BACKGROUND: In humans and other animals, the internal organs are positioned asymmetrically in the body cavity, and disruption of this body plan can be fatal in humans. The mechanisms by which internal asymmetry are established are presently the subject of intense study; however, the functional significance of internal asymmetry (outside the brain) is largely unexplored. Is internal asymmetry functionally significant, or merely an expedient way of packing organs into a cavity? METHODOLOGY/PRINCIPAL FINDINGS: Like humans, Drosophila shows internal asymmetry, with the gut thrown into stereotyped folds. There is also renal asymmetry, with the rightmost pair of renal (Malpighian) tubules always ramifying anteriorly, and the leftmost pair always sitting posteriorly in the body cavity. Accordingly, transcriptomes of anterior-directed (right-side) and posterior-directed (left-side) Malpighian (renal) tubules were compared in both adult male and female Drosophila. Although genes encoding the basic functions of the tubules (transport, signalling) were uniformly expressed, some functions (like innate immunity) showed positional or gender differences in emphasis; others, like calcium handling or the generation of potentially toxic ammonia, were reserved for just the right-side or left-side tubules, respectively. These findings correlated with the distinct locations of each tubule pair within the body cavity. Well known developmental genes (like dorsocross, dachshund and doublesex) showed continuing, patterned expression in adult tubules, implying that somatic tissues maintain both left-right and gender identities throughout life. Gender asymmetry was also noted, both in defence and in male-specific expression of receptors for neuropeptide F and sex-peptide: NPF elevated calcium only in male tubules. CONCLUSIONS/SIGNIFICANCE: Accordingly, the physical asymmetry of the tubules in the body cavity is directly adaptive. Now that the detailed machinery underlying internal asymmetry is starting to be delineated, our work invites the investigation, not just of tissues in isolation, but in the context of their unique physical locations and milieux.
BACKGROUND: In humans and other animals, the internal organs are positioned asymmetrically in the body cavity, and disruption of this body plan can be fatal in humans. The mechanisms by which internal asymmetry are established are presently the subject of intense study; however, the functional significance of internal asymmetry (outside the brain) is largely unexplored. Is internal asymmetry functionally significant, or merely an expedient way of packing organs into a cavity? METHODOLOGY/PRINCIPAL FINDINGS: Like humans, Drosophila shows internal asymmetry, with the gut thrown into stereotyped folds. There is also renal asymmetry, with the rightmost pair of renal (Malpighian) tubules always ramifying anteriorly, and the leftmost pair always sitting posteriorly in the body cavity. Accordingly, transcriptomes of anterior-directed (right-side) and posterior-directed (left-side) Malpighian (renal) tubules were compared in both adult male and female Drosophila. Although genes encoding the basic functions of the tubules (transport, signalling) were uniformly expressed, some functions (like innate immunity) showed positional or gender differences in emphasis; others, like calcium handling or the generation of potentially toxic ammonia, were reserved for just the right-side or left-side tubules, respectively. These findings correlated with the distinct locations of each tubule pair within the body cavity. Well known developmental genes (like dorsocross, dachshund and doublesex) showed continuing, patterned expression in adult tubules, implying that somatic tissues maintain both left-right and gender identities throughout life. Gender asymmetry was also noted, both in defence and in male-specific expression of receptors for neuropeptide F and sex-peptide: NPF elevated calcium only in male tubules. CONCLUSIONS/SIGNIFICANCE: Accordingly, the physical asymmetry of the tubules in the body cavity is directly adaptive. Now that the detailed machinery underlying internal asymmetry is starting to be delineated, our work invites the investigation, not just of tissues in isolation, but in the context of their unique physical locations and milieux.
The vertebrate body plan is internally asymmetric [1], [2], [3], and although complete situs inversus is benign in humans, partial disruption of this asymmetric organization (for example in heterotaxy) can be lethal [4], [5], [6]. Although separated by 450 M year of divergent evolution, many insect body plans show similar internal asymmetry; for example, the alimentary canal of the classical developmental model Drosophila starts development symmetrically, but is then thrown into highly stereotyped folds within the body cavity. Just as human kidneys sit slightly differently in the abdomen, so the Drosophila Malpighian (renal) tubules show marked asymmetry; the two tubule primordia initially sit dorsoventrally at the midgut / hindgut boundary, then a rotation of the developing alimentary canal sets the dorsal tubules on the right side, and the ventral tubules on the left side, of the body [7]. Remarkably the right-side tubules always elongate anteriorly within the body cavity into the thorax, while the left-hand tubules always grow posteriorly [8] (
). There is a clear advantage to this distribution, as it ensures that the tubules ramify throughout the body cavity (haemocoel). Thus the haemolymph, although circulating only sluggishly, is nonetheless regulated efficiently.
Figure 1
Internally asymmetric organisation of the Drosophila alimentary canal.
The alimentary canal is divided into ectodermal foregut (grey), endodermal midgut (yellow) and ectodermal hindgut (orange). The midgut and hindgut are thrown into tightly defined loops and folds, the most obvious consequence being that the two pairs of Malpighian (renal) tubules (blue) are oppositely directed. The right pair (with conspicuous dilated initial segment) is always directed anteriorly and wraps around the midgut; whereas the left pair are directed posteriorly and associate with the hindgut.
Internally asymmetric organisation of the Drosophila alimentary canal.
The alimentary canal is divided into ectodermal foregut (grey), endodermal midgut (yellow) and ectodermal hindgut (orange). The midgut and hindgut are thrown into tightly defined loops and folds, the most obvious consequence being that the two pairs of Malpighian (renal) tubules (blue) are oppositely directed. The right pair (with conspicuous dilated initial segment) is always directed anteriorly and wraps around the midgut; whereas the left pair are directed posteriorly and associate with the hindgut.However, the tubules also display morphological differences. The right-hand tubules contain conspicuous distal initial and transitional segments (
). Although no such segments are visible in the left-hand tubules, genetic markers that label initial and transitional domains in the anterior tubules also label smaller and otherwise morphologically cryptic domains in the posterior tubule [9]. Unusually, the Drosophila Malpighian tubule is capable of providing both developmental and functional readouts [8], as its transport and signalling physiology has proved highly amenable to study [10]. Although the cells of the initial domain are thin and do not display prominent structural adaptations for ion transport (like abundant mitochondria or deep microvilli), this region is capable of excreting calcium at extremely high rates [11]. There is thus already some evidence of functional asymmetry in this simple kidney, and this is reinforced by asymmetric gene expression: the homothorax/dorsotonals transcription factor is expressed exclusively in the initial segment of the right-hand tubules [12].The insect Malpighian tubule – and particularly that of Drosophila – is well understood at multiple levels [13]. It is a surprisingly good model for renal function and disease [14], including stem cell differentiation and cancer [15], [16], [17], [18]; and even the formation of kidney stones [19], [20]. The tubule, as a major osmoregulatory tissue with a wide range of transporters in common with mammalian kidney [12], [21], [22], [23], responds to desiccation stress, salt stress [24], [25], oxidative stress [26], [27], [28], immune stress [29], and plays a key role in the defence against xenobiotics [30], [31], [32], [33], [34]. It is also a model for neuroendocrine control [35], [36], [37]. The Drosophila Malpighian tubule thus offers a particularly useful, and broadly relevant, system in which to address issues of asymmetry.One approach to address this and other possible asymmetries in the tubule is to compare the transcriptomes of right- and left-hand tubules; so in this study we performed a comprehensive analysis, using Affymetrix version 2 chips on left- and right-hand tubules, and further subdivided by sex. The results showed previously unsuspected lateral or sex-specific asymmetry in expression in a diverse set of genes, including those involved in positional specification in the embryo, and others involved in signalling. The data thus allow a reappraisal of functional sequelae of positional asymmetry in somatic tissues in higher organisms.
Results
Left v. Right: Genes Up-regulated in Right-side Tubules Suggest an Interplay with the Gut
As the posterior tubule appears morphologically similar to the anterior (right) tubule, but with a reduced initial segment [9], we expected to find the left tubule transcriptome to be broadly a subset of the right tubule. Indeed, of 88 genes significantly changed (at FDR<0.05), 74 genes were significantly up-regulated in right tubules, compared with only 14 in left tubules (
& ). The results implicate the right-side tubules in defence and calcium handling roles; the 5 genes with most asymmetric expression are presented, together with their FlyAtlas-derived expression in other tissues, in
.
Table 1
The 10 most anterior, posterior, female and male-enriched genes.
Probeset ID
Gene Title
P-value
Fold-Change
Anterior-enriched
1638974_at
CG14963
1.9E-19
1940.9
1640881_at
CG16762
1.7E-10
239.7
1634031_at
Bestrophin 2
1.4E-10
63.6
1631218_at
Dorsocross
5.0E-12
52.4
1627384_at
CG6225
2.8E-08
18.5
1629459_at
Dorsocross3
3.8E-12
16.7
1635591_at
ninjurin A
2.7E-10
15.2
1625266_at
antigen 5-related
1.1E-05
12.5
1628302_at
CG13748
1.4E-09
10.6
1635398_at
CG10587
2.8E-08
6.2
Posterior-enriched
1624060_at
bric-a-brac
1.7E-04
–1.5
1626439_at
CG15353
1.8E-04
–1.9
1635803_s_at
bowel
8.7E-07
–1.9
1634418_at
CG33281
1.5E-07
–2.4
1637123_a_at
CG33281
3.5E-07
–2.7
1627354_at
CG11779
1.3E-04
–3.3
1634658_a_at
CG42708
2.0E-05
–3.8
1625629_at
Esterase-6
3.9E-08
–3.8
1639637_a_at
CG3376
5.1E-07
–7.6
1629738_at
CG14957
9.2E-07
–9.0
Female-enriched
1629545_at
yolk protein 1
5.4E-07
515.7
1631419_at
yolk protein
4.4E-07
514.0
1623655_at
yolk protein 2
2.3E-07
387.7
1633540_at
CG8147
5.0E-07
39.9
1630600_at
Frost
2.1E-05
31.4
1637702_at
---
1.2E-07
28.8
1641419_at
attacin
6.7E-04
25.1
1633820_at
Fad2
3.5E-04
22.5
1623776_s_at
doublesex
1.4E-10
19.3
1627613_at
Metchnikowin
7.1E-05
12.0
Male-enriched
1635189_at
drosomycin
1.9E-03
–6.8
1638816_at
CG3884
1.1E-03
–6.8
1628982_at
neuropeptide F receptor
7.0E-07
–6.9
1632636_at
CG2145
3.1E-09
–8.6
1638484_at
Gene 3
2.7E-04
–10.6
1640799_at
doublesex
6.9E-13
–10.8
1628611_at
CG11241
3.5E-09
–11.1
1637145_at
CG14787
6.4E-10
–18.3
1633432_at
CG9657
4.9E-12
–41.6
1633275_at
CG31562
7.8E-10
–56.8
Complete lists are in Supporting information S1.
Figure 2
Adult tissue expression profiles of the 5 genes with most enriched expression in anterior (right-side tubules).
Y-axis shows mean Affymetrix microarray signal for each tissue along the x axis (N = 4 arrays). The data for anterior and posterior tubules are highlit and labelled A and P, respectively. Abbreviations: Tag - thoracicoabdominal ganglion; sg - salivary gland; FA, MA, FP, MP - female or male, anterior or posterior tubules; acc- male accessory glands; v_spt, m_spt – virgin or mated spermatheca; car – carcass; fly – whole fly. Data for tubules are from this paper: comparison data for other tissues is derived from FlyAtlas.org. For simplicity, error bars are omitted; these can be obtained by interrogation of FlyAtlas.org, but are typically in the range 5–10% of the signal.
CG14963 is 1940x up-regulated in right (anterior) tubules, and FlyAtlas.org [38] reports that expression of this gene is utterly specific to the tubule. What function could be performed entirely by just two out of 4 tubules? CG14963 encodes a protein containing an insect allergen related repeat, associated with nitrile-specific detoxification. To discourage herbivores, some plants (notably brassicas) have developed a glucosinolate-myrosinase chemical defence mechanism; and consequently insects, like caterpillars of the small white butterfly (Pieris rapae), have adapted to produce a detoxifying molecule, nitrile-specifier protein (NSP) [39]. BLASTP searches reveal that proteins closely similar to CG14963 are found throughout the Diptera, but that the Dipteran branch is rather diverged from the Lepidopteran branch. The implication is that CG14963 is part of a Dipteran adaptation to dietary challenge. Why then is this gene confined to, and expressed at high level in, the right-hand tubules (Fig. 2)? The key observation is that the right-hand tubules ramify anteriorly to surround the midgut, whereas the left-hand tubules are confined to the posterior abdomen, where they surround the hindgut. The tubules are major tissues of detoxification [31]; so if a toxic compound were released by digestion, and passed through the highly permeable midgut, it would thus be a task for primarily the anterior tubules to neutralize the compound. Conversely, the left tubules might be expected to be enriched for genes involved in detoxifying compounds leaching from the hindgut; this will be demonstrated later.Complete lists are in Supporting information S1.
Adult tissue expression profiles of the 5 genes with most enriched expression in anterior (right-side tubules).
Y-axis shows mean Affymetrix microarray signal for each tissue along the x axis (N = 4 arrays). The data for anterior and posterior tubules are highlit and labelled A and P, respectively. Abbreviations: Tag - thoracicoabdominal ganglion; sg - salivary gland; FA, MA, FP, MP - female or male, anterior or posterior tubules; acc- male accessory glands; v_spt, m_spt – virgin or mated spermatheca; car – carcass; fly – whole fly. Data for tubules are from this paper: comparison data for other tissues is derived from FlyAtlas.org. For simplicity, error bars are omitted; these can be obtained by interrogation of FlyAtlas.org, but are typically in the range 5–10% of the signal.A similar defensive role is implied for CG16762, another gene strongly (240x) up-regulated in right-hand tubules (
), and with tubule-restricted expression. BLASTP searching reveals similarity to TsetseEP, a mucin implicated in tsetse susceptibility to trypanosome attack. As all BLASTP hits are confined to the Schizophora, the gene family may represent a highly specific adaptive radiation within this subset of the Diptera, to defend against microbial attack. Although Drosophilids are not susceptible to trypanosome attack, dog heartworm (Dirofilaria immitis) is an intracellular parasite of the Malpighian tubules of culicid mosquitos; so there may be a general requirement for the tubule to defend against luminal pathogens.Conspicuously enriched (3.8x) in the left-side tubules, which wrap around the hindgut, is probe set 1634658_a_at (
), which corresponds to CG42708, a mitochondrial glutaminase [40]. FlyAtlas reports that this gene is particularly highly expressed in the tubules and hindgut. Glutaminase generates ammonia stoichometrically in the generation of glutamate from glutamine, and is found in kidney and liver in mammals: in kidney, the resulting ammonium ion can be used to rescue bicarbonate in the collecting duct [41]. Although abundantly produced in freshwater insects (where it can effectively diffuse away to harmless levels), ammonia is generally held to be a toxic and undesirable metabolite in terrestrial insects [42]. Our data suggest that this reaction is concentrated in tissues in the back end of Drosophila, thus compartmentalizing it away from other potentially sensitive tissues. To confirm the spatial segregation of glutaminase activity, we measured the glutamine: glutamate ratio in acutely-dissected head, thorax and abdomen in adult flies, showing that the ratio is lowest in the abdomen (
).
Figure 3
Glutamine: glutamate ratios in acutely dissected head, thorax and abdomen of adult flies.
Box plots denote median and interquartile ranges, with individual replicates (4 per tissue), marked.
Glutamine: glutamate ratios in acutely dissected head, thorax and abdomen of adult flies.
Box plots denote median and interquartile ranges, with individual replicates (4 per tissue), marked.Bestrophin 2 encodes (of four Drosophila bestrophins) the most closely related to humanbestrophin 1, a calcium- and volume-activated chloride channel of retinal pigmented epithelial cells, which is mutated in Best’s macular dystrophy [43], [44]. However, Bestrophins play wider roles: they are implicated in epithelial-to-mesenchymal transitions in human kidney [45], and in olfactory transduction [46]. In Drosophila, Best1 also mediates a calcium and volume activated chloride current [47]. FlyAtlas reports that, although expressed in eye, Best2 is abundant in epithelia; in adult tubule, it is 64x enriched in right-hand tubules (
). The tubules secrete fluid at high rates, and chloride conductance is under control of the diuretic neuropeptide leucokinin, which acts through intracellular calcium [48], [49]. However, Best2 is unlikely to be the major chloride channel of the tubule, because it is confined to the right-hand tubules, whereas leucokinin acts equally on both right and left tubules. An alternative is that Best2 mediates selective loading of specialized peroxisomes with calcium concretions; the initial segments of the right-side tubules are known to excrete calcium at remarkable rates [11], forming calcium rich concretions [50], derived from specialized peroxisomes containing an isoform of the SPCA Ca2+ ATPase [51]. Best2 also localizes to peroxisomes, both in vivo and in S2 cells in vitro (
, ). Manipulation of Best2 expression levels impacts on cellular calcium, consistent with a key role for this gene in calcium handling in the initial segment (
).
Figure 4
Asymmetric calcium excretion deduced from anterior-specific gene expression.
(A) Best2 colocalizes with peroxisomal SPoCk-C. Heterologous and ectopic expression of Best2-YFP and its colocalisation with native peroxisomal localized secretory pathway Ca2+/Mn2+ ATPase isoform C (SPoCk-C). The first panel of images shows the in vitro colocalisation (in S2 cells) of heterologously expressed yellow fluorescent protein fused Best2 (Best2-YFP) with native SPoCk-C (using affinity-purified rabbit anti-SPoCk-C antibody at 1:1000 [51]) and the second panel represents the same but in vivo colocalisation in adult tubules. Scale bars denote 10 µm. (B) Calcium changes in initial segment depend on Best2 expression. Real-time calcium traces in tubule initial segment principal cells, in response to the calcium-mobilizing diuretic peptide capa1, measured with targeted transgenic aequorin. Both over-expression and knockdown of Best2 modulates the cellular calcium signal. (C) The major peroxisomal calcium pool is in initial segment. Peroxisomal calcium traces in response to capa1 from tubules, tubules without initial segments, or microdissected initial segments alone. (D) Schematic enlargement of the initial segment of the anterior Malpighian tubule, outlining processes thought to underlie the formation and secretion of calcium-rich ‘spherites’, and labelled with some anterior-enriched candidate genes.
Asymmetric calcium excretion deduced from anterior-specific gene expression.
(A) Best2 colocalizes with peroxisomal SPoCk-C. Heterologous and ectopic expression of Best2-YFP and its colocalisation with native peroxisomal localized secretory pathway Ca2+/Mn2+ ATPase isoform C (SPoCk-C). The first panel of images shows the in vitro colocalisation (in S2 cells) of heterologously expressed yellow fluorescent protein fused Best2 (Best2-YFP) with native SPoCk-C (using affinity-purified rabbit anti-SPoCk-C antibody at 1:1000 [51]) and the second panel represents the same but in vivo colocalisation in adult tubules. Scale bars denote 10 µm. (B) Calcium changes in initial segment depend on Best2 expression. Real-time calcium traces in tubule initial segment principal cells, in response to the calcium-mobilizing diuretic peptide capa1, measured with targeted transgenic aequorin. Both over-expression and knockdown of Best2 modulates the cellular calcium signal. (C) The major peroxisomal calcium pool is in initial segment. Peroxisomal calcium traces in response to capa1 from tubules, tubules without initial segments, or microdissected initial segments alone. (D) Schematic enlargement of the initial segment of the anterior Malpighian tubule, outlining processes thought to underlie the formation and secretion of calcium-rich ‘spherites’, and labelled with some anterior-enriched candidate genes.
A Mechanism for Asymmetric Calcium Handling
The only known functional asymmetry in tubule function is the anterior-specific storage excretion of calcium as phosphate-rich mineral concretions in the enlarged initial segments of the right-side tubules [11]. Based on results implicating SPoCk, the secretory pathway Ca2+/Mn2+ ATPase, [51] and Best2 (
) in calcium handling in tubule initial segment, it is possible to build a model for spherite formation in the tubule. Physiological data had implicated the initial segments as particular hot-spots for calcium transport [11]; and our data placing a peroxisome-targeted isoform of SPoCk on initial segment vesicles, was confirmed by direct recording of peroxisomal calcium, showing that the major peroxisomal calcium pool in tubules was in initial segments (
). Interestingly, the right-side tubule transcriptome is enriched for genes implicated in calcium and phosphate transport, and for peroxisomal biogenesis, allowing a conceptual model for spherite generation to be built (
). Calcium could be admitted to the specialized peroxisome by entry through a trp-like plasma membrane channel, together with a peroxisomal isoform of SPoCk; phosphate is provided by the Na+/phosphate cotransporter, NaPiT; the membrane is polarized by a specialized V-ATPase (with protons provided by a highly enriched isoform of carbonic anhydrase), and charge balance provided by the Best2chloride channel. Calcium is stabilized in the peroxisome by calexcitin, a specialized calcium-binding protein originally identified in sarcoplasmic reticulum. There is also scope for regulation of the pathway, because of high enrichment of calmodulin and a calmodulin-responsive transcriptional activator.
Given that there are real functional differences between left and right-side tubules, and that these are underpinned by significant transcriptional differences, it is interesting to start to identify the transcriptional programme involved in specifying asymmetry. The three Dorsocross transcription factors are found in a cluster on chromosome 3L. These T-box, p53-like, brachyury transcription factors were originally implicated in heart formation [52] at the dorsal midline, under control of decapentaplegic and wingless. They are possibly the products of recent gene duplication, because they have similar embryonic expression profiles, and are partially redundant [52]. Post-embryonically, however, FlyAtlas [38] reveals differences in expression. Doc1 is expressed mainly in tubule, hindgut and testis; doc2 is confined to the hindgut, and doc3 to tubule, hindgut and heart. Our data are consistent with reported embryonic expression in only the anterior tubules [52]; overexpression of Doc genes in the embryonic hindgut results in failure of the posterior tubules to develop, leaving only the anterior pair [53]. Although Doc genes are implicated in the very earliest stages of tubule specification, these data show that they continue to be expressed in the same spatially restricted pattern (Doc1 is 52x, and Doc3 is 17x, enriched in anterior rather than posterior tubule) through larval and into adult life, suggesting that the anterior/posterior distinction remains functionally significant throughout life, and that continued expression of Doc genes (or dorsocross transcriptional network) likely maintains that identity.To test whether Doc genes indeed impact on the functional asymmetry of adult tubules, we examined expression of a right-side specific gene, Best2, in a Doc1 hypomorph. In a Doc1 heterozygote insertional mutant (with 50%-less Doc1 expression than wild-type), Best2 expression was significantly reduced (to 50% of wild-type levels;
). The Minos {ET1}[11] transposon [54] insertion in Doc1 also drove GFP expression in anterior, but not posterior tubules (
), confirming that asymmetric expression of Doc1 directly controls asymmetric expression of Best2.
Figure 5
Asymmetric expression of Best2 is under the control of the dorsocross transcriptional network.
(A) Doc1 and Best2 expression in the anterior tubule are both reduced to 50% of wild-type levels in heterozygotes of the Mi{ET1} enhancer trap GAL4 insertional mutant, Doc1, in comparison to wild-type, w, flies. (B) Doc1 driven GFP expression confirms Doc1 anterior-enriched expression found in the microarrays and qRT-PCR. Scale bars denote 50 µm.
Asymmetric expression of Best2 is under the control of the dorsocross transcriptional network.
(A) Doc1 and Best2 expression in the anterior tubule are both reduced to 50% of wild-type levels in heterozygotes of the Mi{ET1} enhancer trap GAL4 insertional mutant, Doc1, in comparison to wild-type, w, flies. (B) Doc1 driven GFP expression confirms Doc1 anterior-enriched expression found in the microarrays and qRT-PCR. Scale bars denote 50 µm.Other transcription factors enriched in right-side tubules are dachshund (4.0x), the ski proto-oncogene homologue important in development of the legs and eyes, but not previously implicated in tubule function; and homothorax/dorsotonals (3.3x), also important in eye development. By contrast, bric-a-brac (1.5x), bowl (1.9x) and suppressor of hairy wing (1.2x) are all significantly enriched in the left-side (posterior) tubules ().
Gender Differences in Tubule Function
Male and female tubules show markedly distinct transcriptional profiles. Although most of the classical roles of the renal system (pumps and channels underlying the generation of a primary urine, and organic solute transporters for excretion of undesirable solutes) are expressed roughly equally in both sexes, 113 genes are up-regulated (≥2-fold) in female, and 116 genes in male, tubules (at FDR<0.05) (). Both by inspection, and using the Gorilla gene ontology package [55], we identified several classes of genes with clearly sexually-dimorphic expression, particularly in lipid metabolism, sex determination, neuropeptide signalling and immunity/defence.The yolk proteins, Yp1-3, encode lipases. Although rather broadly expressed (FlyAtlas.org), their expression is utterly sexually dimorphic, with F:M fold changes in excess of 380x. Other genes with enriched female expression implicated in fat or glyceride metabolism are Fad2 (22x), a fatty acid desaturase; CG3599 (6.5x), a biotinidase; and imaginal disc growth factor 3 (5.9x), a glycoside hydrolase. Although the function of female-specific independent of transformer (fit- enriched 9.9x) is not known, it is expressed in fat cells in the head [56], and so fit may also impact on fat metabolism. The clear implication is that the maternal investment in yolk impacts on other tissues, and that enhanced lipid metabolism is a critical task in females.
Sex Determination Genes and Sexual Dimorphism in Neuroendocrine Control
Understanding sex determination is a triumph of Drosophila developmental biology; however, there has been relatively little attention paid to the mechanism or physiological significance of maintenance of gender differences in post-embryonic somatic tissues. The expression data () clearly show that some of the best-known players in embryonic sex determination persist for the lifetime of the insect, presumably to maintain sexually dimorphic gene expression. For example, doublesex appears in both male-enriched (10x) and female-enriched (19x) lists, because there are distinct probe sets for the male and female transcripts of this gene. In situ hybridization confirms the enriched expression of Doublesex-RA in male tubules compared to female tubules. Similarly, Sex-lethal is enriched (2.8x) in male tubule, as is the dosage-compensation gene, male-specific lethal, msl-2 (3.4x). It is thus clear that adult tubules maintain a clear gender identity in terms of control of gene expression. Given the differing metabolic loads required for reproduction, and the implicit requirements for absorption, excretion and osmoregulation, it is reasonable that the tissues in the alimentary canal possess robust and lifelong gender identity. Although the popular view is that gender is important in development and the brain, the very clear message is that somatic tissues care about their sex too [57].If the tubules exhibit sexually dimorphic expression patterns, it is reasonable to expect that their endocrine control mechanisms might also diverge. Intriguingly, two well-known receptors (for sex peptide and neuropeptide F) are prominently male-enriched (). Their spatial expression patterns are presented along with their peptide ligands in . Sex peptide receptor (SPR) is 6.6x male-enriched. Sex peptide is transferred with the sperm to the female, where it induces a series of changes in physiology and behaviour, notably a reduction in receptivity to subsequent matings [58]. Not surprisingly, therefore, FlyAtlas reports high levels of the receptor in (female) spermathecae, the receptacles for sperm after mating. Selective expression of a neuropeptide targeted at females in male tubules is thus puzzling, but could be explained by the recent observation that myoinhibitory peptides (MIPs) are the ancestral ligands for SPR, as SPR homologues are found even in insects without an obvious sex peptide [59]. Furthermore, DrosophilaSPR is 10x more sensitive to the Drosophila MIP, allatostatin-B [60], [61] than to SP itself [59]. The data may thus have uncovered a previously unknown neuropeptide control mechanism for the tubule; allatostatin B-reactive cells are found at the junction between the anterior and middle midgut [62], offering a direct signalling interaction between the gut and the tubule.A second surprise is the male-specific expression of neuropeptide F receptor 1 (NPFR1) [63], [64], [65], [66], [67], Drosophila NPF appears to be a homologue of vertebrate Neuropeptide Y. Although sNPF is only distantly related to NPF, and the two peptides are not redundant, they still perform similar roles [67]. Neuropeptide F/Y signalling regulates physiological processes including feeding behaviour, metabolism, reproduction and stress responses both in vertebrates and invertebrates, and there is an extensive literature implicating neuropeptide F signalling in clock function, learning, appetite and growth in Drosophila
[68], [69]. However, FlyAtlas reveals that NPFR1 is conspicuously enriched in the adult tubule; and its expression in tubules is 6.9x male-enriched (Supporting information S1). This was confirmed by qPCR (6.3±0.96x (N = 3) male enriched), suggesting that male tubule could be a major target for NPF. This nicely links with the observation that expression of NPF itself in the brain is sexually dimorphic, with expression in some neurons being male-specific and under the control of transformer and fruitless [70]. By qPCR, we found that NPF expression is also male-enriched in both head and body (). FlyAtlas expression profiles are also presented for reference in . Thus both the peptide and its receptor show sex-specificity.What is the likely output of the signalling pathway? In heterologous systems, DrosophilaNPFR signals through Gi to inhibit adenylate cyclase [64]. As the tubules contain cyclic-nucleotide gated calcium channels [71], [72], measurement of intracellular calcium provides a useful surrogate assay for NPF function. Consistent with the microarray results, NPF transiently elevates [Ca2+] (
) in a dose-dependent manner (
) in male, but not female tubules, with an EC50 of 6 nM (
), confirming that the tubules receive a bona fide NPF signal through NPFR1. Consistent with a likely action through G, resting fluid secretion was decreased, but only in males (
).
Figure 6
Male-specific signalling by Neuropeptide F and short neuropeptide F.
(A) Typical traces showing differential real-time cytosolic calcium responses of male and female tubules. NPF was added to 10–8 M final concentration at 100 s. (B) Dose-response curve for NFP-induced calcium signalling in male tubules. (C) Typical trace showing response of tubules to NPF, added to 10–8 M final concentration at 30 min. Data are shown as mean±SEM (N = 10 tubules). (D) NPF inhibits fluid secretion in male, but not female, tubules. Average fluid secretion rates are compared before and after addition of 10−8 M NPF. *** denotes significant reduction, Student’s t-test, two tailed, P<0.05. (E) Typical trace showing response of tubules to sNPF, added to 10−7 M final concentration at 30 min. Data are shown as mean±SEM (N = 10 tubules). (F) sNPF inhibits fluid secretion in male, but not female, tubules. Average fluid secretion rates are compared before and after addition of 10−7 M sNPF. *** denotes significant reduction, Student’s t-test, two tailed, P<0.05).
Male-specific signalling by Neuropeptide F and short neuropeptide F.
(A) Typical traces showing differential real-time cytosolic calcium responses of male and female tubules. NPF was added to 10–8 M final concentration at 100 s. (B) Dose-response curve for NFP-induced calcium signalling in male tubules. (C) Typical trace showing response of tubules to NPF, added to 10–8 M final concentration at 30 min. Data are shown as mean±SEM (N = 10 tubules). (D) NPF inhibits fluid secretion in male, but not female, tubules. Average fluid secretion rates are compared before and after addition of 10−8 M NPF. *** denotes significant reduction, Student’s t-test, two tailed, P<0.05. (E) Typical trace showing response of tubules to sNPF, added to 10−7 M final concentration at 30 min. Data are shown as mean±SEM (N = 10 tubules). (F) sNPF inhibits fluid secretion in male, but not female, tubules. Average fluid secretion rates are compared before and after addition of 10−7 M sNPF. *** denotes significant reduction, Student’s t-test, two tailed, P<0.05).A distantly related peptide, the so called short neuropeptide F (sNPF) has similar, but independent actions on feeding [66], [67], [68], and the cognate receptor (CG7395/sNPF-R) is also selectively enriched (1.4x) in male tubules; so the impact of sNPF on tubule function was also assessed. Again, sNPF inhibits resting fluid secretion, but only of male tubules (
). These results thus both identify two new agonists acting on the tubule, and emphasise male-specific somatic roles for these two well-studied peptides.An interesting possibility is that NPF may act locally to signal particular stress conditions: disruption of the NPF/NPFR1 circuit renders flies resistant to ethanol intoxication [73]; and the tubule is known to be a major site of expression of detoxification genes [31], such as alcohol dehydrogenase [12]. The tubule also integrates response to diverse stressors, such as salt stress [24] and immune challenge [25], [29], and so NPF may be modulating such responses. Again, NPF-reactive cells, which co-express the diuretic neuropeptide leucokinin, are found in the anterior midgut [62] as well as the CNS, suggesting that the tubule could receive direct warning of dietary stressors as they arrive in the midgut [74], together with a known diuretic signal. Drosophilatachykinin (DTK) peptide, short neuropeptide F (sNPF) and ion transport peptide (ITP) precursors have recently been shown to be colocalized in five pairs of large protocerebral neurosecretory cells in two clusters (designated ipc-1 and ipc-2a) in the adult flies [75]. The same report proposed that IPTs may act as antidiuretic hormones that regulate transport in hindgut. In addition to neuronal functions, sNPF has been implicated in regulation of insulin signaling, feeding and growth [67]. Thus our results support a complex network of central and peripheral signalling of NPF and sNPF in the modulation of clock-controlled functions, insulin signaling, feeding and growth. Immunity and detoxification.The Malpighian tubule is a major immune [29], [76] and detoxification tissue, and express a cluster of immune/defence genes, which FlyAtlas suggests are expressed in broadly similar patterns - typically in the major immune tissues (head, midgut, tubule, fat body and spermathecae). However, these results indicate that there is gender-specific expression of several immune genes in tubule, suggesting males and females meet differing immune challenges. Female-enriched genes include the antimicrobial peptides attacin (25.1x), Metchnikowin (12x) and immune induced molecule 2 (7.4x); the peptidoglycan receptor protein SB1 (9.3x), an N-acetylmuramoyl L-alanine amidase with bactericidal properties against Bacillus spp. [77]; and the detoxification enzyme, cytochrome P450 cyp4e3 (6.5x). By contrast, males preferentially express drosomycin (7.8x), and a series of cytochrome P450s, including the cardinal insecticide resistance locus, cyp6g1 (2.5x) [31].This enrichment for immune genes suggests that although females and males make similar overall investments in innate immune response, females experience distinct immune challenges from males, which are argued to emphasise defence against Gram-negative bacteria more than females [78].
Discussion
The key outputs of this work are: detailed transcriptomic datasets that outline the scope and extent of differences between male and female, and left and right insect Malpighian tubules; interesting novel hypothesis on the spatial and gender compartmentalization of different processes; and preliminary experimental data that suggest that some of these transcriptomic differences really do have physiological significance.For the first time, a transporting epithelium has been profiled for expression according to both its gender and its disposition within the body. The results show that all tubules are not equivalent; although they perform the same key functions (the generation of urine, detoxification and excretion of waste material) they also perform some tasks (like innate immune defence) with different emphases; and some tasks, (like calcium homeostasis) are remarkably dimorphic in their transcriptional repertoire. The neuroendocrine control of tubules, though substantially the same for all, also shows subtle distinctions. Importantly, it appears that the same transcription factors which determine positional identity and gender in the early embryo persist into adulthood, implying that identity of the tubules remains important, and that these transcription factors must be considered to be important for more than early development.In this work, we found that morphological asymmetry has direct relevance to functional optimization of complex tissues in the whole organism, specifically putting transport processes near the organs that generate their substrates, and with both local and central control of output. A summary diagram is shown in
. In this model, the basic fluid transport and homeostatic functions of the tubule are common to left and right tubules; but functional sequelae result from the proximity of the right-side tubules with the highly permeable midgut, and the left-side tubules with the excretory and concentrative power of the hindgut. Both dietary toxins and overabundant solutes (like calcium) must be sequestered rapidly by the tubules before they impact on the whole insect. Local signalling by neuroendocrine cells embedded along the length of the midgut [62] could complement central signals, by relaying information about the gut contents directly to the tubules. The compartmentalization of ammonia handling to the hindgut and closely-coupled left-side tubules would equally protect the insect against toxic levels of an essential metabolite.
Figure 7
Model for universal and spatially asymmetric functions of the renal system.
The fundamentals of the renal system, to generate urine and to transport and metabolize metabolites and toxins, are common to both sets of tubules. However, the right-side tubules ramify anteriorly and associate intimately with the highly permeable midgut. They need to play a particular role in transport or sequestration of solutes arriving from the gut. The conspicuous adaptation is for the storage excretion of calcium. The left-hand tubules perform a corresponding task for the hindgut, to which they are loosely attached. Here, the major pressure is to guard against excessive release of ammonia from nitrogenous excretion.
Model for universal and spatially asymmetric functions of the renal system.
The fundamentals of the renal system, to generate urine and to transport and metabolize metabolites and toxins, are common to both sets of tubules. However, the right-side tubules ramify anteriorly and associate intimately with the highly permeable midgut. They need to play a particular role in transport or sequestration of solutes arriving from the gut. The conspicuous adaptation is for the storage excretion of calcium. The left-hand tubules perform a corresponding task for the hindgut, to which they are loosely attached. Here, the major pressure is to guard against excessive release of ammonia from nitrogenous excretion.We and others have previously argued that the high number of anonymous (undocumented) genes with highly tissue-specific expression patterns found in FlyAtlas [38] suggests that researchers need to become more interested in specific tissues within the organism, in order to functionally characterize the whole genome. This principle is demonstrated further here; although we have previously-identified novel tubule-specific genes [12], the present dataset shows that the principle further extends to sidedness and to gender, offering fascinating insights as to likely novel functions. The power of Drosophila genetics will allow a detailed examination of the interactions between tissues in their natural physical layout within the whole organism, and so allow an understanding of gene functions in an organotypic, organismal context. In an insect, this level of understanding is of great benefit to developing insights that might lead to novel control methods; but it further suggests that there may be asymmetry to be uncovered in other epithelia in the future.
Methods
Drosophila
Drosophila melanogaster (Canton S, wild type) were reared on standard diet at 25°C and 55% relative humidity on a 12∶12 h photoperiod. Malpighian tubules were dissected from 7–10 day old adults, for compatibility with the extensive physiological literature on the tubule [48], [79], [80], [81], [82], [83], [84], [85]. At this stage, the tubules are in a relatively stable state after adult emergence, and their secretion parameters do not change detectably between 3 and 14 days post-emergence.
Microarrays
Tubules were quickly dissected in cold Schneider’s medium (Invitrogen, UK) and collected into RNA stabilization buffer RLT (Qiagen, UK) every 5 min to ensure the integrity of the mRNA. Care was taken to sever the tubules from the gut at the junction of lower ureter and hindgut (
) so that no other tissue was included in the sample. Total RNA was extracted from wild type Canton S flies using RNeasy columns (Qiagen, UK). RNA was quantified with NanoDrop-1000 (NanoDrop Technologies, USA), and quality assessed using Bioanalyzer (Agilent Technologies UK Ltd.). For each sample, 4 biological replicates, each consisting of 40 tubules, were generated. Samples of 100ng of total RNA were reverse-transcribed, then in vitro transcribed, according to Affymetrix standard 2-cycle small sample protocol. The quality of the complementary RNA (cRNA) was also checked on the Bioanalyzer, with a sample in which the broad cRNA peak exceeded the height of the low molecular weight degradation peak taken to be satisfactory. Samples were then run on the Affymetrix Drosophila genome chip v.2, comprising 18880 probe sets analysing over 18500 transcripts, under the Manufacturer’s standard conditions.
Microarray Data Analysis
Microarray data analysis and quality control were performed initially using Affymetrix GCOS software, and with the Partek Genome analysis suite. A 2-way ANOVA approach was employed to identify genes that were differentially expressed by gender and by tubule position (left or right). We report genes with significant differential expression, based on a false discovery rate (FDR) threshold of P = 0.05. The microarray data have been deposited at NCBI GEO, with the accession number (GSE7763).Although our previous study had shown a close correlation between Affymetrix microarray and quantitative real-time PCR (qPCR)-derived measures of expression level within a tissue [12], a selection of genes was further validated by qPCR and in situ hybridization ().
qRT-PCR
Samples were prepared as described above and qRT-PCR was performed using Opticon DNA engine 4 (Bio-Rad Technologies UK) using Sybr green master mix (Finnzymes, UK) with the primer pairs described in . The data obtained was then expressed as fold change on the basis of CT values. Student’s t test (unpaired; 95% confidence interval) was performed with GraphPad Prism statistics software (GraphPad Software Inc., USA).
In situ Hybridization
DIG-labelled mRNA probes were transcribed from PCR products, generated using the same primers () used for qRT-PCR. Adult Malpighian tubules were dissected in Schneider’s medium (Invitrogen, UK) and placed into wells of a Millipore 96-well plate (MAGVN22 or MAGVS22) with 100 µl of Schneider’s medium. The in situ protocol is adopted from the Berkeley Drosophila Genome Project (BDGP) (http://www.fruitfly.org/about/methods/RNAinsitu.html).
Measurement of Glutamine : Glutamate Ratios
Acutely dissected heads, thoraces and abdomens from ten 7-day old adults (mixed sexes) were homogenised in ice cold methanol/chloroform/water (3∶1∶1), followed by sonication for 15 s. The supernatant was then centrifuged for 5 minutes at 13000 g at 0°C, and the filtered supernatants were then stored in a freezer at −80°C until required. The samples were then analysed using ZICHILIC chromatography interfaced to an LTQ Orbitrap mass-spectrometry as described previously [20], [86]. Four independent samples were analysed for each tissue. Data were plotted as means and interquartile ranges, and difference between groups tested with the Kruskal Wallis nonparametric test.
Generation of Peroxisomal Calcium Reporter Transgenic Flies
Drosophila transgenic for a luminescent peroxisomal-targeted calcium reporter were generated by cloning a peroxisomal-targeted Aequorea victoria apoaequorin construct into the pUAST vector. This construct uses the KVK-SKL amino acid motifs, previously shown to target YFP to peroxisomes [87]. The sequence coding for the KVK-SKL was introduced before the stop codon of the aequorin template by PCR using the oligonucleotides 5′-GCAGATCTATGACAAGCAAACAATACTCA-3′ and 5′-GCTCTAGATTACAGCTTGGACTTCACCTTGGGGACAGCTCCACC-3′. The resulting PCR product was digested with BglII and XbaI and ligated into the pUAST vector. Transgenic lines were generated using standard methods for P-element-mediated germline transformation (BestGene Inc, USA).
Calcium Measurement
Cytosolic [Ca2+]cyto or peroxisomal [Ca2+]perox calcium was measured in tubules expressing transgenic aequorin according to published protocols [88], [89]. Briefly, the tubules were dissected, incubated at room temperature with 2.5 µM coelenterazine to reconstitute aequorin for 3 h. Calcium-dependent aequorin luminescence was measured in 10 biological replicates each containing 20-pairs of tubules. At the end of each experiment, total aequorin was released using 300 µl of lysis buffer (1% (v/v) Triton X-100, 100 mM CaCl2) in order to calculate the total luminescence; and the data were back-integrated using a program written in Perl, based on the method described by Button and Eidsath [90]. Data are presented as the mean (±SEM) and statistical significance was calculated using unpaired t-test.
Tubule Fluid Secretion Assay
Classical fluid secretion assays were performed as previously described by Dow et al. [91]. Briefly, basal fluid secretion rates of the dissected live tubules were established for 30 min after which the required concentrations of peptides were added and secretion was measured for a further 70 min. The rates of secretion (in nl/min) were represented as the mean (±SEM) of approximately 30–35 tubules coming from 3 independent biological replicates.
Pharmacology
sNPF (AQRSPSLRLRF-NH2) and MIP (AWQSLQSSW-NH2) peptides were synthesised by Biomatik, USA with a purity of greater than 98%. NPF (SNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF-NH2) peptide was a kind gift from Professor Ian Orchard (University of Toronto Mississauga). According to the peptide profiles generated by peptide profile calculator (Gene Script, UK), they were dissolved first in water to produce a stock solution of 10 mM and subsequently diluted in the Schneider’s medium to get required final concentrations.The combined supplementary information file comprises Figures S1 to S4 and Tables S1 to S4.(DOCX)Click here for additional data file.
Authors: Tony D Southall; Selim Terhzaz; Pablo Cabrero; Venkateswara R Chintapalli; Jennifer M Evans; Julian A T Dow; Shireen-Anne Davies Journal: Physiol Genomics Date: 2006-04-11 Impact factor: 3.107
Authors: Javier Márquez; Amada R López de la Oliva; José M Matés; Juan A Segura; Francisco J Alonso Journal: Neurochem Int Date: 2006-03-03 Impact factor: 3.921
Authors: Venkateswara R Chintapalli; Mohammed Al Bratty; Dominika Korzekwa; David G Watson; Julian A T Dow Journal: PLoS One Date: 2013-10-29 Impact factor: 3.240
Authors: Pablo Cabrero; Laura Richmond; Michael Nitabach; Shireen A Davies; Julian A T Dow Journal: Proc Biol Sci Date: 2013-02-27 Impact factor: 5.349