Preclinical studies of human immunodeficiency virus type 1 (HIV-1) vaccine candidates have typically shown post-infection virological control, but protection against acquisition of infection has previously only been reported against neutralization-sensitive virus challenges. Here we demonstrate vaccine protection against acquisition of fully heterologous, neutralization-resistant simian immunodeficiency virus (SIV) challenges in rhesus monkeys. Adenovirus/poxvirus and adenovirus/adenovirus-vector-based vaccines expressing SIV(SME543) Gag, Pol and Env antigens resulted in an 80% or greater reduction in the per-exposure probability of infection against repetitive, intrarectal SIV(MAC251) challenges in rhesus monkeys. Protection against acquisition of infection showed distinct immunological correlates compared with post-infection virological control and required the inclusion of Env in the vaccine regimen. These data demonstrate the proof-of-concept that optimized HIV-1 vaccine candidates can block acquisition of stringent, heterologous, neutralization-resistant virus challenges in rhesus monkeys.
Preclinical studies of humanimmunodeficiency virus type 1 (HIV-1) vaccine candidates have typically shown post-infection virological control, but protection against acquisition of infection has previously only been reported against neutralization-sensitive virus challenges. Here we demonstrate vaccine protection against acquisition of fully heterologous, neutralization-resistant simian immunodeficiency virus (SIV) challenges in rhesus monkeys. Adenovirus/poxvirus and adenovirus/adenovirus-vector-based vaccines expressing SIV(SME543) Gag, Pol and Env antigens resulted in an 80% or greater reduction in the per-exposure probability of infection against repetitive, intrarectal SIV(MAC251) challenges in rhesus monkeys. Protection against acquisition of infection showed distinct immunological correlates compared with post-infection virological control and required the inclusion of Env in the vaccine regimen. These data demonstrate the proof-of-concept that optimized HIV-1 vaccine candidates can block acquisition of stringent, heterologous, neutralization-resistant virus challenges in rhesus monkeys.
Despite the recent demonstration of partial HIV-1 vaccine efficacy in humans[6], the immune responses required to protect against acquisition of infection have remained unclear. Preclinical studies of HIV-1 vaccine candidates have begun to elucidate immunologic correlates of protection against neutralization-sensitive viruses[1-3], but no study has to date reported vaccine protection against acquisition of heterologous, neutralization-resistant virus challenges[1,7,8]. Mucosal SIVmac251 infection of rhesus monkeys represents a stringent preclinical model of a highly pathogenic, neutralization-resistant virus swarm[1,9,10], and repetitive mucosal challenges more closely mimic sexual HIV-1 transmission in humans than do single high-dose challenges[10]. We therefore performed two studies to evaluate the protective efficacy of optimized adenovirus/poxvirus and adenovirus/adenovirus vector-based vaccines against repetitive, heterologous, intrarectal SIVmac251 challenges in rhesus monkeys.In the first study, 40 Indian-origin rhesus monkeys (Macaca mulatta) that did not express the class I alleles Mamu-A*01, Mamu-B*08, and Mamu-B*17 associated with spontaneous virologic control[11-13] were immunized by the intramuscular route with the following vaccine regimens expressing SIVsmE543 Gag-Pol and Env immunogens (N=8/group): (i) DNA prime, MVA boost; (ii) MVA prime, MVA boost; (iii) Ad26 prime, MVA boost; (iv) MVA prime, Ad26 boost; and (v) sham controls. Groups were balanced for susceptible and resistant TRIM5α alleles[1,14]. Monkeys were primed once at week 0 with 2×1010 vp Ad26 vectors or 108 pfu MVA vectors, or three times at weeks 0, 4, and 8 with 5 mg DNA vaccines. Animals were then boosted once at week 24 with 2×1010 vp Ad26 vectors or 108 pfu MVA vectors.The vaccine regimens elicited different profiles of cellular and humoral immune responses, as measured by IFN-γ ELISPOT assays (Fig. 1a, Supplementary Fig. 1), multiparameter intracellular cytokine staining (ICS) assays[8,15-17] (Fig. 1b, Supplementary Fig. 2), cellular immune breadth (Supplementary Fig. 3), SIVmac251 Env-specific binding antibody ELISAs (Fig. 1c), tier 1 neutralizing antibody (NAb) assays against tissue culture laboratory adapted (TCLA) tier 1 SIVsmE660 (CP3C-P-A8) and SIVmac251 (TCLA) pseudoviruses (Fig. 1d), and antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cell-mediated virus inhibition (ADCVI) assays (Supplementary Fig. 4). Tier 2 NAb responses against neutralization-resistant SIVsmE660 (CR54-PK-2A5) and SIVmac251 (SIVmac251.30) pseudoviruses, however, were below the 50% neutralization cutoff for positivity, although positive trends were observed in all vaccinated groups (Supplementary Fig. 4).
Figure 1
Immunogenicity and protective efficacy of the adenovirus/poxvirus vaccines
a, Cellular immune responses to SIVsmE543 and SIVmac239 Gag, Pol, and Env as determined by IFN-γ ELISPOT assays at weeks 0, 10, 24, 26, and 52. b, CD8+ and CD4+ total, central/transitional memory (CM; CD28+CD95+), and effector memory (EM; CD28-CD95+) responses to Gag, Pol, and Env as determined by multiparameter IFN-γ ICS assays at week 26. c, SIVmac251 Env ELISAs at weeks 0, 10, 24, 28, and 52. d, SIVsmE660 and SIVmac251 tier 1 pseudovirus NAb assays at weeks 0, 28, and 52. Error bars reflect s.e.m. e, Number of challenges required for acquisition of infection in each vaccine group. f, Statistical analyses include the number of challenges required for 50% infection, hazard ratios with 95% confidence intervals (CI), per-exposure vaccine efficacy (VE), and per-exposure risks of infection in each group. P-values reflect Wald tests using a proportional hazard model. g, Log SIV RNA copies/ml are depicted for each vaccine group at viral setpoint (day 84). ** P=0.0037, Wilcoxon rank-sum tests. The horizontal lines reflect mean setpoint log viral loads.
To evaluate the protective efficacy of these vaccine regimens, all monkeys were challenged repetitively beginning at week 52 (six months following the boost immunization) with six intrarectal inoculations of the heterologous virus SIVmac251 utilizing a 1:1000 dilution (930 TCID50) of our challenge stock[9]. After the first challenge, 75% of sham control monkeys became infected, as compared with only 12–25% of the animals that received the heterologous vector regimens DNA/MVA, Ad26/MVA, and MVA/Ad26 (Fig. 1e). The percent uninfected animals declined proportionately with each challenge, and the majority of vaccinees and all controls were infected by the end of the challenge protocol. Monkeys that received the Ad26/MVA and MVA/Ad26 vaccines required 3 challenges to infect 50% of animals in each group, whereas only 1 challenge was required to infect 50% of animals in the control group (P=0.004 and P=0.006, respectively, Wald tests, proportional hazard model). The heterologous vector regimens also exhibited decreased hazard ratios of 0.17 (CI 0.05–0.57) to 0.20 (CI 0.06–0.63) as compared with the controls, corresponding to an 80–83% reduction in the per-exposure probability of infection (Fig. 1f; vaccine efficacy VE = 1 – hazard ratio), utilizing the statistical approach of Self et al.[4] and Gilbert et al.[5]. These data demonstrate vaccine protection against acquisition of infection following repetitive, heterologous, IR SIVmac251 challenges.Control monkeys exhibited peak viral loads on day 14 following infection and then relatively stable mean setpoint viral loads of 5.85 log SIV RNA copies/ml (Supplementary Fig. 5). The Ad26/MVA and the MVA/Ad26 vaccines resulted, respectively, in at least 2.32 and 1.08 log reductions of mean setpoint viral loads compared with sham controls for over 250 days (P=0.0037 for each vaccine versus sham, Wilcoxon rank-sum tests) (Fig. 1g, Supplementary Fig. 5). Moreover, half the animals in the Ad26/MVA group either demonstrated rapid and durable virologic control to undetectable levels (Fig. 1g; N=3) or remained uninfected (Fig. 1e; N=1). The Ad26/MVA and MVA/Ad26 vaccines also afforded a survival advantage as compared with the controls (P=0.025, log-rank test) (Supplementary Fig. 6).We next evaluated the immunologic correlates of protection against acquisition of infection, defined as the number of challenges required to establish infection, and virologic control, defined as setpoint viral loads. Our pre-specified primary immunologic correlates analysis (Supplementary Table 1) demonstrated that protection against acquisition of infection was best correlated with Env binding ELISA antibody responses (Fig. 2a; P<0.0001, Spearman rank-correlation test) and tier 1 NAb titers (Fig. 2b; P=0.0034) immediately prior to challenge. Protection against acquisition of infection also correlated with V2-specific antibodies that presumably represent a subset of total Env binding antibodies (Fig. 2e, f; P<0.0001). Virologic control was correlated with Gag ELISPOT breadth (Fig. 2c; P=0.0002) and magnitude (Fig. 2d; P=0.0058) immediately prior to challenge, consistent with our previous observations[18].
Figure 2
Correlates of protection against acquisition of infection and virologic control with the adenovirus/poxvirus vaccines
Correlation of (a) log ELISA titers immediately prior to challenge and (b) log tier 1 NAb titers immediately prior to challenge with the number of challenges required to establish infection. Correlation of (c) Gag ELISPOT breadth prior to challenge and (d) Gag ELISPOT magnitude prior to challenge with setpoint viral loads following challenge. Correlates analyses included the 32 vaccinated monkeys (a, b) or the 29 vaccinated animals that became infected (c, d) and did not include the sham controls. P-values reflect Spearman rank-correlation tests. e, V2-specific binding antibodies assessed by surface plasmon resonance response units (RU) for each vaccine group at week 30. * P=0.002, ** P=0.0007, Wilcoxon rank-sum tests. The horizontal lines reflect mean responses. f, Correlation of V2-specific antibody responses with the number of challenges required to establish infection.
In our exploratory immunologic correlates analysis, we evaluated 35 humoral and cellular immune parameters at both peak and memory timepoints prior to challenge as possible immunologic correlates of acquisition and virologic control following challenge. No additional immune parameters were significantly correlated with protection against acquisition of infection in this analysis after multiple comparison adjustments (Supplementary Table 2). Gag-, Pol-, and Env-specific effector memory CD8+ T lymphocyte responses exhibited trends towards protection against acquisition but did not achieve statistical significance according to our pre-specified criteria. In contrast, multiple humoral and cellular immune responses were significantly correlated with virologic control (Supplementary Table 3), including Env ELISA, NAb, and ADCC responses as well as Gag ELISPOT magnitude and breadth, Pol ELISPOT magnitude, and EnvCD4+ effector memory responses. These data suggest a model in which protection against acquisition of infection is correlated with vaccine-elicited Env-specific antibody responses, whereas virologic control may be correlated with both T lymphocyte and antibody responses. These distinct immunologic correlates likely reflect fundamentally different biologic requirements for blocking establishment of infection at the mucosal site of inoculation compared with controlling viral replication after infection has become disseminated[19]. However, the actual mechanisms of protection remain to be determined.We next evaluated directly the hypothesis that Env was critical for blocking acquisition of infection in this system. In the second study, 40 rhesus monkeys that did not express the class I alleles Mamu-A*01, Mamu-B*08, and Mamu-B*17 were immunized by the intramuscular route with Ad35 prime[20], Ad26 boost[21] vaccine regimens expressing (i) SIVsmE543 Gag-Pol (N=16); (ii) SIVsmE543 Gag-Pol and Env (N=16); and (iii) sham controls (N=8). Groups were balanced for susceptible and resistant TRIM5α alleles[1,14]. Monkeys were primed once at week 0 with 2×1010 vp Ad35 vectors and boosted once at week 24 with 2×1010 vp Ad26 vectors. Cellular immune responses were assessed by IFN-γ ELISPOT assays (Fig. 3a, Supplementary Fig. 7) and multiparameter ICS assays in both the periphery (Fig. 3b, Supplementary Fig. 8) and in colorectal mucosa (Supplementary Fig. 9). Env-specific humoral immune responses were assessed by ELISAs in both the periphery (Fig. 3c) and in colorectal mucosa (Supplementary Fig. 10), tier 1 NAb assays (Fig. 3d), and ADCC assays (Supplementary Fig. 11). Only marginal tier 2 NAb responses were observed (Supplementary Fig. 11).
Figure 3
Immunogenicity and protective efficacy of the adenovirus/adenovirus vaccines
a, Cellular immune responses to SIVsmE543 and SIVmac239 Gag, Pol, and Env as determined by IFN-γ ELISPOT assays at weeks 0, 4, 24, 28, and 52. b, CD8+ and CD4+ total, central/transitional memory (CM; CD28+CD95+), and effector memory (EM; CD28-CD95+) responses to Gag, Pol, and Env as determined by multiparameter IFN-γ ICS assays at week 28. c, SIVmac251 Env ELISAs at weeks 0, 4, 24, 28, and 52. d, SIVsmE660 and SIVmac251 tier 1 pseudovirus NAb assays at weeks 0, 28, and 52. Error bars reflect s.e.m. e, Number of challenges required for acquisition of infection in each vaccine group. f, Statistical analyses include the number of challenges required for 50% infection, hazard ratios with 95% confidence intervals (CI), per-exposure vaccine efficacy (VE), and per-exposure risks of infection in each group. P-values reflect Wald tests using a proportional hazard model. g, Log SIV RNA copies/ml are depicted for each vaccine group at viral setpoint (day 84). ** P<0.001, Wilcoxon rank-sum tests. The horizontal lines reflect mean setpoint log viral loads.
We assessed protective efficacy of these vaccine regimens against repetitive, heterologous, intrarectal SIVmac251 challenges as described in the first study. After the first challenge, 50% of sham control monkeys became infected, as compared with only 12% of the animals that received the Gag-Pol-Env vaccine (Fig. 3e). The monkeys that received the Gag-Pol-Env vaccine required 4 challenges to infect 50% of animals in each group, whereas only 1 challenge was required to infect 50% of animals in the control group (Fig. 3f; P=0.002, Wald test, proportional hazard model). Moreover, the Gag-Pol-Env vaccine resulted in a decreased hazard ratio of 0.20 (CI 0.07–0.55), corresponding to an 80% reduction in the per-exposure probability of infection. In contrast, the Gag-Pol vaccine afforded only a marginal protective effect, demonstrating the critical role of Env in blocking acquisition of infection in this model. The Gag-Pol and Gag-Pol-Env vaccines resulted in, respectively, at least 1.59 log and 2.18 log reductions of setpoint viral loads as compared with controls (Fig. 3g, Supplementary Fig. 12; P=0.0006 and 0.0002, respectively, Wilcoxon rank-sum tests). Immunologic correlates of protection against acquisition of infection were consistent with the first study, and both peripheral (Fig. 4a–c) and rectal (Fig. 4d) Env-specific IgG correlated with reduced acquisition risk.
Figure 4
Correlates of protection against acquisition of infection with the adenovirus/adenovirus vaccines
Correlation of (a) log ELISA titers immediately prior to challenge, (b) log tier 1 NAb titers immediately prior to challenge, (c) V2-specific antibody responses, and (d) rectal IgG antibody responses with the number of challenges required to establish infection. Correlates analyses included the 16 Gag-Pol-Env vaccinated monkeys and did not include the Gag-Pol vaccinated monkeys or the sham controls. P-values reflect Spearman rank-correlation tests.
Taken together, these data demonstrate that optimized adenovirus/poxvirus and adenovirus/adenovirus vector-based vaccines afforded significant protection against acquisition of infection following highly pathogenic, heterologous, neutralization-resistant SIVmac251 challenges in rhesus monkeys (Fig. 1e, 3e, Supplementary Fig. 13). Although several studies have previously shown partial protection against acquisition of neutralization-sensitive virus challenges[1-3], no HIV-1 vaccine candidate has to date blocked acquisition of heterologous, difficult-to-neutralize virus challenges, including Ad5[7], DNA/Ad5[1], and CMV[8] vaccines. In particular, a recent study demonstrated that a DNA/Ad5 vaccine afforded partial protection against acquisition of SIVsmE660, which is a neutralization-sensitive tier 1A virus in TZM-bl neutralization assays, but the same vaccine afforded no efficacy against neutralization-resistant SIVmac251[1], highlighting important differences in the stringencies between these two SIV challenge models as well as potentially important phenotypic differences between Ad serotypes[17]. However, we note that the acquisition effect in the present study was relative rather than absolute and that the majority of vaccinees became infected by the end of the challenge protocol.Our studies also demonstrate that inclusion of Env in the vaccine was required for the acquisition effect (Fig. 3e), despite an 18% difference in the amino acid sequences between the vaccine strain and challenge virus. Moreover, our immunologic correlates analyses (Fig. 2, 4; Supplementary Tables 1–3) suggest that Env-specific antibodies may be critical for blocking acquisition of infection, whereas multiple cellular and humoral immune responses may correlate with virologic control, although the actual mechanisms of protection remain to be determined. In addition, the RV144 immunologic correlates analyses raised the hypothesis that vaccine-elicited V1/V2-specific antibodies may reduce HIV-1 acquisition risk in humans[22]. Our data (Fig. 2f, 4c) are consistent with this hypothesis, although it remains unclear whether V2-specific antibodies actually protect or simply represent a marker for other Env-specific antibodies or other protective factors.Considerable efforts are currently underway to identify and to reverse engineer potent, broadly reactive monoclonal antibodies[23,24]. Although the induction of such NAb responses by a vaccine would be highly desirable, no Env immunogens have to date been developed that can elicit these responses. Our findings suggest that a substantial degree of protection can be achieved against stringent virus challenges even in the absence of high titers of tier 2 NAbs, perhaps reflecting the importance of antibody effector functions that may not be fully measured by traditional virus neutralization assays. Of note, the partial protection in the present study was observed with vectored Env and without a purified Env protein subunit boost. The degree to which an Env protein boost may further improve the protective efficacy afforded by these vaccine regimens remains to be determined.In summary, our data demonstrate the first proof-of-concept that vaccination can protect against acquisition of stringent, heterologous, neutralization-resistant SIVmac251 challenges in rhesus monkeys. These findings, together with the observations of a critical requirement for Env and the distinct immunologic correlates of protection against acquisition of infection and virologic control, pave novel paths forward for HIV-1 vaccine development.
Methods Summary
For each study, 40 Indian-origin rhesus monkeys (Macaca mulatta) were vaccinated with DNA, MVA[25], Ad26[21], or Ad35[20] expressing SIVsmE543 Gag-Pol and/or Env antigens or received a sham vaccine. Cellular immune responses were measured by IFN-γ ELISPOT[18], multiparameter intracellular cytokine staining (ICS)[8,15-17], and epitope mapping[26] assays. Humoral immune responses were measured by Env ELISA[27], TZM-bl pseudovirus neutralizing antibody (NAb)[28], antibody-dependent cellular cytotoxicity (ADCC)[29], and antibody-dependent cell-mediated virus inhibition (ADCVI)[30] assays. Six months following the boost immunization, all monkeys received six challenges by the intrarectal route with the fully heterologous, neutralization-resistant virus SIVmac251 utilizing a 1:1000 dilution (930 TCID50) of the challenge stock[9]. Protective efficacy was determined by resistance to acquisition of infection, defined as the number of challenges required to establish infection, and virologic control, defined as setpoint viral loads. Immunologic correlates of protection against acquisition of infection and virologic control were evaluated by pre-specified primary and exploratory analyses.
Methods
Animals, immunizations, and challenges
80 Indian-origin, outbred, young adult, male and female, specific pathogen-free (SPF) rhesus monkeys (Macaca mulatta) that did not express the class I alleles Mamu-A*01, Mamu-B*08, and Mamu-B*17 associated with spontaneous virologic control[11-13] were housed at New England Primate Research Center (NEPRC), Southborough, MA. 40 animals were utilized for each study. Groups were balanced for susceptible and resistant TRIM5α alleles[1,14]. Immunizations were performed by the intramuscular route in the quadriceps muscles with 2×1010 vp Ad35 vectors[20], 2×1010 vp Ad26 vectors[21], 108 pfu MVA vectors[25], or 5 mg DNA vaccines expressing SIVsmE543 Gag-Pol and/or Env gp140. Monkeys were primed at week 0 and boosted at week 24, except DNA vaccine priming that was performed at weeks 0, 4, and 8. To evaluate for protective efficacy and immunologic correlates, all monkeys were challenged repetitively beginning at week 52 with six intrarectal inoculations of the heterologous virus SIVmac251 utilizing a 1:1000 dilution (930 TCID50) of our challenge stock[9]. Monkeys were bled weekly for viral loads (Siemans Diagnostics), and the date of infection was defined as the last challenge timepoint prior to the first positive SIV RNA level. Animals were followed to determine setpoint viral loads. All animal studies were approved by the Harvard Medical School Institutional Animal Care and Use Committee (IACUC).
Cellular immune assays
SIV-specific cellular immune responses were assessed by IFN-γ ELISPOT assays[18] and multiparameter intracellular cytokine staining (ICS) assays[8,15-17] essentially as described. ELISPOT assays utilized pools of SIVsmE543 and SIVmac239Gag, Pol, and Env peptides. Analyses of cellular immune breadth utilized subpools of 10 peptides covering each antigen. Peptides were 15 amino acids in length and overlapped by 11 amino acids. 9-color ICS assays utilized mAbs (Becton-Dickinson) against CD3 (SP34; Alexa700), CD4 (L200; AmCyan), CD8 (SK1; allophycocyanin-cyanine7 [APC-Cy7]), CD28 (L293; peridinin chlorophyll-Acyanine5.5 [PerCP-Cy5.5]), CD95 (DX2; phycoerythrin [PE]), CD69 (TP1.55.3; phycoerythrin-Texas Red [energy coupled dye; ECD]; Beckman Coulter), IFN-γ (B27; phycoerythrin-cyanine7 [PE-Cy7]), IL-2 (MQ1-17H12; allophycocyanin [APC]) and TNF-α (Mab11; fluorescein isothiocya [FITC]). IFN-γ backgrounds were consistently <0.01% in PBMC and <0.05% in colorectal biopsy specimens.
Humoral immune assays
SIV-specific humoral immune responses were assessed by SIVmac251 Env ELISAs[27], TZM-bl luciferase-based virus neutralization assays[28] against tier 1 SIVsmE660 (CP3C-P-A8) and SIVmac251 (TCLA) pseudoviruses, TZM-bl virus neutralization assays against tier 2 SIVsmE660 (CR54-PK-2A5) and SIVmac251 (SIVmac251.30) pseudoviruses, antibody-dependent cellular cytotoxicity (ADCC) assays[29], and antibody-dependent cell-mediated virus inhibition (ADCVI) assays[30]. V2 binding assays were performed by surface plasmon resonance with a Biacore 2000 or T200 using a 1:50 serum dilution and a cyclic SIVsmE543 V2 peptide containing an N-terminal biotin tag (CIKNNSCAGLEQEPMIGCKFNMTGLKRDKKIEYNETWYSRDLICEQPANGSESKCY) and immobilized on streptavidin-coated CM5 chips. Mucosal antibodies were assessed using rectal secretions collected with Weck-Cel sponges. Approximately 100 ul rectal secretions were eluted and diluted 6-fold, and total IgG and IgA as well as SIVEnv-specific IgG and IgA (Immune Technology Corporation) were measured by ELISA using a biotin-conjugated anti-monkey IgG and IgA (Alpha Diagnostics) secondary antibody. Mucosal titers were defined as endpoint ELISA titers multiplied by the dilution of the eluted secretions. Samples exhibited comparable levels of total IgG.
Statistical analyses and immunologic correlates
Protection against acquisition of infection was analyzed using Wald tests with a proportional hazard model and the exact conditional likelihood method for breaking ties. A discrete time model provided similar estimates. The number of challenges required for 50% infection of each group, hazard ratios with 95% confidence intervals (CI), per-exposure vaccine efficacy (VE), and per-exposure risks of infection were quantitated. VE was defined as the reduction in the per-exposure probability of infection as previously described[4,5]. Analyses of virologic and immunologic data were performed by Wilcoxon rank-sum tests and analysis of survival by log-rank tests. For these tests, P<0.05 was considered significant, and two-tailed tests were performed. Immunologic correlates were evaluated by a focused primary analysis and a detailed exploratory analysis using Spearman rank-correlation tests. In the primary analysis, P<0.01 was considered significant, whereas in the exploratory analysis, P<0.0014 was considered significant to adjust for multiple comparisons.
Authors: Ronald Vogels; David Zuijdgeest; Richard van Rijnsoever; Eric Hartkoorn; Irma Damen; Marie-Pierre de Béthune; Stefan Kostense; Germaine Penders; Niels Helmus; Wouter Koudstaal; Marco Cecchini; Antoinette Wetterwald; Mieke Sprangers; Angelique Lemckert; Olga Ophorst; Björn Koel; Michelle van Meerendonk; Paul Quax; Laura Panitti; Jos Grimbergen; Abraham Bout; Jaap Goudsmit; Menzo Havenga Journal: J Virol Date: 2003-08 Impact factor: 5.103
Authors: Levi J Yant; Thomas C Friedrich; Randall C Johnson; Gemma E May; Nicholas J Maness; Alissa M Enz; Jeffrey D Lifson; David H O'Connor; Mary Carrington; David I Watkins Journal: J Virol Date: 2006-05 Impact factor: 5.103
Authors: Christine J Pitcher; Shoko I Hagen; Joshua M Walker; Richard Lum; Bridget L Mitchell; Vernon C Maino; Michael K Axthelm; Louis J Picker Journal: J Immunol Date: 2002-01-01 Impact factor: 5.422
Authors: Nancy A Wilson; Jason Reed; Gnankang S Napoe; Shari Piaskowski; Andy Szymanski; Jessica Furlott; Edna J Gonzalez; Levi J Yant; Nicholas J Maness; Gemma E May; Taeko Soma; Matthew R Reynolds; Eva Rakasz; Richard Rudersdorf; Adrian B McDermott; David H O'Connor; Thomas C Friedrich; David B Allison; Amit Patki; Louis J Picker; Dennis R Burton; Jing Lin; Lingyi Huang; Deepa Patel; Gwendolyn Heindecker; Jiang Fan; Michael Citron; Melanie Horton; Fubao Wang; Xiaoping Liang; John W Shiver; Danilo R Casimiro; David I Watkins Journal: J Virol Date: 2006-06 Impact factor: 5.103
Authors: I Ourmanov; C R Brown; B Moss; M Carroll; L Wyatt; L Pletneva; S Goldstein; D Venzon; V M Hirsch Journal: J Virol Date: 2000-03 Impact factor: 5.103
Authors: Peter Abbink; Angelique A C Lemckert; Bonnie A Ewald; Diana M Lynch; Matthew Denholtz; Shirley Smits; Lennart Holterman; Irma Damen; Ronald Vogels; Anna R Thorner; Kara L O'Brien; Angela Carville; Keith G Mansfield; Jaap Goudsmit; Menzo J E Havenga; Dan H Barouch Journal: J Virol Date: 2007-02-28 Impact factor: 5.103
Authors: Guido Ferrari; Justin Pollara; Daniel Kozink; Tiara Harms; Mark Drinker; Stephanie Freel; M Anthony Moody; S Munir Alam; Georgia D Tomaras; Christina Ochsenbauer; John C Kappes; George M Shaw; James A Hoxie; James E Robinson; Barton F Haynes Journal: J Virol Date: 2011-05-04 Impact factor: 5.103
Authors: Bianca R Mothé; Jason Weinfurter; Chenxi Wang; William Rehrauer; Nancy Wilson; Todd M Allen; David B Allison; David I Watkins Journal: J Virol Date: 2003-02 Impact factor: 5.103
Authors: John T Loffredo; Jess Maxwell; Ying Qi; Chrystal E Glidden; Gretta J Borchardt; Taeko Soma; Alex T Bean; Dominic R Beal; Nancy A Wilson; William M Rehrauer; Jeffrey D Lifson; Mary Carrington; David I Watkins Journal: J Virol Date: 2007-05-30 Impact factor: 5.103
Authors: Shari N Gordon; Melvin N Doster; Rhonda C Kines; Brandon F Keele; Egidio Brocca-Cofano; Yongjun Guan; Poonam Pegu; Namal P M Liyanage; Monica Vaccari; Nicolas Cuburu; Christopher B Buck; Guido Ferrari; David Montefiori; Michael Piatak; Jeffrey D Lifson; Anastasia M Xenophontos; David Venzon; Marjorie Robert-Guroff; Barney S Graham; Douglas R Lowy; John T Schiller; Genoveffa Franchini Journal: J Immunol Date: 2014-11-14 Impact factor: 5.422
Authors: James M Kovacs; Joseph P Nkolola; Hanqin Peng; Ann Cheung; James Perry; Caroline A Miller; Michael S Seaman; Dan H Barouch; Bing Chen Journal: Proc Natl Acad Sci U S A Date: 2012-07-05 Impact factor: 11.205
Authors: Nicos Karasavvas; Erik Billings; Mangala Rao; Constance Williams; Susan Zolla-Pazner; Robert T Bailer; Richard A Koup; Sirinan Madnote; Duangnapa Arworn; Xiaoying Shen; Georgia D Tomaras; Jeffrey R Currier; Mike Jiang; Craig Magaret; Charla Andrews; Raphael Gottardo; Peter Gilbert; Timothy J Cardozo; Supachai Rerks-Ngarm; Sorachai Nitayaphan; Punnee Pitisuttithum; Jaranit Kaewkungwal; Robert Paris; Kelli Greene; Hongmei Gao; Sanjay Gurunathan; Jim Tartaglia; Faruk Sinangil; Bette T Korber; David C Montefiori; John R Mascola; Merlin L Robb; Barton F Haynes; Viseth Ngauy; Nelson L Michael; Jerome H Kim; Mark S de Souza Journal: AIDS Res Hum Retroviruses Date: 2012-10-04 Impact factor: 2.205
Authors: Eung-Jun Im; Erica N Borducchi; Nicholas M Provine; Anna G McNally; Sufen Li; Fred R Frankel; Dan H Barouch Journal: J Virol Date: 2013-02-06 Impact factor: 5.103
Authors: Franco Pissani; Delphine C Malherbe; Jason T Schuman; Harlan Robins; Byung S Park; Shelly J Krebs; Susan W Barnett; Nancy L Haigwood Journal: Vaccine Date: 2013-11-23 Impact factor: 3.641
Authors: Nicholas M Provine; Rafael A Larocca; Pablo Penaloza-MacMaster; Erica N Borducchi; Anna McNally; Lily R Parenteau; David R Kaufman; Dan H Barouch Journal: J Immunol Date: 2014-04-28 Impact factor: 5.422
Authors: So-Yon Lim; Christa E Osuna; Peter T Hraber; Joe Hesselgesser; Jeffrey M Gerold; Tiffany L Barnes; Srisowmya Sanisetty; Michael S Seaman; Mark G Lewis; Romas Geleziunas; Michael D Miller; Tomas Cihlar; William A Lee; Alison L Hill; James B Whitney Journal: Sci Transl Med Date: 2018-05-02 Impact factor: 17.956
Authors: Monica Vaccari; Rabih Halwani; L Jean Patterson; Adriano Boasso; Jennifer Beal; Elzbieta Tryniszewska; Anna Hryniewicz; David Venzon; Elias K Haddad; Mohamed El-Far; Margherita Rosati; George N Pavlakis; Barbara K Felber; Saleh Al-Muhsen; Marjorie Robert-Guroff; Rafick-Pierre Sekaly; Genoveffa Franchini Journal: J Virol Date: 2013-01-16 Impact factor: 5.103
Authors: Monica Vaccari; Brandon F Keele; Steven E Bosinger; Melvin N Doster; Zhong-Min Ma; Justin Pollara; Anna Hryniewicz; Guido Ferrari; Yongjun Guan; Donald N Forthal; David Venzon; Claudio Fenizia; Tia Morgan; David Montefiori; Jeffrey D Lifson; Chris J Miller; Guido Silvestri; Margherita Rosati; Barbara K Felber; George N Pavlakis; James Tartaglia; Genoveffa Franchini Journal: J Virol Date: 2013-01-16 Impact factor: 5.103