not previously detected. Our favored model is that there are different modes of interaction of Fz with Dsh that confer different signaling specificities. Notably, the ability to recruit Dsh to junctions, as seen during planar polarity specification, appears to require some specific residues in the Fz intracellular loops and C-terminal tail that have no major requirement in canonical signaling (magenta in Figures 2 and 6). We believe that two of these residues (I451 and W561) may be required for conformational changes in Fz that promote planar polarity activity, as in our model of the Fz structure they do not lie on a cytosolic-facing interaction surface (Figure 6B). A further residue that when mutated gave a strong effect on planar polarity but not on canonical activity (E279) protrudes into the deep central pocket in our model (Figure 6B) and thus might be part of a specific binding surface that interacts directly with Dsh only when the Fz receptor adopts a certain conformation. Alternatively, these residues could be involved in recruiting other factors that promote planar polarity activity. For instance, stable recruitment of Dsh into planar polarity complexes correlates with its phosphorylation (Axelrod 2001; Shimada ) and thus these residues could be involved in recruiting or activating a kinase. If we consider the positions within our model of the Fz structure of missense alleles that do not show large differences of activity between planar polarity and canonical activity (turquoise in Figure 6), then again some lie in transmembrane regions or deep pockets and are unlikely to directly affect Dsh binding (Figure 6A). However, others lie close together on the cytosolic face of Fz (Figure 6B). This region could plausibly form part of an interaction surface for Dsh that is required for both canonical and planar polarity activity. It is important to note that the interaction surfaces on the cytosolic face of Fz are likely to be much more extensive than revealed by the small number of missense alleles that we obtained. Many residues on the predicted cytosolic surface cannot be mutated to give deleterious changes by the GC:AT substitutions most commonly induced by EMS or ENU mutagenesis (olive in Figure 6C). Furthermore, many residues in the region are highly conserved in homologous proteins, suggesting functional conservation (deep pink and red in Figure 6D). It is notable that we failed to obtain any missense alleles that caused a defect in planar polarity but gave rise to Fz proteins still able to recruit Dsh to junctions. This is consistent with the primary role of the intracellular regions of Fz in planar polarity signaling being to recruit Dsh, although we also note that in some cases a failure to recruit Dsh leads to a relatively mild planar polarity phenotype, leaving open the possibility that loss of Dsh recruitment is not in itself the cause of the signaling defect. Our data also provide strong evidence for the hypothesis that Fz receptors that cannot stably recruit Dsh, but still localize to cell junctions, can participate in only non-cell-autonomous planar polarity signaling (Amonlirdviman ). We identified 13 more alleles that show this property. This further cements the view that the primary role of Dsh is in intracellular amplification and interpretation of polarity cues (Krasnow ; Strutt and Strutt 2007), most likely by promoting clustering of planar polarity protein complexes in cell membranes (Strutt ). Several other points emerge from our analysis of novel alleles. First, we isolated four different changes in the CRD, all of which affected both canonical and planar polarity activity, and three altering cysteine residues suggested to be involved in disulphide bond formation based on the crystal structure of vertebrate CRDs (Dann ). However, these all also prevented Fz localization to junctions, suggesting that a properly folded CRD is required for normal trafficking to the cell surface, similar to what was previously observed for a mutation in the CRD of Fz2 (Chen ). In theory we might have expected to isolate point mutations in the CRD that block the reported intercellular interaction with Stbm in neighboring cells (Strutt and Strutt 2008; Wu and Mlodzik 2008), but in practice it may not be possible to separate this activity from the requirement for the CRD in membrane targeting. Second, we failed to isolate any mutations in the extracellular loops, and although this may reflect our screen being slightly less sensitive to planar polarity defects than that previously performed by Povelones , it nevertheless suggests that these regions are less sensitive to changes in amino acid identity. Finally, we found no evidence for an essential requirement of the Fz C-terminal tail downstream of the KTxxxW motif: this is consistent with the general lack of sequence conservation for this region among Fz family receptors.
  70 in total

1.  High-resolution crystal structure of an engineered human beta2-adrenergic G protein-coupled receptor.

Authors:  Vadim Cherezov; Daniel M Rosenbaum; Michael A Hanson; Søren G F Rasmussen; Foon Sun Thian; Tong Sun Kobilka; Hee-Jung Choi; Peter Kuhn; William I Weis; Brian K Kobilka; Raymond C Stevens
Journal:  Science       Date:  2007-10-25       Impact factor: 47.728

2.  Template-based modeling and free modeling by I-TASSER in CASP7.

Authors:  Yang Zhang
Journal:  Proteins       Date:  2007

3.  Frizzled proteins constitute a novel family of G protein-coupled receptors, most closely related to the secretin family.

Authors:  M R Barnes; D M Duckworth; L J Beeley
Journal:  Trends Pharmacol Sci       Date:  1998-10       Impact factor: 14.819

4.  frizzled and frizzled 2 play a partially redundant role in wingless signaling and have similar requirements to wingless in neurogenesis.

Authors:  K M Bhat
Journal:  Cell       Date:  1998-12-23       Impact factor: 41.582

5.  Use of dsRNA-mediated genetic interference to demonstrate that frizzled and frizzled 2 act in the wingless pathway.

Authors:  J R Kennerdell; R W Carthew
Journal:  Cell       Date:  1998-12-23       Impact factor: 41.582

6.  Frizzled-Dishevelled signaling specificity outcome can be modulated by Diego in Drosophila.

Authors:  Jun Wu; Andreas Jenny; Ivana Mirkovic; Marek Mlodzik
Journal:  Mech Dev       Date:  2007-10-17       Impact factor: 1.882

7.  The planar polarity pathway promotes coordinated cell migration during Drosophila oogenesis.

Authors:  Rebecca Bastock; David Strutt
Journal:  Development       Date:  2007-07-25       Impact factor: 6.868

8.  Asymmetric homotypic interactions of the atypical cadherin flamingo mediate intercellular polarity signaling.

Authors:  Wei-Shen Chen; Dragana Antic; Maja Matis; Catriona Y Logan; Michael Povelones; Graham A Anderson; Roel Nusse; Jeffrey D Axelrod
Journal:  Cell       Date:  2008-06-13       Impact factor: 41.582

9.  Frizzled and Dfrizzled-2 function as redundant receptors for Wingless during Drosophila embryonic development.

Authors:  P Bhanot; M Fish; J A Jemison; R Nusse; J Nathans; K M Cadigan
Journal:  Development       Date:  1999-09       Impact factor: 6.868

10.  Wingless signaling in the Drosophila embryo: zygotic requirements and the role of the frizzled genes.

Authors:  H A Müller; R Samanta; E Wieschaus
Journal:  Development       Date:  1999-02       Impact factor: 6.868

View more
  9 in total

1.  Partial interchangeability of Fz3 and Fz6 in tissue polarity signaling for epithelial orientation and axon growth and guidance.

Authors:  Zhong L Hua; Hao Chang; Yanshu Wang; Philip M Smallwood; Jeremy Nathans
Journal:  Development       Date:  2014-10       Impact factor: 6.868

2.  Selective function of the PDZ domain of Dishevelled in noncanonical Wnt signalling.

Authors:  Juliusz Mieszczanek; Helen Strutt; Trevor J Rutherford; David Strutt; Mariann Bienz; Melissa V Gammons
Journal:  J Cell Sci       Date:  2022-05-31       Impact factor: 5.235

3.  Pharmacological folding chaperones act as allosteric ligands of Frizzled4.

Authors:  Serena F Generoso; Mariateresa Giustiniano; Giuseppe La Regina; Sara Bottone; Sara Passacantilli; Salvatore Di Maro; Hilde Cassese; Agostino Bruno; Massimo Mallardo; Monica Dentice; Romano Silvestri; Luciana Marinelli; Daniela Sarnataro; Stefano Bonatti; Ettore Novellino; Mariano Stornaiuolo
Journal:  Nat Chem Biol       Date:  2015-03-09       Impact factor: 15.040

4.  Expression characteristics of β-catenin in scallop Chlamys farreri gonads and its role as a potential upstream gene of Dax1 through canonical Wnt signalling pathway regulating the spermatogenesis.

Authors:  Hailong Li; Zhifeng Zhang; Ying Bi; Dandan Yang; Litao Zhang; Jianguo Liu
Journal:  PLoS One       Date:  2014-12-30       Impact factor: 3.240

5.  Targeting Frizzled-7 Decreases Stemness and Chemotherapeutic Resistance in Gastric Cancer Cells by Suppressing Myc Expression.

Authors:  Yongzhong Cheng; Li Li; Sirong Pan; Huilin Jiang; Hongyan Jin
Journal:  Med Sci Monit       Date:  2019-11-16

Review 6.  The BMP Pathway in Blood Vessel and Lymphatic Vessel Biology.

Authors:  Ljuba C Ponomarev; Jakub Ksiazkiewicz; Michael W Staring; Aernout Luttun; An Zwijsen
Journal:  Int J Mol Sci       Date:  2021-06-14       Impact factor: 5.923

7.  Origin and evolution of dishevelled.

Authors:  Adler R Dillman; Paul J Minor; Paul W Sternberg
Journal:  G3 (Bethesda)       Date:  2013-02-01       Impact factor: 3.154

8.  Wnt Signalosome Assembly by DEP Domain Swapping of Dishevelled.

Authors:  Melissa V Gammons; Miha Renko; Christopher M Johnson; Trevor J Rutherford; Mariann Bienz
Journal:  Mol Cell       Date:  2016-09-29       Impact factor: 17.970

9.  Essential role of the Dishevelled DEP domain in a Wnt-dependent human-cell-based complementation assay.

Authors:  Melissa V Gammons; Trevor J Rutherford; Zachary Steinhart; Stephane Angers; Mariann Bienz
Journal:  J Cell Sci       Date:  2016-10-15       Impact factor: 5.285

  9 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.