BACKGROUND: LEA (late embryogenesis abundant) proteins encode conserved N-terminal mitochondrial signal domains and C-terminal (A/TAEKAK) motif repeats, long-presumed to confer cell resistance to stress and death cues. This prompted the hypothesis that LEA proteins are central to mitochondria mechanisms that connect bioenergetics with cell responses to stress and death signaling. In support of this hypothesis, recent studies have demonstrated that mammalian LEA protein PRELI can act as a biochemical hub, which upholds mitochondria energy metabolism, while concomitantly promoting B cell resistance to stress and induced death. Hence, it is important to define in vivo the physiological relevance of PRELI expression. METHODS AND FINDINGS: Given the ubiquitous PRELI expression during mouse development, embryo lethality could be anticipated. Thus, conditional gene targeting was engineered by insertion of flanking loxP (flox)/Cre recognition sites on PRELI chromosome 13 (Chr 13) locus to abort its expression in a tissue-specific manner. After obtaining mouse lines with homozygous PRELI floxed alleles (PRELI(f/f)), the animals were crossed with CD19-driven Cre-recombinase transgenic mice to investigate whether PRELI inactivation could affect B-lymphocyte physiology and survival. Mice with homozygous B cell-specific PRELI deletion (CD19-Cre/Chr13 PRELI(-/-)) bred normally and did not show any signs of morbidity. Histopathology and flow cytometry analyses revealed that cell lineage identity, morphology, and viability were indistinguishable between wild type CD19-Cre/Chr13 PRELI(+/+) and CD19-Cre/Chr13 PRELI(-/-) deficient mice. Furthermore, B cell PRELI gene expression seemed unaffected by Chr13 PRELI gene targeting. However, identification of additional PRELI loci in mouse Chr1 and Chr5 provided an explanation for the paradox between LEA-dependent cytoprotection and the seemingly futile consequences of Chr 13 PRELI gene inactivation. Importantly, PRELI expression from spare gene loci appeared ample to surmount Chr 13 PRELI gene deficiency. CONCLUSIONS: These findings suggest that PRELI is a vital LEA B cell protein with failsafe genetics.
BACKGROUND: LEA (late embryogenesis abundant) proteins encode conserved N-terminal mitochondrial signal domains and C-terminal (A/TAEKAK) motif repeats, long-presumed to confer cell resistance to stress and death cues. This prompted the hypothesis that LEA proteins are central to mitochondria mechanisms that connect bioenergetics with cell responses to stress and death signaling. In support of this hypothesis, recent studies have demonstrated that mammalian LEA protein PRELI can act as a biochemical hub, which upholds mitochondria energy metabolism, while concomitantly promoting B cell resistance to stress and induced death. Hence, it is important to define in vivo the physiological relevance of PRELI expression. METHODS AND FINDINGS: Given the ubiquitous PRELI expression during mouse development, embryo lethality could be anticipated. Thus, conditional gene targeting was engineered by insertion of flanking loxP (flox)/Cre recognition sites on PRELI chromosome 13 (Chr 13) locus to abort its expression in a tissue-specific manner. After obtaining mouse lines with homozygous PRELI floxed alleles (PRELI(f/f)), the animals were crossed with CD19-driven Cre-recombinase transgenic mice to investigate whether PRELI inactivation could affect B-lymphocyte physiology and survival. Mice with homozygous B cell-specific PRELI deletion (CD19-Cre/Chr13 PRELI(-/-)) bred normally and did not show any signs of morbidity. Histopathology and flow cytometry analyses revealed that cell lineage identity, morphology, and viability were indistinguishable between wild type CD19-Cre/Chr13 PRELI(+/+) and CD19-Cre/Chr13 PRELI(-/-) deficient mice. Furthermore, B cell PRELI gene expression seemed unaffected by Chr13 PRELI gene targeting. However, identification of additional PRELI loci in mouse Chr1 and Chr5 provided an explanation for the paradox between LEA-dependent cytoprotection and the seemingly futile consequences of Chr 13 PRELI gene inactivation. Importantly, PRELI expression from spare gene loci appeared ample to surmount Chr 13 PRELI gene deficiency. CONCLUSIONS: These findings suggest that PRELI is a vital LEA B cell protein with failsafe genetics.
In attempting to understand how mitochondria bioenergetics is biochemically connected with stress and death signaling, recent studies found that PRELI (protein of relevant evolutionary and lymphoid interest) [1], [2] is a key mammalian LEA ortholog inherently involved in mechanisms that regulate mitochondria biogenesis, energy metabolism, and cell survival [3], [4], [5]. Importantly, PRELI was shown to interact with dynamin-like GTPase OPA1
[6] to keep cristae junctions intact, control molecular current [5], [7], and support critical biochemical mitochondria functions. For instance, mitochondria convert organic compounds into CO2 and H2O to produce energy in the form of ATP, via respiratory chain (RC) oxidative phosphorylation reactions [5], [7], [8], [9]. These reactions were found to be enhanced by PRELI expression, thus enabling RC progression from complex I to V and ensuring the maintenance of the mitochondrial membrane potential (Δψm) [5], [10], [11]. Notably, the mitochondrial Δψm supports energy metabolism, regulates reactive oxygen species (ROS) production and controls the traffic of pro- and anti-apoptotic molecules [5], [12], [13]. As such, the mitochondrial Δψm becomes a conductance core, where crosstalk between bioenergetics and apoptosis signaling directs cell responses and fate [14].In keeping with this notion, LEA protein-dependent maintenance of the mitochondrial Δψm is essential to prevent ROS surges, promote the assembly of survival protein networks and restrain the release of hallmark contributors of programmed and induced cell death [5], [12], [14], [15], [16]. Remarkably, the intrinsic mitochondria-dependent cytoprotection functions that are relevant to LEA-containing proteins like PRELI, have been documented by studies on plants and vertebrate and invertebrate animals, in which evolutionary parallels of cell responses to stress and death-inducing stimuli are well established [3], [5], [17], [18], [19], [20], [21]. Furthermore, yeast (Ups1p) and mammalian PRELI locate within mitochondria inter-membrane space (IMS), interact with respective yeastMgm1p or mammalianOPA1 at cristae junctions, and play analogous roles in mitochondria biogenesis and cell survival [5], [17], [22]. Moreover, human and mouse PRELI proteins are 96.3% identical and exhibit robust and ubiquitous expression during embryo development [1], [2], which supports the notion of evolutionarily conserved mechanisms for eukaryote cell development and survival [3], [4], [5], [17], [23].Therefore, to directly assess the physiological significance of mammalian LEA-containing proteins in vivo, we sought to conditionally target the mouse Chr13 PRELI gene, the only known locus at the time these studies were undertaken. The findings reported herein and the recent disclosure of additional PRELI gene copies in Chr1 and Chr5 provide evidence that failsafe mechanisms are genetically imprinted to ensure the expression of genes that are necessary for cell survival.
Results
Protein structure features defining PRELI physiology
As mammalian LEA proteins, human and mouse PRELI display conserved MSF1-like domains and C-terminal coiled-coil (CC) LEA motif (A/TAEKAK) repeats [2], [3], [5], [23]. The hypothetical MSF1-like domain (Fig. 1a) spans a 170 amino acid module, which is known to assume globular α/β conformations and harbor pleckstrin homology (PH) regions, phosphothyrosine binding (PTB) sites, epsin N-terminal homology (ENTH) motifs and 4.1 Ezrin-Radixin-Moesin (FERM) domains [24], [25]. These structures are characteristic of signal transduction proteins involved in the regulation of mitochondrial molecular traffic [24], [25]. Relevant to PRELI mechanisms of action, the MSF1-like sequence comprises N-terminal mitochondria localization signals [26]. Thus, to further attest the relevance of the MSF1-like structure in defining PRELI expression in the mitochondria, control (Vector) and PRELI Blin-1 transfectants were comparatively analyzed by immunofluorescence staining and confocal microscopy. Consistent with PRELI N-terminal structure, Figure 1b reveals a selective expression of the mammalian LEA protein, in the mitochondria by PRELI Blin-1 transfectants. Markedly, the parental Pre-B acute lymphocytic leukemia (PreB ALL) Blin-1 cell line [27] did not express detectable PRELI levels, which underscored its sensitivity to caspase-dependent and independent apoptosis [5].
Figure 1
PRELI motifs and their relevance in subcellular location and function.
(a) Hypothetical PRELI structure based on queries of deduced amino acid sequence against protein databases (http://wwwuniprot.org/uniprot/Q8R107; http://pfam.sanger.ac.uk/family/PF04707). PRELI MSF1-like region is depicted as a dark grey octagonal form, while its LEA motif is shown as theoretical α helices, flanked by low complexity (LC) domains (lighter grey rectangles). (b) Confocal microscopy results on control (Vector) and PRELI PBlin-1 transfectants [5] confirm MSF1-like deduced prediction that N-terminal signal peptide mvkyflgqsvlrsswdqvfaafwqrypnpyskhvl can direct PRELI expression (red fluorescence) into the mitochondria, as shown by its co-localization (merge) with mitochondrial HSP60 (green fluorescence) [5]. (c) Confocal microscopy results show that in contrast to control cells (Control), PRELI Blin-1 transfectants (PRELI) [5] prevent STS-induced (+STS) release of AIF from the mitochondria and uphold cell morphology and survival. These results are consistent with the conserved cytoprotection function of LEA-containing proteins. AIF is shown in red fluorescence within greyscale cell background.
PRELI motifs and their relevance in subcellular location and function.
(a) Hypothetical PRELI structure based on queries of deduced amino acid sequence against protein databases (http://wwwuniprot.org/uniprot/Q8R107; http://pfam.sanger.ac.uk/family/PF04707). PRELI MSF1-like region is depicted as a dark grey octagonal form, while its LEA motif is shown as theoretical α helices, flanked by low complexity (LC) domains (lighter grey rectangles). (b) Confocal microscopy results on control (Vector) and PRELI PBlin-1 transfectants [5] confirm MSF1-like deduced prediction that N-terminal signal peptide mvkyflgqsvlrsswdqvfaafwqrypnpyskhvl can direct PRELI expression (red fluorescence) into the mitochondria, as shown by its co-localization (merge) with mitochondrial HSP60 (green fluorescence) [5]. (c) Confocal microscopy results show that in contrast to control cells (Control), PRELI Blin-1 transfectants (PRELI) [5] prevent STS-induced (+STS) release of AIF from the mitochondria and uphold cell morphology and survival. These results are consistent with the conserved cytoprotection function of LEA-containing proteins. AIF is shown in red fluorescence within greyscale cell background.Equally important to PRELI structure-dependent features, the tandem LEA (A/TAEKAK) repeats are configured as two α helices in opposite orientation, which are flanked by low complexity (LC) regions (Fig. 1a) and characterize proteins that confer stress tolerance and resistance to death [3], [5], [18], [21], [28]. In agreement with this notion and in further support of earlier findings [5], figure 1c shows that PRELI expression is essential to confine apoptosis inducing factor (AIF) [29] in the mitochondria and thus prevent caspase-independent death. Notably, AIF release from the mitochondria results in direct DNA fragmentation and virtually immediate cell destruction [5]. Thus, the potent LEA protein-dependent cytoprotection was emphasized by the evidence that in contrast to control Blin-1 transfectants (Fig. 1c top), the imminent and devastating death resulting from AIF redistribution was largely preventable in PRELI expressing cells (Fig. 1c, bottom).
PRELI expression during mouse embryo development
LEA gene expression in all eukaryote studied is selectively prominent during embryo development and when organisms are exposed to stress and/or life-threatening conditions [3], [5], [18], [20], [21], [23], [30]. This suggested that in vivo, PRELI expression could be crucial for mammalian embryo development and when cell survival is intrinsically connected with mitochondria mechanisms that control stress tolerance and resistance to death [5]. In support of this hypothesis, northern blot and fluorescent in situ hybridization (FISH) analyses showed that PRELI mRNA expression was robust and ubiquitous throughout all mouse embryo stages (Fig. 2a and b). Although northern blot results depicted strong mRNA levels at 7, 11, 15, and 17 days post coitum (dpc), which vitually overlapped with the FISH data, the former aimed to verify PRELI mRNA molecular size while the latter intended to mainly illustrate the overall tissue distribution of the transcript. Moreover, the 13-dpc FISH image revealed a developmental stage not represented in the northern blot results and thus complemented PRELI expression analyses. Of note, the prominent 1.1 kb mRNA size detected by northern blotting, is the only mouse transcript that has been routinely confirmed by annotated sequencing data (National Center for Biotechnology Information and The European Molecular Biology Organization databases). Therefore, the weak but noticeable 7.5 kb mRNA bands detected at 11 and 15 dpc are likely the result of unprocessed transcripts. These collective results parallel LEA gene expression traits found in most eukaryotes.
Figure 2
PRELI mRNA expression during mouse embryo development and in adult life.
(a) Northern blot results show the prominent PRELI mRNA expression at 7–17 days post coitum (dpc) stages of mouse embryo development. (b) In situ hybridization results of whole-mount embryo sections show robust and ubiquitous PRELI mRNA expression at 13-dpc developmental stage. Left: hybridization with digoxigenin-labeled anti-sense PRELI complementary RNA (cRNA) probe shows prominent red fluorescence overlapping with Hoechst blue fluorescence counterstain. Right: hybridization with sense cRNA probe, which largely exhibits the blue fluorescence of the counterstain, serves as control for PRELI mRNA detection specificity. (c) Northern blot results show PRELI expression by distinct adult mouse tissues: bone marrow (1), thymus (2), spleen (3), lymph node (4), testis (5), ovary (6), brain (7), skeletal muscle (8), heart (9), stomach (10), liver (11), lung (12) and kidney (13). Ethidium bromide-stained images of 28S and 18S ribosomal RNA bands, retained on nitrocellulose blots after capillary transfer, are shown as control for RNA sample loading (d) Left: Cell sorting scheme used for RNA isolation from naïve IgD+GL-7− (1), germinal center (GC) precursors IgD+GL7+ (2), GC IgD−GL-7+ (3), and memory IgD−GL-7− (4) B cell subsets. Right: RT-PCR results reveal PRELI mRNA expression by the distinct B cell subsets. Glyceraldehyde 3-phosphate dehydrogenase (GAPDH) mRNA amplification is presented as control of B cell subset RNA content.
PRELI mRNA expression during mouse embryo development and in adult life.
(a) Northern blot results show the prominent PRELI mRNA expression at 7–17 days post coitum (dpc) stages of mouse embryo development. (b) In situ hybridization results of whole-mount embryo sections show robust and ubiquitous PRELI mRNA expression at 13-dpc developmental stage. Left: hybridization with digoxigenin-labeled anti-sense PRELI complementary RNA (cRNA) probe shows prominent red fluorescence overlapping with Hoechst blue fluorescence counterstain. Right: hybridization with sense cRNA probe, which largely exhibits the blue fluorescence of the counterstain, serves as control for PRELI mRNA detection specificity. (c) Northern blot results show PRELI expression by distinct adult mouse tissues: bone marrow (1), thymus (2), spleen (3), lymph node (4), testis (5), ovary (6), brain (7), skeletal muscle (8), heart (9), stomach (10), liver (11), lung (12) and kidney (13). Ethidium bromide-stained images of 28S and 18S ribosomal RNA bands, retained on nitrocellulose blots after capillary transfer, are shown as control for RNA sample loading (d) Left: Cell sorting scheme used for RNA isolation from naïve IgD+GL-7− (1), germinal center (GC) precursors IgD+GL7+ (2), GC IgD−GL-7+ (3), and memory IgD−GL-7− (4) B cell subsets. Right: RT-PCR results reveal PRELI mRNA expression by the distinct B cell subsets. Glyceraldehyde 3-phosphate dehydrogenase (GAPDH) mRNA amplification is presented as control of B cell subset RNA content.
PRELI mRNA tissue distribution in adult mice
Earlier studies have shown that LEA proteins in general and PRELI in particular connect mitochondria bioenergetics with mechanisms that are essential for cell survival [3], [5], [31]. In keeping with this notion, PRELI mRNA tissue distribution in adult mice was found to be predominant in the thymus, spleen, lymph nodes, brain, lungs, and kidneys (Fig. 2c). These are tissues in which cells are under rigorous selection pressure [32], [33], [34] and mitochondria-dependent functions drive cell responses to stress and death stimuli [35], [36]. For instance: (a) Lymphocyte maturation programs in the thymus, spleen and lymph nodes entail stringent selection mechanisms that ensure the survival of immunocompetent cells and elimination of aberranly developed cells [32], [33]; (b) Similarly, high energy-driven mechanisms are central for brain cell survival [35]; (c) Lung cell survival is constantly challenged by oxidative toxicity and pathogen-driven inflammatory strain [34]; (d) In kidney cells, strenuous NaH+/Cle− exchanges are characteristic functions that sustain tissue hydration, osmolarity and survival, which parallel bioenergetic H+/e− gradients that protect plant cells from pH collapse, desiccation, and death [19], [28], [30]; (e) Lastly, like immune cells, germ cells in the ovary undergo maturation selection cycles, which result in the ovulation of the fit and the demise of cells failing maturation demands [36].It is noteworthy that while mitochondria bioenergetics is inherently associated to cellular activity in the testis, heart, skeletal muscle and liver, PRELI mRNA levels were virtually undetectable in these organs under homeostatic contitions (Fig. 2c). However, it is conceivable that PRELI expression is most prominently required when energy demands are intrinsically linked to cell responses to stress death signaling [5]. This suggests that PRELI expression could be under strict genetic and/or epigenetic regulatory constraints and hence, transcriptional activation could also depend on stress-mediated stimulation, including hypoxia, hypertension or inflammatory reactions.In added support of the physiological connection of stress and death signaling with PRELI expression and mechanisms of cell survival, spleen and lymph node germinal center (GC) B cells are programmed to die unless they can recognize pathogen determinants (also known as antigens) with high affinity [32]. Thus, GC B cell affinty maturation is a stringent selection process and timely PRELI expression could be required to ensure the survival of high-affinty/antigen-binding GC B cells. Consistent with this hypothesis, figure 2d shows that PRELI expression is selectively expressed by GC precursors and GC B cells.Together, these data suggest that similar to most LEA genes, PRELI expression is necessary for embryo development and important for stress tolerance and resistance to programmed and induced death in adult mice. Therefore, gene inactivation experiments were sought to appraise in vivo PRELI physiology.
Conditional PRELI gene targeting in mice
Gene targeting experiments were undertaken with the aim to inactivate mouse PRELI gene expression in vivo and define its biological significance. As a means to circumvent potential embryo lethality, a conditional gene-targeting strategy was devised to achieve PRELI gene inactivation in a cell lineage-restricted manner. As shown in Figure 3a, flanking loxP (flox)/Cre recognition sites were engineered in the targeting construct in a manner so that sites could be inserted adjacent to exon II of homologous chromosome 13 (Chr 13) PRELI gene. In this context, the transfer of exon II with flanking loxP sites (floxed target) into the Chr 13 PRELI locus of embryonic stem cells (ESC) could be achieved by homologous recombination. The rationale for loxP sites adjacent to exon II was based on sequence database analyses, which showed that only introns I and II sequences were exempt from regulatory sequences that are transcriptionally relevant to adjacent genes (Fig. 3a). Thus, in agreement with this reasoning, deletion of exon II was designed to interrupt PRELI expression without affecting neighboring Rab24 or Mad3 (Fig. 3a) gene transcription.
Figure 3
Conditional Chr 13 PRELI gene Targeting.
(a) Overall Schema I: WT allele depicts PRELI gene flanked by Rab 24 (left) and Mad3 (right) genes; II: Targeting vector construct displays relevant restrictions sites (Asc1 [A], BamH1 [B], Cla1 [C], EcoR1 [R1], Not1 [N], Pme1 [P], Sal1 [S], and Xba1 [X]). Also indicated are 5′ and 3′ arms of homology, LoxP sites, Flip recombination (Frt) sequences, and PGK-Neo and HSV-Tk selection cassettes; III: Floxed PRELI allele, after Frt-mediated removal of selection cassettes; IV: PRELI deficient allele after CD19-driven Cre recombinase (Cre) cleavage of PRELI exon II. Location of 5′ and 3′ external probes used in Southern Blot hybridization experiments is indicated. (b) PCR genotyping results of mouse litters after Chr13 PRELI gene targeting (Flox insertion) and Frt-mediated removal of PKG-Neo cassette but before breeding with CD19-Cre mice. Several PCR reaction products from Chr13 PRELI
f/f mice are compared to those of Chr13 PRELI
+/f and Chr13 PRELI
+/+ littermates. A PRELI gene PCR reaction from CD19Cre mouse DNA is included as an additional Chr13 PRELI
+/+ control. Predicted sizes of amplified DNA from PRELI+/+ and PRELIf/f alleles are indicated. (c) Southern blot genotype results of the conditionally targeted mouse strain after breeding with CD19-Cre mice. (Left) Southern blot analysis of BamH1 digested genomic DNA from WT CD19-Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/− and homozygous CD19-Cre/Chr13 PRELI
−/− mice hybridized to the 5′ external probe (illustrated above). Because all mouse lines tested here are in the C57BL/6 genetic background, a WT control from C57BL/6 (BL6) genomic DNA (first lane on the blot) is also included. (Right) Southern blot analysis of EcoR1 and Sal1 digested DNA from heterozygous CD19-Cre/Chr13 PRELI
+/−, WT CD19/Cre/Chr13 PRELI
+/+ and homozygous CD19-Cre/Chr13 PRELI
−/− mice hybridized to the 3′ external probe (illustrated above). Expected molecular sizes are also indicated.
Conditional Chr 13 PRELI gene Targeting.
(a) Overall Schema I: WT allele depicts PRELI gene flanked by Rab 24 (left) and Mad3 (right) genes; II: Targeting vector construct displays relevant restrictions sites (Asc1 [A], BamH1 [B], Cla1 [C], EcoR1 [R1], Not1 [N], Pme1 [P], Sal1 [S], and Xba1 [X]). Also indicated are 5′ and 3′ arms of homology, LoxP sites, Flip recombination (Frt) sequences, and PGK-Neo and HSV-Tk selection cassettes; III: Floxed PRELI allele, after Frt-mediated removal of selection cassettes; IV: PRELI deficient allele after CD19-driven Cre recombinase (Cre) cleavage of PRELI exon II. Location of 5′ and 3′ external probes used in Southern Blot hybridization experiments is indicated. (b) PCR genotyping results of mouse litters after Chr13 PRELI gene targeting (Flox insertion) and Frt-mediated removal of PKG-Neo cassette but before breeding with CD19-Cre mice. Several PCR reaction products from Chr13 PRELI
f/f mice are compared to those of Chr13 PRELI
+/f and Chr13 PRELI
+/+ littermates. A PRELI gene PCR reaction from CD19Cre mouse DNA is included as an additional Chr13 PRELI
+/+ control. Predicted sizes of amplified DNA from PRELI+/+ and PRELIf/f alleles are indicated. (c) Southern blot genotype results of the conditionally targeted mouse strain after breeding with CD19-Cre mice. (Left) Southern blot analysis of BamH1 digested genomic DNA from WT CD19-Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/− and homozygous CD19-Cre/Chr13 PRELI
−/− mice hybridized to the 5′ external probe (illustrated above). Because all mouse lines tested here are in the C57BL/6 genetic background, a WT control from C57BL/6 (BL6) genomic DNA (first lane on the blot) is also included. (Right) Southern blot analysis of EcoR1 and Sal1 digested DNA from heterozygous CD19-Cre/Chr13 PRELI
+/−, WT CD19/Cre/Chr13 PRELI
+/+ and homozygous CD19-Cre/Chr13 PRELI
−/− mice hybridized to the 3′ external probe (illustrated above). Expected molecular sizes are also indicated.After obtaining mouse lines with homozygous Chr 13 PRELI floxed alleles (Chr 13 PRELI
f/f mice), as confirmed by polymerase chain reaction (PCR) analyses (Fig. 3b), the animals were bred into the C57BL/6 background to generate and study genetically equal PRELI
f/f mouse strains. Although the overall aim in the design and generation of PRELI
f/f mice was to provide flexible means to assess the requirement of PRELI expression in a broad range of cell lineages, primary breeding with the CD19-Cre transgenic (Tg) mice was chosen for several reasons: (i) PRELI was discovered for its prominent expression in GC B cells [1], which are known for their propensity to programmed cell death [32] and hence, it was important to define the impact of its inactivation in these cells; (ii) the successful breeding with CD19-Cre mice is well documented [37], [38]; and (iii) the CD19-Cre mice are readily available from approved animal repositories.
PRELI gene deletion without expression loss
After breeding the Chr 13 PRELI
f/f mouse strain with CD19-Cre Tg animals, litters of wild type (WT) CD19-Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mice were obtained and their genotype routinely verified by Southern blotting (Figure 3c). As a rigorous measure, blots were independently confirmed with external 5′ and 3′ probes, whose respective sequences are located outside the regions of homology with the targeting vector (Fig. 3a).Homozygous CD19-Cre/Chr13 PRELI
−/− mice bred normally and did not have any detectable signs of morbidity. Post mortem examination of lymphoid organs, from cohorts of euthanized mice, showed no discernible differences in B cell lineage phenotype, homing, or viability between WT CD19-Cre/Chr13 PRELI
+/+ and homozygous CD19-Cre/Chr13 PRELI
−/− littermates. For instance, flow cytometry analyses of CD45/B220+ and CD19+ cells [34] in peripheral blood leukocytes (PBL) showed that overall leukocyte cellularity (B220) and B lineage-specific (CD19) cell numbers were virtually identical in WT CD19-Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mice (Fig. 4). Furthermore, analyses of offspring resulting from the breeding of PRELI
f/f mouse lines with ubiquitous CMV-driven Cre expressing mice gave similar results as those obtained with CD19-Cre (not shown).
Figure 4
Cell lineage phenotype analyses of CD19Cre/Chr13 PRELI mice.
Flow cytometry results compare the presence of B220+ (left histograms) and CD19+ (right histograms) lymphocytes in peripheral blood leukocytes of WT CD19/Cre/Chr13 PRELI
+/+ (top), heterozygous CD19-Cre/Chr13 PRELI
+/− (middle), and homozygous CD19-Cre/Chr13 PRELI
−/− mice (bottom). Results are presented as number of cells (%) with relevant fluorescence (Log) staining. The figure is a representative result of at least three independent analyses performed with age-matched littermates (n = 3). Standard error mean (± SEM) bars are indicated and high statistical significance values scored p≤0.001.
Cell lineage phenotype analyses of CD19Cre/Chr13 PRELI mice.
Flow cytometry results compare the presence of B220+ (left histograms) and CD19+ (right histograms) lymphocytes in peripheral blood leukocytes of WT CD19/Cre/Chr13 PRELI
+/+ (top), heterozygous CD19-Cre/Chr13 PRELI
+/− (middle), and homozygous CD19-Cre/Chr13 PRELI
−/− mice (bottom). Results are presented as number of cells (%) with relevant fluorescence (Log) staining. The figure is a representative result of at least three independent analyses performed with age-matched littermates (n = 3). Standard error mean (± SEM) bars are indicated and high statistical significance values scored p≤0.001.Although no other LEA genes with similar PRELI structure and mechanisms of action have been identified in mammals, functional redundancy with other gene families was plausible. Therefore, defining mRNA and protein expression status in CD19-Cre/Chr13 PRELI KO mice was imperative, before functional overlap could be concluded. Strikingly, northern blot and quantitative reverse transcription-mediated PCR (qRT-PCR) [39], [40], [41] revealed that PRELI mRNA expression in bone marrow and spleen B cells was virtually unaffected in homozygous CD19-Cre/Chr13 PRELI
−/− mice (Fig. 5a and b), despite proven Chr13 PRELI gene deletion (Fig. 3b and c). Moreover, northern blot results showed no discernible differences in PRELI mRNA molecular sizes between WT CD19-Cre/Chr13 PRELI
+/+ and homozygous CD19-Cre/Chr13 PRELI
−/− littermates, even though exon II spans nearly one fourth (226 bp) of the entire 1.1 kb transcript sequence. Nevertheless and although Chr13 PRELI gene targeting was engineered to completely prevent transcription, exon II-skipping, which could generate truncated PRELI transcripts and proteins required to be ruled out. To that end, amplification of full-length PRELI open reading frame (ORF), directional cDNA cloning, and immunoblotting experiments were performed using RNA and protein extracts from CD19-Cre/Chr13 PRELI KO peripheral blood leukocytes (PBL), to verify PRELI mRNA and protein molecular sizes and examine the nucleotide sequence of the amplified ORF. Figure 6 demonstrates that the amplified 672 ORF (Fig. 6a), the 25-kDa polypeptide (Fig. 6b), and the exon II-retaining full-length cDNA sequence (Fig. 6c) derived from RNA and protein extracts of CD19-Cre/Chr13 PRELI KO PBL, encode intact PRELI gene products.
Figure 5
PRELI transcription by CD19Cre/Ch13 PRELI mice.
(a) Northern blots compare PRELI mRNA levels between WT CD19/Cre/Chr13 PRELI
+/+ and heterozygous CD19-Cre/Chr13 PRELI
+/− or homozygous CD19-Cre/Chr13 PRELI
−/− mouse spleen B cells. (b) qRT-PCR assessment of PRELI transcription between WT CD19/Cre/Chr13 PRELI
+/+ and homozygousCD19-Cre/Chr13 PRELI
−/− mice. qRT-PCR comparisons include results obtained with RNA from bone marrow and spleen B cells. Data are presented in relative Ct and are the result of at least three WT CD19/Cre/Chr13 PRELI
+/+ and CD19-Cre/Chr13 PRELI
−/− paired littermates.
Figure 6
CD19-Cre/Ch13 PRELI
−/− transcripts have exon II sequences.
(a) RT-PCR results of peripheral blood leukocyte (PBL) PRELI transcript amplification from WT CD19/Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mouse littermates. A 2.5–0.3 kb molecular weight marker range is shown on the left of the ethidium bromide-stained gel image to verify the length of PRELI open reading frame (ORF). The predicted 670 bp molecular size of PRELI ORF PCR fragments includes forward and reverse amplifying primers with respective restriction endonuclease EcoR1 and Sal1 sequences (depicted in section c). (b) Immunoblot results reveal PBL PRELI protein levels in WT CD19/Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mice. Of note, the same blot was divided into high and low molecular mass (kDa) sections, indicated by the intersect mark (≠) at proportional kDa boundaries. This strategy enables the assessment of PRELI expression (24.9 kDa) and at the same time, permits to independently monitor protein loading (MSF1-like) on identical sample lanes. (c) cDNA sequencing results obtained from a representative homozygous CD19-Cre/Chr13 PRELI−/− clone obtained after RT-PCR amplification (section a). Amplifying forward and reverse primers are shown in bold font and respective EcoR1 and Sal1 restriction endonuclease target sequences are indicated in grey font. Canonical translation initiation and stop codon sequences are circled, while exon II is framed. This sequence is identical to NCBI database annotation XM_001476721.
PRELI transcription by CD19Cre/Ch13 PRELI mice.
(a) Northern blots compare PRELI mRNA levels between WT CD19/Cre/Chr13 PRELI
+/+ and heterozygous CD19-Cre/Chr13 PRELI
+/− or homozygous CD19-Cre/Chr13 PRELI
−/− mouse spleen B cells. (b) qRT-PCR assessment of PRELI transcription between WT CD19/Cre/Chr13 PRELI
+/+ and homozygousCD19-Cre/Chr13 PRELI
−/− mice. qRT-PCR comparisons include results obtained with RNA from bone marrow and spleen B cells. Data are presented in relative Ct and are the result of at least three WT CD19/Cre/Chr13 PRELI
+/+ and CD19-Cre/Chr13 PRELI
−/− paired littermates.
CD19-Cre/Ch13 PRELI
−/− transcripts have exon II sequences.
(a) RT-PCR results of peripheral blood leukocyte (PBL) PRELI transcript amplification from WT CD19/Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mouse littermates. A 2.5–0.3 kb molecular weight marker range is shown on the left of the ethidium bromide-stained gel image to verify the length of PRELI open reading frame (ORF). The predicted 670 bp molecular size of PRELI ORF PCR fragments includes forward and reverse amplifying primers with respective restriction endonuclease EcoR1 and Sal1 sequences (depicted in section c). (b) Immunoblot results reveal PBL PRELI protein levels in WT CD19/Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre/Chr13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mice. Of note, the same blot was divided into high and low molecular mass (kDa) sections, indicated by the intersect mark (≠) at proportional kDa boundaries. This strategy enables the assessment of PRELI expression (24.9 kDa) and at the same time, permits to independently monitor protein loading (MSF1-like) on identical sample lanes. (c) cDNA sequencing results obtained from a representative homozygous CD19-Cre/Chr13 PRELI−/− clone obtained after RT-PCR amplification (section a). Amplifying forward and reverse primers are shown in bold font and respective EcoR1 and Sal1 restriction endonuclease target sequences are indicated in grey font. Canonical translation initiation and stop codon sequences are circled, while exon II is framed. This sequence is identical to NCBI database annotation XM_001476721.These results, together with the evidence of conditional Cre-mediated Chr13 PRELI gene deletion (Fig. 3b and c) suggested that the PRELI mRNA and protein expression observed in homozygous CD19-Cre/Chr13 PRELI
−/− mice could not have originated from the Chr 13 locus. It is therefore conceivable that complementary loci, encoding LEA proteins of related or identical gene pool, could operate in concert to overcome Chr13 PRELI deficiency.
Spare PRELI loci compensate the Chr 13 PRELI gene deficiency
In support of this hypothesis, updates of mouse databases revealed the presence of additional PRELI gene copies in mouse chromosome 5 and 1. Strikingly, PRELI copy in Chr5 is an intronless gene (Fig. 7a) and transcribes mRNAs, whose deduced amino acid sequence is 100% identical to that encoded by the Chr13 PRELI gene (Fig. 7b). Similarly, Chr1 PRELI gene is also intronless (Fig. 7a) but its nucleotide sequence is only 98% identical to Chr5 and 13 genes (not shown). The distinctive nucleotide divergence of the Chr1 PRELI gene from those of Chr5 and 13 loci appears to give rise to premature stop codons, which would preclude PRELI-like translation. However, the annotated nucleotide sequence data was generated from pooled DNA of diverse mouse strains and hence, the likelihood of strain-related polymorphisms and/or nucleotide mismatches cannot be completely excluded. Nevertheless, the prominent PRELI mRNA and protein levels found in all homozygous CD19-Cre/Chr13 PRELI
−/− mouse lines examined indicate that overall expression is amply sufficient to surmount Chr13 PRELI gene deficiency, irrespective of whether it originated from Chr5 PRELI alone or from combined Chr5 and Chr1 PRELI gene transcription. Moreover, the compensatory PRELI mRNA and protein expression in CD-19Cre/Chr 13 PRELI−/− mice was vastly kept at physiological levels. Therefore, retention of B cell responses to stress and death signaling is anticipated. These findings additionally suggest that inter-chromosomal PRELI gene duplication represent evolutionarily conserved LEA-dependent mechanisms to preserve vital physiology.
Figure 7
Additional PRELI gene copies in Chr 5 and 1 loci.
(a) Top: Relative PRELI gene location in Chr 5 is shown with distance/direction coordinates (black triangles) and accession number; transcript database annotation at (http://www. ncbi.nlm.nih.gov/sites/) is provided; 5′-3′ transcript orientation with respect to the gene locus is indicated by a thick black arrow; and protein annotation, which also originated from the same uniform resource locator (URL) link shown above, depicts deduced 5′ and 3′ untranslated regions (in grey) and coding open reading frame (in black). Bottom: Designated PRELI gene location in Chr 1, which includes distance/direction coordinates (black triangles) and database accession number. It also displays database annotation of respective transcript at (http://www.ncbi.nlm.nih.gov/sites) and its relative 5′-3′ direction with respect to the gene locus is shown by a thick black arrow. A region spanning the predicted mRNA is shown as a grey rectangle. (b) Amino acid sequence alignment between proteins respectively encoded by Chr 13 and Chr 5 PRELI gene loci is shown in color-coded format: A numbered consensus generated by the Clustal alignment software (see methods) is shown in black font, while Chr 13 PRELI and Chr 5 PRELI amino acid sequences are respectively aligned in dark and grey font.
Additional PRELI gene copies in Chr 5 and 1 loci.
(a) Top: Relative PRELI gene location in Chr 5 is shown with distance/direction coordinates (black triangles) and accession number; transcript database annotation at (http://www. ncbi.nlm.nih.gov/sites/) is provided; 5′-3′ transcript orientation with respect to the gene locus is indicated by a thick black arrow; and protein annotation, which also originated from the same uniform resource locator (URL) link shown above, depicts deduced 5′ and 3′ untranslated regions (in grey) and coding open reading frame (in black). Bottom: Designated PRELI gene location in Chr 1, which includes distance/direction coordinates (black triangles) and database accession number. It also displays database annotation of respective transcript at (http://www.ncbi.nlm.nih.gov/sites) and its relative 5′-3′ direction with respect to the gene locus is shown by a thick black arrow. A region spanning the predicted mRNA is shown as a grey rectangle. (b) Amino acid sequence alignment between proteins respectively encoded by Chr 13 and Chr 5 PRELI gene loci is shown in color-coded format: A numbered consensus generated by the Clustal alignment software (see methods) is shown in black font, while Chr 13 PRELI and Chr 5 PRELI amino acid sequences are respectively aligned in dark and grey font.In further support of the relevance of in vivo PRELI functions, recent studies have demonstrated that transgenic (Tg) mice ubiquitously expressing high levels of mutant PRELI proteins that lacked the functional LEA motif (PRELI/LEA−) succumbed at early embryo stages [5]. PRELI/LEA− Tg embryos died of massive apoptosis, caused by a dominant-negative molecular hindrance, which prevented endogenous LEA-dependent cytoprotection and severely compromised mouse development [5]. Moreover, Tg mice in which mutant PRELI/LEA− expression was driven by the endothelial and hematopoietic cell lineage-specific vav promoter [42], [43], died of systemic haemorrhages within five weeks of postnatal life and showed poor lymphoid organ development [5]. Remarkably, no other proteins with similar tissue distribution, mitochondria localization and pro-survival functions could circumvent PRELI/LEA
− Tg lethality, thus emphasizing the unique LEA-dependent mechanisms that are essential for plant and animal embryo development and cell survival [3], [4], [5], [18], [20], [21], [23], [30], [31].Thus, the present work emphasises the conserved cytoprotection activity of LEA-containing proteins in general [1], [3], [4], [5], [18], [20], [21], [28] and supports the vital PRELI physiology, which could be upheld by spare chromosome imprints that confer failsafe genetic means to ensure the survival of cells undergoing strenuous development [20], [21], [28], [30], [31] and selection pressure [5], [32], [44].
Discussion
Eukaryote cells react to stress and death-inducing stimuli by a coordinated transduction of signals that trigger the expression of genes that are relevant for cell homeostasis and survival [20], [21], [30], [45]. In keeping with this notion, LEA motif-containing genes encode an evolutionarily conserved family of proteins, which have emerged as archetypal protectors of eukaryote cells against stress and death cues [3], [4], [18], [20], [21], [23], [28], [30], [31]. Although LEA proteins were first identified and studied in plants [19], [28], [30], [45], [46], a decade of broad prokaryote and eukaryote research emphasizes their evolutionary conservation and biological impact in stress tolerance [1], [5], [20], [21], [31], [47]. For instance, the Drosophila proteins prel (PRELI-like), slmo (slowmo) and retm (real-time) proteins constitute a family of mitochondrial LEA-containing orthologs, which also possess conserved MSF1-like domains and are activated during embryo development [3], [23]. Analogous to plants, nematodes use LEA-dependent anhydrobiosis functions as protective means against dehydration [20], [48]. Moreover, Ups1p is a yeast LEA protein that is localized within mitochondrial intermembrane space (IMS), whose known interactions with Mgm1p keep mitochondria cristae junctions tight and prevent the exit of apoptogenic molecules [4], [17].As the first example of LEA-containing proteins in vertebrates, the PX19 gene is an avian ortholog, whose expression is induced in response to stress-inducing bromodeoxyuridine and appears to be critical for haematopoietic cell development [18]. Among vertebrates, PRELI is a mammalian LEA-containing protein with N-terminal mitochondrial localization MSF1-like signals and tandem C-terminal repeats of the LEA domain [1], [2]. Identical to yeastUps1p, PRELI locates within the IMS and interacts with OPA1, the mammalian homolog of yeastMgm1p
[6], [22], to uphold mitochondria membrane potential Δψm, support oxidative phosphorylation reactions and regulate protein traffic [5]. The evidence that human PRELI can biochemically and functionally substitute yeastUps1p in the mitochondria [17], further emphasizes their biological resemblance.In view of the widespread support of LEA protein physiology in eukaryote cell protection against death-inducing stimuli [1], [3], [4], [18], [20], [21], [28], [30], [31] and given the robust PRELI transcript levels during embryo development [5], the rational inference was that LEA gene expression could be vital in mammals. Consistent with this hypothesis, Tg mice with dominant-negative PRELI/LEA
− expression died at early embryo stages or soon after birth, as a result of molecular hindrance preventing endogenous PRELI functions [5]. Furthermore, additional PRELI gene copies in mouse Chr 5 and 1 have been identified (Fig. 7), whose expression seems sufficient to keep mRNA and protein expression at physiological levels and thus overcome Chr13 PRELI gene loss.Relevant to the safeguard of essential biology, LEA proteins in plants and animals are recognized for their multiple gene copy distribution within the same organism [31]. In plants, fourteen of the 51 LEA genes, grouped into nine classified families, are duplicated [49], [50]. The imprinted LEA genetics for physiological safety can therefore be interpreted as evolutionarily conserved means to keep organelle structures intact and thus ensure cell functions and survival. These include, maintenance of mitochondria cristae junctions to support RC oxidative phosphorylation reactions, uphold osmolarity, regulate ROS levels, prevent dehydration, and protect cells against thermodynamic shock-induced stress [5].Remarkably, LEA gene duplication is not restricted to plants [31] and thus, the relatively homogenous distribution of spare copies either within the same or distinct chromosomes [50] likely reflects conserved measures to bank essential genetics, via inter and intra-chromosome gene repeats. In nematodes, homologous avLEA and ceLEA proteins regulate tolerance to desiccation-induced stress and overall protein stabilization functions [20], [21]. Although identical LEA gene duplicates are yet to be identified in Drosophila, this species counts on the PRELI-like proteins Slmo, Prel and Retm to home in the mitochondria and sustain RC-dependent ATP synthesis [3], [23]. In the same context, yeastUps1p and Ups2p share remarkable resemblance with PRELI in supporting mitochondria structure integrity and physiology [4], [17].The present study speculates that LEA proteins in mammals possess gene duplication traits equivalent to those observed in plants [31], [49], [50]. Consistent with this theory, gene and protein databases have revealed that the mouse carries at least two spare PRELI gene copies in Chr 5 and Chr 1 (Fig. 7). Importantly, the probability of persistent PRELI expression, originating from duplicate gene loci is high for Chr 5 PRELI and conceivable for Chr 1 PRELI genes. It is therefore plausible that gene expression from Chr 5 PRELI or in conjunction with Chr 1 PRELI locus occurs as a means to preserve functions that are essential for mouse embryo development and cell survival. However, it must be noted that although the presence of spare PRELI genes represent backup means to circumvent the loss of the Ch 13 locus, expression in CD19-Cre/Ch 13 PRELI
−/− mouse B cells remains under the same genetic and epigenetic regulatory mechanisms as those of WT B cells. In this context B cell PRELI expression is also under physiologic control of cell development and maturation signals.In conclusion, the data presented and discussed in this study highlight the biological significance of LEA proteins in general and PRELI in particular, whose physiology links mitochondria biogenesis, energy metabolism, and cell responses to stress and death signaling [5]. The impact of these functions, which involve hallmark mechanisms relevant to embryo organogenesis, development and survival in plants and animals [3], [4], [5], [17], [18], [20], [21], [28], [30], stems from the remarkable array of LEA proteins across evolution and the inherent capacity to undergo gene locus duplication [31], [49], [50]. In keeping with this concept, LEA genes epitomize conserved molecular models that have been long presumed to portray backup genetics applied to mechanisms of cell preservation [49], [50]. The fact that mouse PRELI gene undergoes inter-chromosomal gene duplication provides experimental support to such prediction and suggests that spare Chr 5 and potentially Chr 1 PRELI loci (Fig. 7) play genetically meaningful roles to uphold cytoprotection functions after Chr 13 PRELI gene loss. Lastly and to underscore the relevance of the evolutionary conservation of LEA duplication traits, figure 8 summarizes gene database annotations, as evidence that human PRELI gene also undergoes inter-chromosomal duplication at Chr 5q35.3 and Chr 6q22.32. Notably, human Chr 5 and 6 PRELI loci are confirmed spare gene copies, which encode amino acid sequence that are 100% identical to the Q9Y225 protein annotation (Fig. 8).
Figure 8
Spare PRELI gene copies in humans.
This figure provides mRNA and protein database URL information, including gene ID annotations, chromosome coordinates, nucleotide and protein accession number annotations for human PRELI gene duplicates found in Chr 5q35.3 and Chr 6q22.32.
Spare PRELI gene copies in humans.
This figure provides mRNA and protein database URL information, including gene ID annotations, chromosome coordinates, nucleotide and protein accession number annotations for human PRELI gene duplicates found in Chr 5q35.3 and Chr 6q22.32.Although future research will provide full appraisal of PRELI biological significance, the present study aims to share information deemed relevant to the broad Biology field.
Materials and Methods
Cloning and Sequencing
A mouse spleen cDNA library (Clontech Laboratories, Inc., Palo Alto, CA) was screened by hybridization to a human PRELI cDNA probe. A selected clone was purified, sequenced (DNA Sequencing Core Facility, UT-MDACC) and found to be identical to an annotated sequence in the National Center for Biotechnology Information (NCBI) database: Accession # XM_001476721. The sequence information served to retrieve a Chr 13 bacterial artificial chromosome (BAC) clone (Accession # NT_039589), which was used as the base to design the strategy for conditional PRELI gene targeting in mice.
PRELI mRNA Expression
PRELI mRNA in situ hybridization was performed on normal 13.5 dpc embryo sections, covered with 4 million counts of 35S-UTP-labeled antisense or sense complementary RNA (cRNA) probes and hybridized overnight (ON) at 60°C. Post-hybridization washes were processed as previously reported [51]. After ON incubation, slides were dipped in Kodak NTB-2 emulsion and exposed for three days. Images were acquired using an Olympus BX60 microscope equipped with a SPOT digital camera (Diagnostics Instruments). Also, embryo stage-specific (days post coitum or dpc.) and multiple tissue northern (MTN) blots (Clontech, Palo Alto CA), routinely normalized against housekeeping transcripts, were respectively hybridized to 32P-labeled mouse PRELI cDNA probes, as recommended by the manufacturer.
Confocal Fluorescence Microscopy
For sub-cellular PRELI protein localization
Control and PRELI Blin-1 transfectants [5] were centrifuged (800 rpm) onto slides and immediately fixed with 4% paraformaldehyde. Slides were probed with anti-HSP60 monoclonal antibody (Stressgen Biotechnologies, Victoria, BC, Canada) in combination with custom-produced anti-PRELI polyclonal IgGs (Genemed Synthesis, Inc., San Antonio, TX). Anti-Hsp60 and PRELI antibody reactivities were respectively revealed by green fluorescence (Alexa 488)-conjugated anti-mouse and red fluorescence (Alexa 594)-conjugated anti-rabbit IgGs (Molecular Probes, Eugene, OR).
For mitochondria morphology and AIF release analyses
Control and PRELI/Blin-1 transfectants [5] were treated with or without 1 µM STS. After an 8 hr treatment, cells were harvested, placed onto polylysine-coated slides (CEL Associates, Pearland, TX) and fixed with 4% paraformaldehyde. The fixed cells were probed with polyclonal anti-AIF (Chemicon International, Temacula, CA) IgGs. Polyclonal anti-AIF reactivity was revealed by red fluorescence (Alexa 594)-conjugated anti-rabbit IgGs (Molecular Probes, Eugene, OR). Images were captured by confocal microscopy (Olympus 1X71; PMT 0-900v; Scan speed 0.005184 sec/line). To emphasize organelle/cell morphology and protein distribution red fluorescence, AIF images were mounted against greyscale cell background using Adobe Photoshop CS4 (Adobe Systems Inc. San Jose, CA) software.
Generation of CD19-Cre/Chr 13 PRELI deficient Mice
To generate conditional PRELI deficient mouse lines, the targeting vector EASY-FLIRT was used to insert Cre recombinase loxP recognition sequences into the Chr 13 PRELI gene locus (Fig. 3a) in a manner so that exon II was flanked by two LoxP sites (Floxed target). The mouse PRELI gene on chromosome 13 was replaced by homologous recombination in 129 embryonic stem cells. After obtaining homozygous PRELI
f/f mouse lines, animals were extensively backcrossed into the C57BL/6 background to produce genetically equal PRELI
f/f mouse strains. This approach aimed to facilitate subsequent breeding schemes with most C57BL/6-Cre mice. Wild type and heterozygous littermates were routinely used as controls. Genotyping of the engineered mouse lines was confirmed by PCR and Southern blot analyses. The forward 5′cttcaccctgatgctgcacgggt c3′and reverse 5′accgaggcacaccccagttatct3′ primer sequences that were used in the design of PCR based experiments to assess the genotype of floxed PRELI mouse litters are respectively located at relative PRELI genomic positions 4298–4323 (within exon I) and 5761–5784 (intron II). The 5′ (Rab24 gene locus) and 3′ (Mad3 locus) external probes, as indicated in Figure 3a, were used in confirmatory Southern blot analyses.
Pure RNA preparations from bone marrow, peripheral blood leukocytes (PBL) and spleen cells were obtained to quantitatively compare PRELI mRNA expression levels between WT CD19-Cre/Chr13 PRELI
+/+ and homozygous CD19-Cre/Chr13 PRELI B cells using SABioscience/QIAGEN (Frederick, MD) reagents and RT2qRT-PCR primer assay kit (Catalogue # PPM40154). qRT-PCR reactions were carried out as reported elsewhere [39], [40], [41], using SYBR Green/Rox PCR master mix (Sabioscience, Frederick, MD, USA) in a 7500 fast real time PCR system (Applied BioSystems, Carlsbad, CA).
PRELI transcript amplification, cloning and sequencing
Total RNA was purified from PBL of WT CD19-Cre/Chr13 PRELI
+/+, heterozygous CD19-Cre//Ch13 PRELI
+/−, and homozygous CD19-Cre/Ch13 PRELI
−/− mouse littermates by standard procedures. RNA was reverse-transcribed using the Superscript II RT kit (Invitrogen, Carlsbad, CA) according to the manufacture's protocol. The PRELI open reading frame was subsequently amplified by the high fidelity DNA polymerase method (Roche, Mannheim, Germany) using forward 5′aagctt and reverse 5′ggtacc primers that respectively included EcoR1 and Sal1 (bold font) to facilitate directional cloning. RT-PCR products were gel-purified, cloned into the pCMV-Script vector (Stratagene-Agilent Technologies/Genomics, Santa Clara, CA), automatically sequenced (The University of Texas MD Anderson Sequencing Core), and aligned for Lasergene (DNAstar, Inc. Madison, WI) sequence analysis.
Immunoblotting
10 µg of PBL protein lysates, obtained from each WT CD19-Cre/Chr 13 PRELI
+/+, heterozygous CD19-Cre/Chr 13 PRELI
+/−, and homozygous CD19-Cre/Chr13 PRELI
−/− mice were each resolved by 12% SDS-PAGE and electro-transferred overnight onto a nitrocellulose matrix. The blot was divided into high (above the 35 kDa mark) and low (below the 35 kDa mark) molecular sections and respectively reacted overnight, at 4°C, to custom-produced polyclonal anti-MSF1-like and LEA sequence-specific anti-PRELI IgGs (Bethyl Laboratories, Montgomery, TX). After intense washing, reactions were revealed with HRP-conjugated anti-rabbit IgG (Abcam) and chemilluminiscence (Pierce, Rockford, IL) autoradiography, according to the manufacturer instructions.
Ethics Statement
All mice in this study were housed under specific pathogen-free conditions and experiments were conducted according to approved Institutional Animal Care and Use Committee (IACUC) protocol # 03-06-03632.
Authors: Pantelis Georgiades; Sarah Ogilvy; Hélène Duval; Diana R Licence; D Stephen Charnock-Jones; Stephen K Smith; Cristin G Print Journal: Genesis Date: 2002-12 Impact factor: 2.487
Authors: Sarah Ogilvy; Christine Louis-Dit-Sully; Joanne Cooper; Robin L Cassady; Denis R Alexander; Nick Holmes Journal: J Immunol Date: 2003-08-15 Impact factor: 5.422
Authors: Wesley Reardon; Sohini Chakrabortee; Tiago Campos Pereira; Trevor Tyson; Matthew C Banton; Katharine M Dolan; Bridget A Culleton; Michael J Wise; Ann M Burnell; Alan Tunnacliffe Journal: BMC Mol Biol Date: 2010-01-19 Impact factor: 2.946