Literature DB >> 22347893

The spin label amino acid TOAC and its uses in studies of peptides: chemical, physicochemical, spectroscopic, and conformational aspects.

Shirley Schreier, José Carlos Bozelli, Nélida Marín, Renata F F Vieira, Clóvis R Nakaie.   

Abstract

We review work on the paramagnetic amino acid 2,2,6,6-tetramethyl-N-oxyl-4-amino-4-carboxylic acid, TOAC, and its applications in studies of peptides and peptide synthesis. TOAC was the first spin label probe incorporated in peptides by means of a peptide bond. In view of the rigid character of this cyclic molecule and its attachment to the peptide backbone via a peptide bond, TOAC incorporation has been very useful to analyze backbone dynamics and peptide secondary structure. Many of these studies were performed making use of EPR spectroscopy, but other physical techniques, such as X-ray crystallography, CD, fluorescence, NMR, and FT-IR, have been employed. The use of double-labeled synthetic peptides has allowed the investigation of their secondary structure. A large number of studies have focused on the interaction of peptides, both synthetic and biologically active, with membranes. In the latter case, work has been reported on ligands and fragments of GPCR, host defense peptides, phospholamban, and β-amyloid. EPR studies of macroscopically aligned samples have provided information on the orientation of peptides in membranes. More recent studies have focused on peptide-protein and peptide-nucleic acid interactions. Moreover, TOAC has been shown to be a valuable probe for paramagnetic relaxation enhancement NMR studies of the interaction of labeled peptides with proteins. The growth of the number of TOAC-related publications suggests that this unnatural amino acid will find increasing applications in the future.

Entities:  

Year:  2012        PMID: 22347893      PMCID: PMC3271205          DOI: 10.1007/s12551-011-0064-5

Source DB:  PubMed          Journal:  Biophys Rev        ISSN: 1867-2450


Historical data

In 2011, when we celebrate 30 years since the first publication on the synthesis of TOAC-labeled peptides, we present a brief account of the history of nitroxides and their use as spin labels for studies of the structure and dynamics of biologically relevant molecules and organized systems. The synthesis of nitroxides was first described by Lebedev (Lebedev and Kazarnovskii 1959) and by Hoffmann and Henderson (1961). Nitroxides are extremely interesting from the chemical point of view, since, in contrast with the vast majority of free radicals, that are highly unstable, the –NO group is stable under a variety of physicochemical conditions. This allows the obtaining of their EPR spectra in different solvents, including water, in a range of pH and temperature. Scientists from the Soviet Union made a great contribution to the development of the chemistry of nitroxides, as well as the knowledge of their physicochemical and spectroscopic properties (see the book by Rozantsev 1970). This contribution has continued until the present days. In France, the group of A. Rassat also reported a great number of studies on the chemistry, physical chemistry, and spectroscopy of nitroxides. The groups of J.F.W. Keana in the USA and of K. Hideg in Hungary have described the synthesis of a vast number of nitroxide-containing compounds. Computer programs for spectral simulations of spin label spectra have been extensively developed by the group of J.H. Freed in the USA. In view of the fact that EPR spectroscopy is performed in the microwave range of the electromagnetic spectrum, EPR spectra are very convenient for obtaining information about the motion of molecules, in particular macromolecules. Moreover, EPR spectra are also sensitive to the orientation of molecules with respect to the magnetic field, which renders them very useful for studies of anisotropic systems such as membranes. The use of nitroxides to obtain conformational information about biological molecules via their EPR spectra was first described by McConnell and coworkers in 1965 in a paper that reported studies of polylysine and bovine serum albumin (Stone et al. 1965). This paper followed the first attempt to introduce a paramagnetic reporter group in an otherwise EPR-silent macromolecule; in this first study, Ohnishi and McConnell (1965) intercalated the chlorpromazine cation radical in a nucleic acid. However, this species was not very stable, pointing to the need for a more convenient reporter group. This role was most adequately performed by the nitroxide group. During the next 15 years, EPR studies of spin-labeled proteins were extensively published. In almost all the studies, proteins were labeled by coupling nitroxide-containing molecules to reactive groups of amino acid side chains, mostly the –SH group of cysteine. The potentiality of cysteine labeling underwent enormous expansion upon the introduction of SDSL by Hubbell and coworkers (Todd et al. 1989; Altenbach et al. 1989), which brought about the possibility of choosing the residue to be investigated. Nitroxide spin labels were also used, albeit to a lesser extent, for studies of other macromolecules—nucleic acids and polysaccharides. On the other hand, the EPR spectra of nitroxides have been largely exploited in studies of membranes. The first paper in this field was published by Hubbell and McConnell (1968). Indeed, the EPR spectra of nitroxides were among the first data that provided evidence for molecular motions of lipids in membranes—rotation about the long molecular axis (Hubbell and McConnell 1969; Hsia et al. 1970), intramolecular trans-gauche isomerization (Seelig 1970; Hubbell and McConnell 1971; Schreier-Muccillo et al. 1973), flip-flop (Kornberg and McConnell 1971), and lateral diffusion (Devaux and McConnell 1972; Sackmann and Träuble 1972a, b; Träuble and Sackmann 1972). In 1981, Nakaie et al. (1981) introduced a new strategy for conformational studies of peptides by means of EPR spectroscopy; in this report, the authors described the use of TOAC (2,2,6,6-tetramethyl-N-oxyl-4-amino-4-carboxylic acid), whose synthesis was reported by Rassat and Rey (1967), for the synthesis of peptides where the unnatural spin-labeled amino acid was incorporated for the first time in the chain via a peptide bond. An article focusing on TOAC and its applications appeared in Chemical and Engineering News (Wilson 2000), and a review of work on TOAC-containing peptides was published (McNulty and Millhauser 2002).

Introduction

When spin labels are bound to an amino acid side chain, their EPR spectra will reflect, in addition to the properties of the backbone, the contribution of side chain flexibility, as well as that of the label molecule itself with respect to the polypeptide backbone. In this context, an interesting alternative to examine the conformational properties of proteins and peptides is the binding of a spin label directly to the backbone. The coupling of TOAC to the peptide chain via a peptide bond was first accomplished by incorporating this α-amino acid into model compounds, the peptide hormone angiotensin II, and some of its analogs (Nakaie et al. 1981, 1983). The SPPS methodology available at the time (Merrifield 1963; Stewart and Young, 1984) relied on the use of the Boc protecting group for the amino group; this approach requires strong acid conditions in the deprotection step, preventing the incorporation of TOAC in internal positions, since the acid treatment causes loss of the paramagnetic group. When the Fmoc-based methodology became available (Atherton and Sheppard 1989; Fields and Noble 1990), Marchetto et al. (1993) published the first report describing the synthesis of angiotensin II analogues labeled with TOAC at internal positions in the peptide chain. It should be mentioned that an attempt to introduce TOAC in a protein by means of genetic engineering was not successful (Cornish et al. 1994), possibly due to steric effects (see below). The use of TOAC has gained notable expansion, mostly in the study of conformational and dynamical properties of peptides. The group of Glenn L. Millhauser has published a series of papers making use of TOAC’s EPR spectra to investigate peptide secondary structure (see “Synthetic peptides”). A major contribution in the field has come from the group of Claudio Toniolo, at the University of Padova. Figure 1 displays the growth of the use of TOAC in the past 15 years. Studies of peptides and other applications, such as the use of TOAC’s EPR spectra to monitor the effect of physicochemical conditions on SPPS, will be the object of this review. We intend to cover most of the literature; due to length limitations, the information contained in these papers is presented in a succinct manner.
Fig. 1

Structure of TOAC and time evolution of TOAC-related publications

Structure of TOAC and time evolution of TOAC-related publications

TOAC and TOAC-containing peptides: synthesis and structural, physicochemical, and spectroscopic properties

The synthesis of TOAC was first described by Rassat and Rey (1967). Other nitroxide-derived α-amino acids have been synthesized (Lex et al. 1982; Csekö et al. 1985; Balog et al. 2003). A spirocyclohexyl nitroxide α-amino acid was synthesized and proposed to be useful for distance measurements by means of pulsed EPR (Rajca et al. 2010). α-amino acids have also been synthesized and incorporated in peptides. In an attempt to overcome the low nucleophilicity of TOAC’s amino group towards the acylation reaction during peptide chain elongation, Tominaga et al. (2001) described the higher efficiency of incorporation of the β-amino acid POAC (Rassat and Rey 1967) into angiotensin II. Studies of POAC, as well as of β-TOAC, have addressed synthesis, separation, identification, spectroscopic characterization, and absolute configuration assignment of pure enantiomers (Wright et al. 2003a, b, 2005, 2008; Péter et al. 2003; Dutot et al. 2008). The synthesis and conformational characterization of hexapeptides double-labeled with β-TOAC and POAC have also been reported (Wright et al. 2007, 2010). Figure 2 presents the structures of the nitroxide-containing α- and β-amino acids TOAC, POAC, and β-TOAC, as well as of the Cα,α-disubstituted glycines Aib and Ac6c. The former is a non-proteinogenic amino acid present in peptides that display antimicrobial activity.
Fig. 2

Chemical structures of the spin-labeled amino acids TOAC, β-TOAC, and POAC and of the Cα,α-disubstituted glycines Aib and Ac6c

Chemical structures of the spin-labeled amino acids TOAC, β-TOAC, and POAC and of the Cα,α-disubstituted glycines Aib and Ac6c TOAC is a member of the family of Cα,α-disubstituted glycines (Toniolo et al. 1995) characterized by a six-member, heterocyclic, saturated side chain containing the paramagnetic nitroxide radical which is stabilized by the tetrasubstituted carbon atoms 2 and 6. A quantum mechanical study of TOAC in vacuo and in aqueous solution showed that the nitroxyl group in an equatorial position is more stable than in the axial position (D'Amore et al. 2003). In addition, the crystallographic characterization of some TOAC derivatives showed the piperidine ring in an approximate chair conformation, with the α-amino group in the axial position and the α-carboxyl group in the equatorial position (Flippen-Anderson et al. 1996; Crisma et al. 2005). The nitroxyl group presents two absorption bands in the UV-visible region, ascribed to the n → π* (ʎ = 420–450 nm, ɛ = 5–20 L mol−1 cm−1) and to the π → π* transitions (ʎ ~ 240 nm, ɛ = 103–104 L mol−1 cm−1); the former band is sensitive to solvent polarity (Dupeyre et al. 1964; Brière et al. 1965). EPR and cyclic voltammetry studies showed that the NO group can undergo reversible redox processes (Toniolo et al. 1995), as well as reversible protonation (Nakaie et al. 1981, 2002; Pertinhez et al. 1997). TOAC-containing peptides were exploited as potential catalysts for enantioselective oxidation (Formaggio et al. 2002). Based on TOAC’s redox properties, Gatto et al. (2008) examined the efficiency of peptide-based self-assembled monolayers to mediate electron transfer and photoinduced electron transfer processes on gold substrates. TOAC-containing model compounds and peptides present high crystallinity allowing for X-ray diffraction studies. Crystallographic studies of synthetic peptides showed that TOAC preferentially adopts helical backbone torsion angles (Toniolo et al. 1995; Flippen-Anderson et al. 1996; Crisma et al. 1997, 2005, 2007; Saviano et al. 2004). These results are in accordance with EPR solution studies (see below) and show that TOAC also induces 310/α-helical backbone conformation in the crystal state. These findings are in agreement with the view that members of the family of Cα,α-disubstituted glycines, such as Aib, Ac6c, and TOAC, favor β-bends and 310/α-helices (Toniolo et al. 1995). X-ray diffraction studies of alanine-based peptides indicated a preference of the piperidine ring for the twist-boat conformation (Flippen-Anderson et al. 1996; Crisma et al. 2005). Crystal studies of TOAC-containing biologically active peptides will be referred to in the corresponding sections. Making use of the fact that, being paramagnetic, TOAC is a fluorescence quencher, photophysical studies have been performed with peptides containing TOAC and an intrinsic or incorporated fluorophore bound to the same or a different peptide, or to a phospholipid. TOAC was shown to quench the fluorescence of tryptophan, tyrosine, phenylalanine, Bin, Bpa, Fmoc, β-(1-azulenyl)-L-alanine, BODIPY, and NBD, the two latter attached to phospholipids. References concerning these studies are given in the following sections. As for EPR spectral properties, like other known nitroxide-containing molecules, TOAC’s spectra are sensitive to the polarity of the environment, the isotropic hyperfine splitting a decreasing with decreasing polarity. Based on the polarity dependence of a , Malavolta et al. (2008) demonstrated a correlation between a and a polarity parameter consisting of the sum of solvent electron acceptor (AN) and electron donor (DN) properties (AN+DN). An alternative polarity scale based on this parameter was proposed as a result of solvation studies of polymers (Cilli et al. 1996; Malavolta et al. 2002). Taking advantage of the sensitivity of a and g values to the polarity of the environment, Marsh and Toniolo (2008) derived a calibration method to determine the location of TOAC at selected positions in membrane-active peptides. The authors determined the polarity dependence of a and g for a TOAC-containing dipeptide and for a DOXYL-containing fatty acid in a range of protic and aprotic media. Correlating these datasets, a polarity profile was established for TOAC in a transmembrane peptide. A similar calibration was deduced for MTSSL, used in protein SDSL. In contrast to the well-known polarity effects on EPR spectra of nitroxides, a demonstration of the pH-dependence of EPR spectra of nitroxides containing ionizable groups was first presented by Nakaie et al. (1981). Changes in a in the spectra of TOAC and model TOAC-containing dipeptides yielded titration curves, allowing the accurate determination of the pK of the ionizable amino and carboxyl groups. It was shown that this resulted from the slow exchange in the EPR timescale between the charged and uncharged species, each yielding a spectrum that contributed to the observed spectrum according to the Henderson–Hasselbalch equation. While the pK of free TOAC’s amino group was 8.0, in TOAC-Gly this value decreased to 5.8. Similar effects were found for N-terminally TOAC-labeled peptides; in addition, pH-modulated conformational changes were also found in these studies (see below).

Synthetic peptides

The advantage of TOAC over side chain-attached spin labels resides in the fact that the former is linked via a peptide bond; moreover, due to its cyclic structure, the molecule’s restricted mobility hampers rotation about side chain bonds. In contrast, side chain-attached spin labels lead to higher conformational freedom, rendering the analysis of backbone conformation more difficult. One approach that has been used, especially in the study of synthetic peptides, consists in examining double-labeled peptides. Measurements of spinspin interactions in the EPR spectra allow the calculation of distances between two TOAC residues in the same peptide chain, and, therefore, the determination of peptide secondary structure (Smythe et al. 1995; Hanson et al. 1996a, b, 1998). For biradicals tumbling fast in the time scale of the experiment, the spectral line shapes are determined primarily by exchange interactions, which are described by the exchange integral J (Luckhurst 1976). In the case of strong exchange, J » a (a is the isotropic hyperfine coupling constant), and the spectrum is characterized by a five-line pattern with intensities 1:2:3:2:1. In flexible molecules, distance fluctuations between the radicals result in a modulation of J that can preferentially broaden the second and fourth lines. Biradicals can also exhibit electron—electron dipolar couplings. For fast tumbling peptides, this interaction averages to zero and does not contribute to the EPR spectrum. On the other hand, for molecules tumbling slowly in the EPR time scale (e.g., at low temperature), measurement of dipolar interactions can also yield distances between two labeled residues (Hanson et al. 1996a). Smythe et al. (1995) examined a 16-residue alanine-based TOAC-double-labeled peptide. The results differed from those previously obtained for a side chain-attached label (Miick et al. 1992), showing that in aqueous solution the peptide acquires α-helical and not 310-helical conformation. TOAC double-labeling studies of the influence of solvent, chain length, presence of N-terminal blocking groups, and insertion of the strong helix-favoring amino acid Aib showed that these factors affect the backbone geometry of alanine-rich peptides, and also that TOAC is a strong helix stabilizer (Toniolo et al. 1995; Hanson et al. 1996a, b, 1998). Figure 3 presents the EPR spectra of double-labeled hexameric peptides with TOAC in different relative positions as a function of solvent (Hanson et al. 1996a). In MeOH, strong biradical interactions were observed consistent with the geometry of a 310-helix. The solvents displayed differing tendencies to support helical structures with the ranking MeOH > EtOH > TFE > HFIP. Spin-spin interaction was also measured in mono- and tri-labeled peptides. Polese et al. (1999) monitored inter-helix interaction in mono-labeled 310-helical peptides covalently tethered to a cyclo-dipeptide template, and Sartori et al. (2005) showed that the conformational regularity of a linear tri-labeled octapeptide (310-helix) is disrupted by an increase in solvent polarity. McNulty et al. (2000) used this methodology to study fold ⇌ unfold intermediates.
Fig. 3

EPR spectra (100 G scanwidth) of hexameric peptides (Boc-TOAC-Ala-TOAC-Ala-OtBu; n = 0–3) as a function of solvent at 298 K. Reprinted from Hanson et al. (1996a), with permission of the American Chemical Society

EPR spectra (100 G scanwidth) of hexameric peptides (Boc-TOAC-Ala-TOAC-Ala-OtBu; n = 0–3) as a function of solvent at 298 K. Reprinted from Hanson et al. (1996a), with permission of the American Chemical Society Elsäber et al. (2005) performed X-band (at 80 K) and W-band (at 80 and 5 K) studies to evaluate the relative orientation of two TOAC residues incorporated at different distances in the primary structure of de novo synthesized 15-mer peptides designed to form an α-helix. By means of simulations of spectra obtained in different solvents, the authors calculated the distance and relative orientation of the two nitroxides, thus obtaining structural information. The conformations found were solvent-dependent and did not correlate with any of the typical helix types adopted by peptides. Carlotto et al. (2007) and Zerbetto et al. (2007) developed computational approaches to simulate EPR spectra determined by the conformational properties of TOAC-containing peptides. The combination of different biophysical techniques can provide more complete information on peptide conformational properties. In this context, EPR, CD, fluorescence, FT-IR, NMR, and X-ray crystallography have been used in studies of TOAC-containing peptides. An example is a study of a series of peptides containing the tricyclic Cα,α-disubstituted glycine Afc and either TOAC or Gly (Crisma et al. 2000). The results confirmed previous findings showing that Afc may adopt either a fully extended or a turn conformation. In another study, Venanzi et al. (2004) used FTIR, NMR, steady-state and time-resolved fluorescence, and molecular mechanics to investigate constrained hexapeptides containing a fluorescent analogue of tryptophan as well as TOAC. Although TOAC is an achiral molecule, Bui et al. (2000) explained the unusual far-UV CD spectrum of a TOAC double-labeled hexapeptide that did not correspond to the known elements of secondary structure in terms of a dominating contribution by the peptide-induced CD of the TOAC π → π* transition. A band was also found in the visible region and was ascribed to TOAC’s n → π* transition. The intensity of this transition could be correlated to peptide conformation. However, in studies with other peptides, TOAC did not seem to disturb the CD spectra of these molecules in the far-UV region (e.g., Schreier et al. 2004; Esposito et al. 2006; Venanzi et al. 2006). Moreover, the NO group does not present any vibrational bands in the amide A, amide I, and amide II regions (Toniolo et al. 1995). Photophysical studies were also performed, in particular making use of TOAC’s fluorescence quenching ability. In cases where the center-to-center TOAC–fluorophore distance was more than 9 Å, the quenching mechanism was described as a Förster energy transfer (dipoledipole interaction) from the excited fluorophore to TOAC, provided the mutual orientation of the fluorophore and TOAC was taken into account (Pispisa et al. 1998; Toniolo et al. 1998, 1999; Pispisa et al. 2000a, b, 2002, 2003a, b). Time-resolved EPR with pulsed laser excitation experiments showed that the intramolecular quenching by TOAC of a fluorophore in the triplet excited state occurs by enhanced intersystem crossing to the ground state via an electron-exchange process (Corvaja et al. 2000a, b).

Use of TOAC EPR spectra to assess peptide orientation in membranes

The study of location and orientation of membrane-active peptides upon interaction with membranes is important for the understanding of their mechanism of action at a molecular level. EPR studies of spin-labeled peptides can provide useful information concerning this topic. Due to the fact that TOAC is rigidly attached to the peptide backbone, if the nitroxide orientation is determined in a given system, e.g. in membranes, from the knowledge of TOAC’s relative orientation with respect to the axis of the secondary structure, it is possible to obtain information about the orientation of the backbone with respect to the bilayer normal. Marsh (2006) described a procedure to obtain orientational information about TOAC-containing peptides that acquire α-helical and β-strand conformations in membranes from calculated order parameters. Crystal structure studies of peptides indicated a preference of the TOAC ring for the twist-boat conformation (see “TOAC and TOAC-containing peptides: synthesis and structural, physicochemical, and spectroscopic properties”, above). Taking advantage of this information, Marsh derived the tilt of the nitroxide z-axis for both mirror-image twist-boat conformers relative to the α-helical and β-strand axes by building the various TOAC crystal structures into the refined coordinates of α-poly-L-alanine and β-poly-L-alanine structures. The author found that the nitroxide z-axis was inclined at 13 ± 2 and 65 ± 3º, with respect to the α-helix axis, or at 25 ± 3 and 32 ± 3º with respect to the β-strand axis, showing that it is possible to use the EPR order parameter to obtain the tilt of TOAC with respect to the bilayer normal; then, making use of the known tilt of the nitroxide z-axis relative to the α-helix and β-strand axes obtained from crystal structures, one can determine the orientation of these axes relative to the bilayer normal. This analysis was applied to TOAC-containing analogues of alamethicin in macroscopically-aligned phospholipid bilayers (see “Alamethicin”, below). An approach to determine the tilt of an α-helical TOAC-containing peptide in macroscopically-aligned model membranes based on hyperfine splitting values of the EPR spectra was described by Lorigan and coworkers. In aligned systems, the macroscopic orientation of the bilayer normal with respect to the static magnetic field is known. Then, through the orientation of the nitroxide z-axis with respect to the magnetic field obtained from the hyperfine splittings, it is possible to obtain the orientation of the nitroxide moiety with respect to the bilayer normal. Hence, due to the spatial relationship between the nitroxide group and the helix axis (obtained from the crystal structure), it is possible to determine the orientation of the peptide in the membrane-bound state (Inbaraj et al. 2006). As a model to validate the methodology, Lorigan and collaborators used TOAC-labeled analogues of the nicotinic acetylcholine receptor transmembrane helical domain M2δ (EKMSTAISVLLAQAVCLLLTSQR) incorporated into aligned bicelles (Inbaraj et al. 2006), phospholipid bilayer nanotube arrays (Karp et al. 2006), and phospholipid bilayers interfaced between glass plate substrates (Inbaraj et al. 2007). The results yielded a helical tilt angle ranging between 14º and 16º, compatible with solid-state NMR data, as well as molecular dynamics simulation. Theoretical calculations of hyperfine splitting values derived from EPR spectra of TOAC-labeled α-helical M2δ in aligned membranes have also been reported (Newstadt et al. 2009).

Biologically active peptides: ligands and fragments of G protein-coupled receptors

Angiotensin and bradykinin

The vasoactive peptides angiotensin II (DRVYIHPF, AII) and bradykinin (RPPGFSPFR, BK) bind to G protein-coupled receptors (GPCRs). Studies of these peptides will be presented concomitantly. In the early work by Nakaie et al. (1983), AII analogues containing TOAC at the N-terminus (TOAC0-AII and TOAC1-angiotensinamide) were examined by EPR spectroscopy. Solution spectra showed a pH-dependence of peptide conformation, and the analysis of a yielded a pK of TOAC’s amino group around 4.5. When the methodology to incorporate TOAC in internal positions became available (Marchetto et al. 1993), it was of interest to evaluate the effect of this incorporation on peptide biological activity. This is clearly a concern in the case of biologically active peptides that have a flexible solution conformation, such as small peptide hormones, whose binding to receptors requires the acquisition of very specific conformations. One might expect that incorporation of TOAC—which, in addition to favoring α-helical and 310-helical conformations, also favors β-turn formation (Toniolo et al. 1998)—could affect receptor binding and, therefore, biological activity. Functional studies of AII (TOAC1-AII and TOAC3-AII) and BK (TOAC0-BK and TOAC3-BK) analogues showed that, while N-terminally-labeled peptides retained at least part of their biological activity, internally-labeled analogues were inactive, possibly due to the fact that the TOAC-imposed bend did not allow acquisition of the receptor-bound conformation (Nakaie et al. 2002; Santos et al. 2008). In order to obtain more detailed information and compare the conformational properties of TOAC-containing analogues to those of native peptides, in addition to EPR, CD and fluorescence studies were performed in solution (as a function of pH and of addition of the secondary structure-inducing solvent TFE) and in the presence of model membranes (micelles and phospholipid bilayer vesicles of variable composition). Studies with model membranes were performed in view of the Membrane Compartment Theory (Schwyzer 1995), which proposes that, once bound, the peptide concentration increases in the membrane phase and it diffuses bidimensionally, increasing the probability of interacting with the receptor. Furthermore, binding to the membrane might displace the peptide conformational equilibrium, favoring acquisition of the receptor-bound conformation. Schreier et al. (2004) showed that the EPR spectra of TOAC1-AII and TOAC0-BK were sensitive to the pH-titration of TOAC’s amino group (a values and rotational correlation times, τC). Moreover, the rotational correlation times of peptides labeled at position 3 were considerably larger than those of N-terminally-labeled peptides, evincing the greater freedom of motion at the N-terminus. CD spectra of N-terminally labeled analogues indicated a flexible backbone and, in most cases, were similar to those of native peptides; in contrast, spectra of peptides containing TOAC at position 3 suggested a more restricted conformation. Furthermore, TOAC caused quenching of Tyr4 fluorescence, which was more intense in the case of TOAC3-AII due to the closer proximity of the nitroxide. TFE caused a considerable increase in τC values. It was concluded that EPR spectra monitored both the increased solvent viscosity and the peptide’s acquisition of secondary structure. CD spectra showed that the native peptides and the N-terminally-labeled analogues acquired similar conformations. On the other hand, different folds were achieved by TOAC3-AII and TOAC3-BK. In the latter case, comparison with the Aib3-BK analogue (Cann et al. 1987) showed that the spectra of both peptides are very similar, demonstrating that both residues indeed impose a similar bend (different from that promoted by the Pro residue in the native peptide), even in non-helical peptides. It was proposed that the conformational behavior provides an explanation for the lack of biological activity of TOAC3-AII and TOAC3-BK. Combined EPR and CD studies were also performed on the interaction of BK (Vieira et al. 2002) and AII (Vieira et al. 2009) and their TOAC-labeled analogues with detergent micelles—negatively charged SDS and zwitterionic HPS. Line broadening in the EPR spectra indicated micelle binding (Fig. 4). The peptides bound to a much greater extent to negatively charged SDS, pointing to the importance of electrostatic interactions. Nevertheless, binding to HPS could still be detected, suggesting that other interactions (hydrophobic, hydrogen bonding, van der Waals interactions) contributed to the energetics of binding. The small decrease of a values suggested a membrane–water interface location for the peptides. Upon binding, the peptides acquired secondary structure, evincing that the less polar membrane environment favors intramolecular hydrogen bonding. The acquired conformations followed a pattern similar to that previously found, i.e., the N-terminally-labeled peptides acquired conformations similar to those of the native peptides, whereas those labeled at position 3 acquired different folds. Both EPR and CD spectra indicated that, upon binding, the peptides underwent pH-dependent conformational changes. Binding caused an increase of fluorescence of AII and its analogues. The differences in conformation achieved by the native and N-terminally-labeled peptides versus those labeled at position 3 corroborated the proposal that the lack of biological activity of the latter is related to the TOAC-imposed bend in these peptides.
Fig. 4

EPR spectra of 0.1 mM TOAC1-AII (a, c) and TOAC3-AII (b, d) in the presence of 50 mM HPS (a, b) and SDS (c, d) in 15 mM phosphate-borate-citrate buffer at pH 4.0 (top), 7.0 (middle), 10.0 (bottom). The arrows in the spectrum of TOAC3-AII in the presence of HPS at pH 10.0 indicate an immobilized component due to HPS-bound TOAC3-AII. Reprinted from Vieira et al. (2009) with permission of John Wiley & Sons

EPR spectra of 0.1 mM TOAC1-AII (a, c) and TOAC3-AII (b, d) in the presence of 50 mM HPS (a, b) and SDS (c, d) in 15 mM phosphate-borate-citrate buffer at pH 4.0 (top), 7.0 (middle), 10.0 (bottom). The arrows in the spectrum of TOAC3-AII in the presence of HPS at pH 10.0 indicate an immobilized component due to HPS-bound TOAC3-AII. Reprinted from Vieira et al. (2009) with permission of John Wiley & Sons In more recent work, Marín (2007) and Marín et al. (2011) examined the interaction of the same peptides with micelles of LPC or 1:1 mol:mol LPC:LPG, as well as with vesicles of POPC or 1:1 mol:mol POPC:POPG. In addition to CD and EPR, fluorescence measurements of Tyr4 in AII and of Phe5 and Phe8 in BK were performed. Again, the peptides bound to a much lesser extent to zwitterionic than to negatively charged membranes, binding being more pronounced at lower pH (when the peptides carry higher positive charge), corroborating the role of electrostatic interactions for binding. Quantitation of free and membrane-bound peptide populations in the EPR spectra allowed calculation of partition coefficients. Differential quenching by TOAC1-AII of the fluorescence of phospholipids carrying NBD at different positions corroborated the notion that the peptide is located at the membrane–water interface. Teixeira et al. (2007) examined the effect of TOAC incorporation on the cleavage of analogues of the AII precursor, angiotensin I (DRVYIHPFHL, AI) by the angiotensin-converting enzyme (ACE). Biological assays showed that the enzyme was selective with respect to labeling position, cleaving only TOAC1-AI and TOAC3-AI. The lack of activity towards TOAC8-AI and TOAC9-AI indicated that sterical hindrance at the C-terminus probably does not allow substrate binding to the active site. Differences in EPR spectral lineshapes of TOAC3-labeled peptides were sufficient to allow the distinction between the substrate and the product. Quenching of Tyr4 fluorescence by TOAC decreased with increasing distance between both residues, suggesting an overall partly extended conformation of AI. Lopes and collaborators (2008) described a novel EPR approach to evaluate the binding site of AII to its transmembrane AT1 receptor. The authors used a biologically active agonist (TOAC1-AII) and an inactive control (TOAC4-AII) to assess the peptides interaction with fragments of AII’s AT1 receptor in solution. EPR spectra showed that TOAC1-AII, but not TOAC4-AII was able to interact with a proposed binding site composed of portions of the receptor N-terminal domain (residues 13–17) and the third extracellular loop (residues 266–278). A study using the same experimental design was done for the interaction of BK with its B2 receptor (Duarte et al. 2011).

α-melanocyte stimulating hormone, α-MSH

The N-terminally-labeled analogue of α-melanocyte stimulating hormone (Ac-SYSMEHFRWGKPV, α-MSH, Ac = acetyl) was the first TOAC-labeled hormone (Ac-TOAC0-α-MSH) that retained full biological activity (Barbosa et al. 1999). Subsequently, Nakaie et al. (2001) showed that the TOAC-containing derivative of the more potent α-MSH analogue [Nle4,D-Phe7]α-MSH (Ac-TOAC0-[Nle4,D-Phe7]α-MSH), was also fully active. Solution EPR spectra yielded rotational correlation times indicative of a slightly more folded structure for Ac-TOAC0-[Nle4, D-Phe7]α-MSH than for Ac-TOAC0-α-MSH. This was corroborated by TOAC quenching of Trp9 fluorescence and by time-resolved fluorescence data (Nakaie et al. 2001; Fernandez et al. 2005b). Acid-base titration of the peptides was also monitored by EPR and time-resolved fluorescence (Fernandez et al. 2005b). Although the latter technique allowed the pK determination of several side chains, the EPR spectra were only slightly pH-dependent, probably because the TOAC amino group was not titrated since it was blocked by the acetyl radical. EPR and time-resolved fluorescence were also used to investigate the interaction between the TOAC-labeled peptides and DMPG (Fernandez et al. 2005a). EPR spectra showed that both peptides displayed similar, strongly restricted motion, indicating insertion into the membrane, both in the gel and in the liquid crystalline phases. a values showed nitroxide incorporation, albeit not deeply into the bilayer core. Accordingly, time-resolved fluorescence data indicated that the membrane-bound native peptides, as well as their TOAC derivatives, presented similar conformations. Calculation of partition coefficients (P) from free and bound peptide populations in the EPR spectra showed a pH-dependence of P with a pK of ca. 7.5, which was ascribed to the titration of His6.

Neuropeptide Y, NPY

Neuropeptide Y (YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2, porcine NPY), one of the most abundant peptides in mammalian central nervous system, binds to at least five GPCRs - Y1, Y2, Y4, Y5 and Y6. NPY analogues containing TOAC at positions 2, 32, and 34 were synthesized (Bettio et al. 2002). While [TOAC34]-NPY and [Ala31, TOAC32]-NPY showed a marked selectivity for Y5, the specific binding of [TOAC2]-NPY to Y2 and Y5 was in the same range as that of native NPY; however, the peptide was inactive at Y1. The data indicated that TOAC introduction in the N-terminal region is better tolerated than in proximity to the C-terminus. The effect of TOAC on the native peptide structure was examined by CD. The spectra were interpreted in terms of an increased α-helical content in [TOAC34]-NPY. EPR spectra of the labeled peptides showed that NPY interacts with PS vesicles through the C-terminal α-helix, while the N-terminal tail retains flexibility comparable to that in solution. Thomas et al. (2005, 2009) investigated the interaction of the TOAC-labeled peptides with model membranes consisting of variable proportions of PC:PS making use of EPR and NMR, as well as fluorescence. The EPR data were analyzed in terms of three peptide populations: free, dimerized, and membrane-bound. In order to obtain the spectra of the membrane-bound population, potassium chromium oxalate was used to broaden the EPR lines due to peptide free in solution. The presence of free and bound peptide spectra allowed the estimation of partition coefficients, which displayed a pH dependence. The depth of membrane penetration was also evaluated by 1H NMR MAS experiments. TOAC-promoted PRE depended on its distance from specific phospholipid hydrogens. In spite of the broad distribution of the PRE effect due to the high mobility of both lipid and peptide, the results corroborated the EPR-based conclusions showing that the α-helical part of NPY (amino acids 13–36) penetrates the membrane interface, while the unstructured N-terminal part (amino acids 1–12) extends into the aqueous phase with occasional contacts with the headgroup region. The results also suggested that NPY’s immersion depth is modulated by membrane composition: the NPY α-helix is located in the upper chain region of zwitterionic membranes, being shifted to the glycerol region in negatively charged membranes. In PC:PS membranes, an intermediate position was observed. Finally, membrane location was also verified by fluorescence quenching experiments with the Trp32-NPY analogue. It was concluded that electrostatic interactions play an important role in peptide binding.

Substance P, SP

Shafer et al. (2008) reported a study where substance P (RPKPQQFFGLM-NH2, SP) was labeled with TOAC at positions 4 or 9 and the affinity of the analogues for the neurokinin-1 receptor was compared to that of native SP. While the binding of TOAC4-SP resembled that of the native ligand, TOAC9-SP bound to a much lesser extent. Moreover, the signaling potency of TOAC4-SP was higher than that of SP itself; in contrast, the potency of position 9-labeled analogue was significantly reduced. EPR spectra reported on these differences. Both peptides gave rise to spectra that indicated restricted mobility in the presence of membranes containing over-expressed receptor. However, while TOAC4-SP bound under conditions of low or high receptor activity, a bound signal for TOAC9-SP was only obtained when the receptor was in the high-affinity binding state. Molecular dynamics calculations showed that the residue replacing Pro4 is located at the beginning of an existing helix and does not disturb the flexibility of the N-terminal sequence (“the address sequence”), while maintaining the helical conformation of the following residues. On the other hand, when TOAC replaces Gly9 in the C-terminal portion (“message domain”), while the peptide also stabilizes in the left-handed helical conformation, it is able to adopt β-sheet conformations, not available in the native peptide.

A TOAC-labeled fragment of the mas oncogene receptor

The hypothesis that protein fragments are able to acquire the same conformation they display in the whole molecule has been verified in many cases. Based on this hypothesis, an N-terminally-TOAC-labeled fragment of the mas oncogene receptor (EYWSTFGNLHHISL, residues 253–266) encompassing part of the third extracellular loop and the beginning of the seventh transmembrane portion was synthesized, and its interaction with differently charged bilayers and micelles was investigated. EPR spectra showed that, while binding to micelles occurred irrespective of detergent headgroup and charge, no interaction took place with bilayers unless peptide and phospholipid bore opposite charges. Thus, while the peptide bound to negatively charged SDS, positively charged CTAB, zwitterionic LPC and HPS, and neutral Brij-35 micelles, it interacted with DMPG vesicles only at low pH, both in the gel and in the liquid crystalline phase. CD and steady-state fluorescence measurements corroborated these findings (Pertinhez-Sini et al. 1994; Pertinhez et al. 1995, 1997). Partition coefficients were calculated from the estimation of free and membrane-bound populations in the peptide EPR spectra.

Biologically active peptides: host defense peptides

Host defense peptides (HDP) or antimicrobial peptides (AMP) present a wide action spectrum against pathogenic microorganisms, being considered an alternative to conventional antibiotics (Zasloff 2002; Brogden 2005). TOAC labeling has been used to gather information about the structure and dynamics of these peptides. In studies of trichogin GA IV (see “Trichogin GA IV”) and alamethicin F50/5 (see “Alamethicin”), the authors have taken advantage of the fact that TOAC structurally resembles Aib present in the native peptides.

Trichogin GA IV

A great deal of the present understanding of the structure and dynamic properties of the Aib-rich linear peptaibol trichogin GA IV (nOctUGLUGGLUGILol; nOct = n-octanoyl, U = Aib, Lol = leucinol) has been obtained through studies of analogues where Aib residues have been substituted by TOAC. Since both residues are helix-inducing moieties, one would expect that this substitution would not perturb the peptide conformation (and function) to a significant extent. Indeed, mono- and double-substitution of residues 1, 4, and 8 revealed that the analogues have membrane-modifying properties comparable to those of the native peptide (Epand et al. 1999; Monaco et al. 1999a, b). ED-EPR spectra indicated that TOAC at positions 1 and 8 is more flexible than at position 4 (Toropov et al. 1998). X-ray diffraction studies showed that, like the native peptide (Toniolo et al. 1994), in the crystal state the TOAC-labeled analogues fold as a right-handed, mixed 310/α-helix (Crisma et al. 1997; Monaco et al. 1999a; Saviano et al. 2004). Figure 5 shows the structures of two crystallographically independent molecules (a and b) in the asymmetric unit of the TOAC4,8-trichogin analogue. In solution, EPR studies of single- and double-labeled peptides showed that the secondary structure remains essentially unchanged when compared to the crystal state (Anderson et al. 1999; Monaco et al. 1999a). The N-terminus adopts a 310-helical structure and the C-terminus is partially folded in an α-helical conformation, also presenting an equilibrium with unfolded conformers. Anderson et al. (1999) suggested that the GlyGly stretch creates a hinge point between two short, but stable helical regions. Furthermore, PELDOR studies were performed to assess the conformation of TOAC-containing analogues when doped in a tetrameric supramolecular assembly of unlabeled peptides (Milov et al. 2001a), of dimers in frozen glassy solutions (Milov et al. 2004), and upon interaction with bilayers (Milov et al. 2005a, b). These results also showed the presence of a mixture of 310/α-helical structure. Far-UV CD spectra corroborated the helical structure of these analogues (Venanzi et al. 2006).
Fig. 5

X-ray diffraction structures of the two crystallographically independent molecules a and b in the asymmetric unit of the TOAC4,8-trichogin analogue with atom numbering. The intramolecular H-bonds are indicated by dashed lines. Reprinted from Monaco et al. (1999a) with permission of John Wiley & Sons

X-ray diffraction structures of the two crystallographically independent molecules a and b in the asymmetric unit of the TOAC4,8-trichogin analogue with atom numbering. The intramolecular H-bonds are indicated by dashed lines. Reprinted from Monaco et al. (1999a) with permission of John Wiley & Sons The self-aggregation properties of TOAC-labeled trichogin GA IV analogues were studied mostly by Milov et al. (2000a, b, 2001b, 2002, 2003a, b) using PELDOR combined with conventional CW-EPR. While formation of aggregates containing four peptide molecules was seen in an apolar solvent at 77 K, addition of a more polar solvent led to aggregate dissociation. In weakly polar solvents at 77 K, aggregation (n = 3.1–4.3 molecules) was dependent on the type of N-terminal group and TOAC position in the peptide chain, as well as solvent composition (Milov et al. 2000a). Tetramers also formed in solvents of different polarity at room temperature (Milov et al. 2000a, 2001b). In addition, in an apolar solvent, the analogues gave rise to concentration-dependent two-component EPR spectra, one ascribed to monomers and the other to aggregates (Milov et al. 2003a). Moreover, a study of self-aggregation properties of mono- and double-labeled TOAC analogues of two head-to-tail, covalently linked trichogin GA IV molecules was also performed (Milov et al. 2003b). PELDOR and CW-EPR studies in frozen glassy solutions showed that, while the covalent dimer does not form aggregates in methanol, in chloroform-toluene aggregates (n = 2–3) were observed. Aggregation of TOAC-containing trichogin GA IV was not detected in membranes of the bacterium Micrococcus luteus (Milov et al. 2002), but was found in model membranes when the peptide:lipid ratio was high (mean aggregation number = 2) (Salnikov et al. 2006). EPR and fluorescence studies showed that, upon interaction with the membrane, at low peptide:lipid ratio the peptides acquired an in-plane orientation on the membrane surface, while at higher peptide:lipid ratios, the orientation changed to a transmembrane arrangement (Epand et al. 1999; Monaco et al. 1999b; Salnikov et al. 2006). In addition, an ED-EPR study showed that the peptides presented two types of orientational motion: at low peptide:lipid ratio, the spectrum indicated fast (nanosecond timescale) motion, whereas upon increasing peptide:lipd ratio, slow (millisecond timescale) motion was observed (Syryamina et al. 2010).

Alamethicin

Alamethicin is a 20-residue linear peptaibol that induces voltage-dependent ion channel activity in lipid membranes. The amino acid sequence of the predominant neutral species, F50/5, is AcUPUAUAQUVUGLUPVUUQQFol (Ac = acetyl, U = Aib, Fol = phenylalaninol). Mono- and double-labeled analogues containing TOAC at positions 1, 8, and 16, and bearing Glu(OMe) residues instead of Gln at positions 7, 18, and 19, were synthesized by Peggion et al. (2007a). The authors showed that all TOAC-containing derivatives exhibited high activity in a leakage assay. Moreover, patch-clamp experiments showed that [TOAC16,Glu(OMe)7,18,19]alamethicin retained the ability to form ion channels in cell membranes, although the current produced was lower compared to the native peptide (Crisma et al. 2007). X-ray diffraction studies of [TOAC16,Glu(OMe)7,18,19]alamethicin showed a similar overall folding to that reported for alamethicin (Fox and Richards 1982). The conformation was largely α-helical with a bend at the level of Pro14 (Crisma et al. 2007). To assess the solution conformation of TOAC mono- and double-labeled analogues, Peggion et al. (2007b) employed CD, FT-IR, and NMR. The results showed that replacement of Aib residues for TOAC does not affect the peptide α-helical conformation significantly. Furthermore, according to PELDOR spectroscopy, the conformation of [TOAC1,16,Glu(OMe)7,18,19]alamethicin in egg PC vesicles is α-helical at least in the 1–16 segment (Milov et al. 2008). Nitroxide to peptide NH proton distances were obtained from PRE studies of [TOAC1,Glu(OMe)7,18,19]alamethicin, which could be used as long-range distance restraints for NMR-based structure determination (Jose et al. 2011). The authors showed that the peptide solution conformation is in close agreement with that in the crystal state. Mono-labeled alamethicin analogues (positions 1, 8, and 16) were studied by EPR to characterize their rotational diffusion as a function of solvent viscosity and polarity (Marsh et al. 2007a). The spectra showed that the peptides remained monomeric in solvents of relatively high polarity. In weakly polar solvents, Milov et al. (2007) detected aggregation in frozen, glassy solutions at 77 K, as well as in liquid solutions at room temperature. In fluid-phase bilayer membranes of PCs with different chain lengths, alamethicin did not form large stable aggregates (Marsh et al. 2007b, c). This conclusion was based on the lack of spinspin interactions between monomers in the CW-EPR spectra, together with the fact that the overall rotation of alamethicin is fast in fluid membranes, as shown by ST-EPR experiments that yielded effective correlation times <30 ns. However, in the low-temperature gel phase of DMPC bilayers, spinspin interaction did suggest aggregation of the TOAC1-derivative (Marsh et al. 2007b). PELDOR spectroscopy showed that the mono-labeled analogues form aggregates with an average number of approximately four in egg PC bilayers at 77 K (Milov et al. 2009). Furthermore, at a peptide:lipid ratio of 1:100, spinspin interaction within POPC bilayers was observed by CW-EPR at 77 K, indicating peptide oligomerization (Salnikov et al. 2009). Moreover, spinspin interactions, monitored by means of ED-EPR at 77 K, indicated a greater tendency to form specific oligomers upon interaction of the peptides with DOPC than with DMPC bilayers (Bartucci et al. 2009). Based on CW-EPR spectra of aligned samples and from the relative polarity of the environments experienced by the different TOAC positions (1, 8, and 16), Marsh et al. (2007b) concluded that [Glu(OMe)7,18,19]alamethicin adopts a transmembrane orientation in DMPC fluid bilayers. The authors used the combined order parameters for the different positions to determine the tilt angle of the peptide long axis relative to the bilayer normal. Effective tilt angles of 17–27 º were found over the temperature range 60–85°C. The tilt was shown to be relatively small, even at high temperatures, and to increase rather slowly with decreasing chain length (from 13° to 23° for n = 18 and 10, respectively, at 75°C) (Marsh et al. 2007c). It was concluded that such behavior is insufficient for alamethicin to achieve hydrophobic matching, and that this peptide differs in its mode of incorporation from other helical peptides for which transmembrane orientation has been determined as a function of lipid length. D2O-ESEEM experiments showed that water exposure of TOAC analogues differs between membranes of saturated (DMPC) and unsaturated (DOPC) lipids (Bartucci et al. 2009). At low temperature, the data indicated a transmembrane location in DOPC, but a more superficial location in DMPC. Corroborating these findings, a transmembrane orientation was found in POPC bilayers, while in DPPC gel phase the peptides switched to an in-plane orientation (Salnikov et al. 2009). In addition, ESEEM experiments showed that, while in the transmembrane orientation positions 8 and 16 are screened from the water phase, in the in-plane orientation only residue 16 is screened from water. It was also shown that in egg PC bilayers at 77 K the water accessibility follows the order TOAC1 > TOAC8 ~ TOAC16 (Milov et al. 2009). The use of ED-EPR spectra together with spectral simulations and conventional EPR allowed the detection of rapid librational motions of limited angular amplitude for the three mono-labeled analogues in DMPC bilayers (Bartucci et al. 2008). This study also showed that torsional fluctuations of the peptide backbone take place in the subnanosecond to nanosecond timescale, with little temperature dependence.

Gomesin

Analogues of the 18-residue HDP gomesin (ZCRRLCYKQRCVTYCRGR, Z = pyroglutamic acid and disulfide bridges link cysteines 2 and 15, and 6 and 11, Gom) were synthesized with TOAC substituting pyro-Glu both in the native cyclic peptide (TOAC1-Gom) and in a linear peptide where the four Cys residues were replaced by Ser (TOAC1-Ser2,6,11,15-Gom) (Moraes et al. 2007). EPR spectra showed that, while TOAC1-Gom interacted with SDS, above and below the detergent’s cmc, the linear peptide only interacted above the cmc. Furthermore, only the cyclic analogue bound to LPC micelles, the interaction being less strong than with SDS. a values suggested an interfacial location of the peptides. Moreover, the values of rotational correlation times were higher for the cyclic peptide. In addition, CD spectra showed that, although the micelle-bound peptides acquired β-hairpin conformations, the folds were different for both peptides. Similar to histatin-5 (see below), while the micelle environment induced a β-hairpin conformation, in TFE the linear peptide acquired α-helical conformation.

Histatin-5

Histatin-5 (DSHAKRHHGYKRKFHEKHHSHRGY, Hst-5) was TOAC-labeled at the N-terminus (TOAC0-Hst-5, Dyszy 2008). As previously found, values of a and of the h0/h−1 empirical ratio (where h0 and h−1 are the mid-field and high-field EPR line heights, respectively) reflected the ionization of TOAC0-Hst-5 N-terminus. The pK was in the 4.0–5.0 range, corroborating the observation that this value is independent of the nature of the residue next to TOAC. EPR also monitored TFE-induced conformational changes. In spite of its high positive charge, CD spectra showed that TOAC0-Hst-5, like its unlabeled counterpart, acquired α-helical conformation in the presence of TFE. Interestingly, when the peptide achieved α-helical conformation, fluorescence quenching occurred, caused by the closer proximity of the nitroxide to the fluorophores (Tyr10 and Tyr24). Hst-5 interacts with several ions, among them paramagnetic Cu2+ (Melino et al. 2006), the binding site being the D1SH3 sequence. The Cu2+-promoted loss of intensity in the EPR spectra of TOAC0-Hst-5 was analyzed by means of the Leigh (1970) theory of spinspin dipolar coupling making use of parameters taken from Livshits et al. (2001). An NO-Cu2+ distance of 4.8 Å was calculated, in agreement with the proposed binding site. Both Hst-5 and TOAC0-Hst-5 bound to a greater extent to negatively charged than to zwitterionic micelles. CD spectra indicated that, in contrast with TFE, upon binding, the peptides acquired a β-turn conformation. EPR spectra of TOAC0-Hst-5 in the presence of lipid vesicles mimicking the membrane of erythrocytes (negligible surface charge) showed essentially no interaction. In contrast, in the presence of vesicles mimicking the membranes of E. coli and C. albicans (negative surface charge), the spectra evinced pH-modulated binding, demonstrating that binding is essentially due to electrostatic interactions. The presence of membrane-bound and free peptide populations allowed calculation of partition coefficients.

Tryptophan-rich tritrpticin and indolicidin

The interaction of the cationic peptide tritrpticin (VRRFPWWWPFLRR, TRP3) and its N-terminally-labeled analogue (TOAC0-TRP3) with micelles and vesicles of variable headgroup composition and surface charge was studied making use of EPR, CD, and fluorescence (Bozelli Jr. 2011). Broadening of the EPR spectral lines demonstrated TOAC0-TRP3 interaction with both zwitterionic and negatively charged micelles, binding being more effective in the latter case. In contrast, the interaction with zwitterionic bilayers was negligible. Thus, while electrostatic interactions were important for peptide-bilayer interaction, they played a less important role in the interaction with micelles. a values demonstrated peptide location at the membrane–water interface. Partition coefficients were calculated, as well as the free energy of binding. The presence of three Trp residues gave rise to electronic transitions in the far-UV, rendering difficult the analysis of CD spectra in terms of peptide secondary structure; nevertheless, binding was seen to promote acquisition of secondary structure, and the peptides conformation was found to depend on aggregate structure: while both peptides acquired similar conformations in all micellar systems, in bilayers, the conformation varied with lipid composition. Binding to membranes promoted an increase in Trp fluorescence; the decrease in maximal emission wavelength was small, corroborating the notion of peptide location close to the membrane–water interface. Fluorescence quenching by the nitroxide group occurred to a small extent, suggesting that the average distance between this group and the Trp residues is too large to allow for significant quenching effects. The N-terminally-labeled TOAC derivative (TOAC0-IND) of indolicidin (ILPWKWPWWPWRR-NH2, IND) was synthesized and fluorescence spectra of both peptides were studied in solution and in the presence of micelles and of phospholipid vesicles (Souto et al., in preparation). In contrast to the negligible quenching effect of TOAC on the fluorescence spectra of TOAC0-TRP3 (see above), considerable quenching was observed for TOAC0-IND. Also, in this case, TOAC0-IND EPR spectra were pH-sensitive. Moreover, the peptide was able to interact with zwitterionic (LPC) as well as negatively charged (SDS, LPC:LPG) micelles and bilayers (POPC:POPG). However, in contrast to most peptides, TOAC0-IND also bound to zwitterionic bilayers (POPC), suggesting that hydrophobic interactions play a more important role in this case. In agreement with this observation, EPR spectra of lipid spin probes showed that addition of native IND increased the order parameter in both micelles and bilayers, although the effect was more pronounced in the former.

Membrane-active peptides: a model peptide, phospholamban, β-amyloid

A positively charged model peptide

Taking into account that water-soluble proteins involved in cell signaling carry positively charged domains that promote their attachment to membranes by means of electrostatic interactions, Victor and Cafiso (2001) examined the interaction between PC and PC:PS (with varying PS content) bilayers and basic synthetic peptides containing Lys and a variable number of Phe residues (n = 0, 2, 3, and 4), in addition to one internally-placed TOAC residue. EPR spectra were used to gather information about the dynamics of free and membrane-bound peptides, binding free energy, and peptide position on the membrane interface. Binding of all peptides increased upon addition of PS. Furthermore, only Phe-containing peptides bound to PC bilayers. Rotational correlation times indicated that the peptides underwent rapid rotation in solution. Upon binding to negatively charged bilayers, the EPR spectra were broadened. For peptides containing only Lys, correlation times were ca. 4 times longer than those in solution. On the other hand, the incorporation of Phe residues increased the correlation times of membrane-bound peptides ca. 20 times. Power-saturation was employed to estimate the position of the peptides in the membrane. While peptides lacking Phe residues were localized within the double layer, ~5 Å above the level of the lipid phosphate, the incorporation of Phe residues shifted the peptides to a location within the bilayer, several angstroms below the phosphate level. The results support the hypothesis that the position and free energy of membrane binding are determined by long-range coulombic attraction, the hydrophobic effect, and a short-range desolvation force.

Phospholamban, PLB

PLB is an amphipathic 52 amino acid membrane peptide which regulates the Ca-ATPase (SERCA) in cardiac sarcoplasmic reticulum whose function requires transitions between distinct states of intramolecular dynamics. The group of D.D. Thomas has made a long-time contribution to the understanding of PLB structural and functional properties, mainly through the use of the spin label method. This group undertook the task of synthesizing TOAC-containing PLB derivatives. The synthesis of this peptide including TOAC is a challenge, especially in the addition of TOAC and the next several amino acids. A procedure was described for the synthetic incorporation of TOAC (Karim et al. 2004, 2007; Zhang et al. 2007). EPR spectra were used to optimize the SPPS. EPR of synthetic intermediates, reconstituted into lipid bilayers, was used to ensure complete coupling and Fmoc deprotection. Fmoc-TOAC-OH attachment led to strong probe immobilization, whereas deprotection dramatically mobilized it, producing a peak completely resolved from that observed before deprotection. In the case of TOAC incorporation at position 11, coupling of the next amino acid (Ser) restored strong immobilization, giving a peak completely resolved from that of the preceding step. For several subsequent steps, the effect of coupling and deprotection was similar but less dramatic. Thus, the sensitivity and resolution of EPR provided a quantitative monitor of completion at each of these critical steps in peptide synthesis. Mass spectrometry, CD, and Edman degradation were used in concert with EPR to verify the chemistry and characterize the secondary structure. It was concluded that application of conventional analytical methods in combination with EPR offers an improved approach to optimize the accurate synthesis of TOAC-labeled membrane peptides. Making use of this procedure, PBL derivatives were synthesized, containing a single TOAC residue at positions 0 (TOAC0-PLB), 11 (TOAC11-PLB), and 24 (TOAC24-PLB) in the cytoplasmic domain or at position 46 (TOAC46-PLB) in the transmembrane domain. The authors also described a protocol for the functional reconstitution of the spin-labeled protein in lipid vesicles. EPR spectra were used to probe the structural dynamics of TOAC-containing PLB analogues in lipid bilayers (Karim et al. 2004). The spectra were analyzed by means of simulations making use of the NLSL software (Budil et al. 1996). TOAC46-PLB gave rise to a single spectral component indicative of strong immobilization, which was consistent with the presence of a stable, highly ordered transmembrane helix. In contrast, the spectra of the three cytoplasmic domain probes presented two-component spectra corresponding to two conformational states, one of which indicated nearly isotropic nanosecond dynamic disorder. For TOAC11-PLB, an N-terminal lipid anchor shifted the equilibrium toward the restricted component, whereas Mg2+ had the opposite effect. Relaxation enhancement by Ni2+ ions chelated to lipid headgroups, provided further information about PLB membrane topology, allowing the refinement of an NMR-based structural model. It was concluded that PLB cytoplasmic domain is in dynamic equilibrium between an ordered conformation in direct contact with the membrane surface, and a dynamically disordered form, detached from the membrane and poised to interact with its target. Based on the knowledge that the PLB transmembrane domain inhibits SERCA at low [Ca2+], but the cytoplasmic domain relieves this inhibition upon Ser16 phosphorylation, TOAC11-PLB was reconstituted into membranes in the presence or absence of SERCA (Karim et al. 2006). The analogue showed normal inhibitory function, reversed by Ser16 phosphorylation or micromolar [Ca2+]. EPR spectra showed that the PLB cytoplasmic domain exhibits two conformations, an ordered (tense) T state and a dynamically disordered and extended (relaxed) R state. Phosphorylation shifted the equilibrium toward the R state, making it more dynamic (hyperextended). It was concluded that the relief of SERCA inhibition by PLB phosphorylation is due to an order-to-disorder transition in PLB cytoplasmic domain, which allows this domain to extend above the membrane surface and induce a structural change in the cytoplasmic domain of SERCA. Multifrequency EPR is a powerful approach for analysis of complex rotational dynamics of proteins. Since the function of PLB requires transitions between distinct states of intramolecular dynamics, multifrequency experiments were used to define the peptide’s multistate structural dynamics in a lipid bilayer (Nesmelov et al. 2007). EPR spectra of TOAC11-PLB and TOAC46-PLB at 9.4 GHz (X-band) and 94 GHz (W-band) were analyzed in terms of anisotropic rotational diffusion of the two domains. Motion of the transmembrane domain was highly restricted, while the cytoplasmic domain exhibited two distinct conformations, a major one with moderately restricted nanosecond dynamics (T) and another with nearly unrestricted subnanosecond motion (R). The global analysis of spectra at two frequencies yielded much more precise values for rotational correlation times and order parameters than those determined at either frequency alone.

β-amyloid peptide

Based on evidence that the lipid matrix of neuronal membranes plays a role in β-amyloid peptide β-sheet oligomerization, Esposito et al. (2006) investigated the interaction between a β-amyloid peptide fragment (GSNKGAAIIGLM, Aβ25-35) containing TOAC at the N- or C-terminus with SDS and DPC micelles, and bilayer vesicles of variable lipid composition employing EPR and CD. A comparison of the CD spectra of the native with those of the labeled peptides revealed that TOAC did not affect peptide conformation. While the CD spectra showed an unordered structure in aqueous solution, the peptides acquired helical conformation upon binding to micelles. Moreover, the peptides also became more structured upon interacting with negatively charged bilayers. When the membranes contained cholesterol and sphingomyelin, present in lipid rafts, a transition from α-helical to β-sheet conformation was observed. EPR spectra showed that, upon binding to micelles, while the peptide containing C-terminally-bound TOAC gave rise to a more strongly immobilized population, the N-terminally-labeled counterpart yielded spectra typical of a more mobile population. A model was proposed whereby the peptide C-terminal portion is highly membrane-associated, while the N-terminal part extends into the aqueous phase, with occasional contacts with the lipid headgroup region.

Peptide-macromolecule interaction

In recent years novel applications of TOAC have appeared, among those, the use of TOAC-labeled peptides to monitor peptide-peptide, peptide-protein, and peptide-RNA interactions. As already mentioned (see “Angiotensin and bradykinin”), Lopes and collaborators (2008) described an EPR approach to explore the details of angiotensin II binding site to its AT1 receptor. While the active TOAC1-AII analogue was found to interact with a peptide composed of portions of the receptor N-terminal domain and third extracellular loop, inactive TOAC4-AII did not display this ability. Zhang et al. (2008) synthesized by SPPS the basic 55-residue protein NCp-7 of the HIV-1 nucleocapsid, as well as an analogue with TOAC before the N-terminal residue (TOAC0-NCp-7). NCp-7 contains two weakly interacting Zn-finger domains and has numerous critical functions in HIV-1 replication. TOAC0-NCp-7 displayed biological activity similar to that of the native protein. EPR spectra were analyzed by means of computer simulations making use of the NLSL method (Budil et al. 1996). The spectra indicated fast motion of N-terminally located TOAC, both in the holo (Zn2+-containing) and in the apo (non-Zn2+) protein; the rate of motion decreased upon interaction with a stem-loop RNA. The conformation of both holo- and apo-TOAC0-NCp-7 as a function of TFE was investigated using EPR and CD spectroscopies. Upon addition of TFE, CD spectra indicated that apo-TOAC0-NCp-7 shifted from a disordered to α-helical conformation. Accordingly, EPR spectra revealed a great increase in rotational correlation times, due both to protein conformational changes and to TFE-promoted increase of microviscosity. The binding of Zn2+ in holo-TOAC0-NCp-7 caused a loss of helical content in TFE, in agreement with the considerable line narrowing in the EPR spectra. The C-terminal tail of transducin α-subunit, Gtα(340-350) (IKENLKDCGLF), binds to and stabilizes rhodopsin’s active conformation upon photoactivation (R*) (Hamm et al. 1988; Dratz et al. 1993). NMR results showed that, upon binding, Gtα(340-350) acquires an ordered continuous helical conformation terminated by a C-terminal capping motif (Kisselev et al. 1998). Five spin-labeled analogues of Gtα(340-350) were synthesized and were able to bind and stabilize R* in a manner similar to that of the native peptide (Van Eps et al. 2010). In this study, TOAC replaced residue 343 in both the native sequence and in a 100-fold higher-affinity peptide (VLEDLKSCGLF) reported from phage display (Martin et al. 1996). In addition, 3-carboxy-PROXYL was incorporated at the N-terminus in both peptides. A fifth analogue was synthesized containing the high affinity sequence and both PROXYL at the N-terminus and TOAC replacing Gly348. Upon binding to R*, all four mono-labeled peptides gave rise to two-component EPR spectra, due to a protein-bound population and another free in solution. Spectral subtractions showed that the protein-bound populations were strongly immobilized, the TOAC-containing peptides yielding higher correlation times than those carrying the PROXYL moiety. DEER experiments showed that the distances between nitroxides in doubly-labeled PROXYL/TOAC348-Gtα(340-350) varied in the range 18–34 Å in solution, a result consistent with an ensemble of conformations for the unbound peptide. In contrast, a narrow distance distribution centered at 19 Å was found for R*-bound Gtα(340-350), consistent with the configuration determined by crystal studies (Scheerer et al. 2008) and by NMR (Kisselev et al. 1998). It was concluded that TOAC and PROXYL spin labels can be valuable tools to explore the structure and conformational changes at the rhodopsin-G-protein interface. The ATP-binding cassette transporter associated with antigen processing (TAP) acts in the adaptive immune defense against infected or malignantly transformed cells. The protein translocates proteasomal degradation products into the lumen of the endoplasmic reticulum for loading onto MHC class I molecules, displaying a broad substrate spectrum, which suggests that the substrate-binding pocket presents high structural flexibility. Making use of EPR spectroscopy, Herget et al. (2011) examined conformational properties of the high affinity HLA-B27 restricted epitope RRYQSTEL. Information about side chain dynamics and environmental polarity was obtained from analysis of spectra of 3-iodoacetamido-PROXYL covalently attached to peptides where each one of the nine residues were mutated to Cys, while TOAC-labeled peptides, with TOAC replacing each of the nine residues, were used to monitor backbone properties. Differences in affinity, dynamics, and polarity were found to depend on the spin probe position: while the side chains mobility was strongly restricted at the ends of the peptide, the central region was flexible, suggesting a central bulge. DEER experiments on doubly-labeled peptides where one PROXYL label was placed at position 8 and the second at position 2, 4, or 6, allowed the determination of interspin distances in order to derive the conformations of TAP-bound peptides. Spectral simulations based on a rotamer library led to the conclusion that peptides bind to TAP in an extended kinked structure, similar to that found for peptides bound to MHC class I proteins. Several approaches were employed to address the role of apoprotein E (apoE) isoforms in the mechanism of development of Alzheimer’s disease, since the interaction between apoE3 and the amyloid β peptide (Aβ) is proposed to be involved in the process of Aβ misfolding and aggregation (Petrlova et al. 2011). Among these approaches, an analogue where TOAC replaced Ser26 in the 40-residue peptide (TOAC26-Aβ) was synthesized that displayed oligomerization and toxic properties similar to those of the native peptide. EPR spectra of the labeled peptide were obtained for the monomeric and oligomeric forms, the latter reporting a higher degree of probe immobilization. The spectra were simulated making use of the NLSL software (Budil et al. 1996) and showed an increase in rotational correlation time of ca. 6 times upon oligomerization. In order to avoid spinspin interactions, oligomers were prepared where the labeled peptide was diluted by the addition of native Aβ at a 1:3 proportion. EPR spectra of monomeric TOAC26-Aβ showed a higher affinity for apoE3 than for apoE4. The apoE-Aβ interaction was also examined by analysis of EPR spectra of different apoE site-directed spin-labeled isoforms, as well as by means of surface plasmon resonance, yielding similar conclusions. An even more recent very promising approach is the use of TOAC-labeled peptides in paramagnetic relaxation enhancement (PRE) experiments to obtain information about the distances between TOAC and amino acids in a protein to which the labeled peptide is bound, allowing the determination of the structure of the complex. The advantage of using TOAC lies in the fact that its rigid structure restricts the region of interaction, decreasing averaging effects and yielding better-defined distances (Lindfors et al. 2008; Su and Otting 2010; Keizers and Ubbink 2011). This approach was used for the first time by Lindfors et al. (2008) to examine the interaction between TOAC-labeled nonapeptides derived from focal adhesion kinase (FAK) and the Src homology 3 (SH3) domain of Src kinase. When TOAC replaced a residue located in the peptide binding motif, this caused a substantial decrease of the binding affinity. In contrast, when TOAC was placed just outside the binding motif, the binding constant was essentially unaffected. It was found that, although the SH3 domain binds weakly and transiently to Pro-rich peptides from FAK, the interaction is not very dynamic and the relative position of the spin label to the protein is well defined. Antibodies have a wide range of biological and biotechnical applications. Selective interaction with an epitope is known to be crucial and to depend on paratope conformation. Mangels et al. (2010) applied PRE NMR spectroscopy to determine the orientation of helix 1 of the prion protein, which is the epitope for the therapeutically active anti-prion scF(v) fragment W226. For this purpose, the peptide fragment W226 was labeled with TOAC and PRE experiments were performed to elucidate the structure of the paratope-epitope interface.

Use of TOAC EPR spectra to monitor and improve solid phase peptide synthesis

The first studies of the applications of EPR to TOAC-labeled peptidyl-resins were reported about two decades ago (Nakaie et al. 1988, 1990) and were extended to focus the dynamics of the polymer matrix through the determination of the mobility of peptide chains in the resin bead as a function of solvent. Cilli et al. (1997) introduced an EPR approach to monitor peptide chain aggregation inside resin beads. In this work, for the first time in peptide synthesis, EPR spectroscopy allowed the detection of different degrees of chain aggregation as a function of solvent and resin loading. Differently from NMR or FT-IR spectra, which reflected the solvation of the whole peptide chain in the bead, the EPR method allowed estimation of the chain aggregation/accessibility in the N-terminal region, where the extent of steric hindrance is critical for the success of the synthetic process. Later, Cilli et al. (1999) studied the strongly aggregating VVLGAAIV and ING sequences in benzhydrylamine resin with different amino group contents to evaluate the extent of chain association within the beads. The model peptidyl-resins were first labeled with Fmoc-TOAC at their N-terminus and their solvation properties in different solvents were evaluated. This work, as well as the studies of Marchetto et al. (2005) and Nakaie et al. (2006), demonstrated the possibility of correlating EPR spectral parameters with different factors that govern polymer-supported reactions during synthesis. The effect of temperature (Ribeiro et al. 2001) and of amino acid side chains protecting groups (Cilli et al. 2007) on chain dynamics inside resin beads were also monitored by EPR. Another study focused on a very hydrophobic 34-residue peptide (TM-34, CTVAEIYLGNLAGADLILASGLPFWAITIANNFD) which corresponds to a transmembrane segment (residues 69–97) of the rat B2 BK receptor. Due to the difficulty in synthesizing and purifying TM-34, Oliveira et al. (2002) investigated the association properties of shorter peptides from this sequence. The work focused on peptide-resin solvation/swelling (measurement of bead size), chain mobility (assessed by means of EPR spectra of TOAC-labeled peptidyl-resin), and the kinetics of the coupling reaction. The use of TOAC EPR spectra to investigate how physicochemical conditions influence the efficacy of peptide synthesis within polymer beads proved to be a powerful tool for the achievement of a fundamental goal in this field, namely, the improvement of the yield of synthesis.

Concluding remarks

The introduction of TOAC represented a new approach for EPR studies of peptides where this unnatural paramagnetic amino acid can be linked to the peptide backbone via a peptide bond. In view of TOAC’s rigid cyclic structure, studies of backbone dynamics are not influenced by rotations of bonds in side chain residues, or those between side chains and the nitroxide group in side chain-attached spin labels. Studies making use of TOAC have yielded a wealth of information about the structural and dynamical aspects of synthetic and biologically active peptides. The combined use of a variety of physical techniques in studies of TOAC-containing peptides has contributed to the understanding of the conformational properties of these molecules, and, therefore, their function. The use of TOAC has shed light on the role of important physicochemical parameters for the improvement of peptide synthesis. New approaches have appeared, such as paramagnetic enhanced relaxation NMR, where the rigid attachment of TOAC to the peptide backbone allows more precise determination of distances for the mapping of peptide-protein complexes. It is foreseeable that other novel approaches will expand the fields of TOAC applications in the future.
  116 in total

1.  Conformational analysis of TOAC-labelled alamethicin F50/5 analogues.

Authors:  Cristina Peggion; Micha Jost; Wim M De Borggraeve; Marco Crisma; Fernando Formaggio; Claudio Toniolo
Journal:  Chem Biodivers       Date:  2007-06       Impact factor: 2.408

2.  Rotational dynamics of HIV-1 nucleocapsid protein NCp7 as probed by a spin label attached by peptide synthesis.

Authors:  Zhiwen Zhang; Xiangmei Xi; Charles P Scholes; Christine B Karim
Journal:  Biopolymers       Date:  2008-12       Impact factor: 2.505

3.  Light-activated rhodopsin induces structural binding motif in G protein alpha subunit.

Authors:  O G Kisselev; J Kao; J W Ponder; Y C Fann; N Gautam; G R Marshall
Journal:  Proc Natl Acad Sci U S A       Date:  1998-04-14       Impact factor: 11.205

4.  Synthesis and conformational characterisation of hexameric β-peptide foldamers by using double POAC spin labelling and cw-EPR.

Authors:  Karen Wright; Michel Wakselman; Jean-Paul Mazaleyrat; Lorenzo Franco; Antonio Toffoletti; Fernando Formaggio; Claudio Toniolo
Journal:  Chemistry       Date:  2010-09-24       Impact factor: 5.236

Review 5.  100 years lock-and-key concept: are peptide keys shaped and guided to their receptors by the target cell membrane?

Authors:  R Schwyzer
Journal:  Biopolymers       Date:  1995       Impact factor: 2.505

6.  Site-specific incorporation of biophysical probes into proteins.

Authors:  V W Cornish; D R Benson; C A Altenbach; K Hideg; W L Hubbell; P G Schultz
Journal:  Proc Natl Acad Sci U S A       Date:  1994-04-12       Impact factor: 11.205

7.  Synthesis and properties of spin-labeled angiotensin derivatives.

Authors:  C R Nakaie; S Schreier; A C Paiva
Journal:  Biochim Biophys Acta       Date:  1983-01-12

8.  Fmoc-POAC: [(9-fluorenylmethyloxycarbonyl)-2,2,5,5-tetramethylpyrrolidine-N-oxyl-3-amino-4-carboxylic acid]: a novel protected spin labeled beta-amino acid for peptide and protein chemistry.

Authors:  M Tominaga; S R Barbosa; E F Poletti; J Zukerman-Schpector; R Marchetto; S Schreier; A C Paiva; C R Nakaie
Journal:  Chem Pharm Bull (Tokyo)       Date:  2001-08       Impact factor: 1.645

9.  The interaction of neuropeptide Y with negatively charged and zwitterionic phospholipid membranes.

Authors:  Lars Thomas; Holger A Scheidt; Andrea Bettio; Annette G Beck-Sickinger; Daniel Huster; Olaf Zschörnig
Journal:  Eur Biophys J       Date:  2009-03-25       Impact factor: 1.733

10.  The Bip method, based on the induced circular dichroism of a flexible biphenyl probe in terminally protected -Bip-Xaa*- dipeptides, for assignment of the absolute configuration of beta-amino acids.

Authors:  Laurence Dutot; Karen Wright; Anne Gaucher; Michel Wakselman; Jean-Paul Mazaleyrat; Marta De Zotti; Cristina Peggion; Fernando Formaggio; Claudio Toniolo
Journal:  J Am Chem Soc       Date:  2008-04-10       Impact factor: 15.419

View more
  18 in total

1.  Calcium-Dependent Structural Dynamics of a Spin-Labeled RyR Peptide Bound to Calmodulin.

Authors:  Cheng Her; Jesse E McCaffrey; David D Thomas; Christine B Karim
Journal:  Biophys J       Date:  2016-12-06       Impact factor: 4.033

2.  Peptide-Membrane Interactions by Spin-Labeling EPR.

Authors:  Tatyana I Smirnova; Alex I Smirnov
Journal:  Methods Enzymol       Date:  2015-09-26       Impact factor: 1.600

3.  Trajectory-Based Simulation of EPR Spectra: Models of Rotational Motion for Spin Labels on Proteins.

Authors:  Peter D Martin; Bengt Svensson; David D Thomas; Stefan Stoll
Journal:  J Phys Chem B       Date:  2019-11-21       Impact factor: 2.991

4.  A Global Minimization Toolkit for Batch-Fitting and χ2 Cluster Analysis of CW-EPR Spectra.

Authors:  William R Lindemann; Ty Christoff-Tempesta; Julia H Ortony
Journal:  Biophys J       Date:  2020-10-14       Impact factor: 4.033

5.  Conformational changes of the HsDHODH N-terminal Microdomain via DEER Spectroscopy.

Authors:  Eduardo F Vicente; Indra D Sahu; Antonio J Costa-Filho; Eduardo M Cilli; Gary A Lorigan
Journal:  J Phys Chem B       Date:  2015-07-02       Impact factor: 2.991

6.  Conformational Dynamics in Extended RGD-Containing Peptides.

Authors:  William R Lindemann; Alexander J Mijalis; José L Alonso; Peter P Borbat; Jack H Freed; M Amin Arnaout; Bradley L Pentelute; Julia H Ortony
Journal:  Biomacromolecules       Date:  2020-06-16       Impact factor: 6.988

7.  Pulsed EPR distance measurements in soluble proteins by site-directed spin labeling (SDSL).

Authors:  Ian Mitchelle S de Vera; Mandy E Blackburn; Luis Galiano; Gail E Fanucci
Journal:  Curr Protoc Protein Sci       Date:  2013-11-05

8.  Half a century deciphering membrane structure, dynamics and function: a short description of the life and research of Shirley Schreier.

Authors:  Shirley Schreier
Journal:  Biophys Rev       Date:  2021-11-13

9.  Conformational Properties of Seven Toac-Labeled Angiotensin I Analogues Correlate with Their Muscle Contraction Activity and Their Ability to Act as ACE Substrates.

Authors:  Luis Gustavo D Teixeira; Luciana Malavolta; Patrícia A Bersanetti; Shirley Schreier; Adriana K Carmona; Clovis R Nakaie
Journal:  PLoS One       Date:  2015-08-28       Impact factor: 3.240

10.  Dynamics and conformational studies of TOAC spin labeled analogues of Ctx(Ile(21))-Ha peptide from Hypsiboas albopunctatus.

Authors:  Eduardo F Vicente; Luis Guilherme M Basso; Graziely F Cespedes; Esteban N Lorenzón; Mariana S Castro; Maria José S Mendes-Giannini; Antonio José Costa-Filho; Eduardo M Cilli
Journal:  PLoS One       Date:  2013-04-09       Impact factor: 3.240

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.