Literature DB >> 21573234

Bacterial transmembrane proteins that lack N-terminal signal sequences.

Arryn Craney1, Kapil Tahlan, David Andrews, Justin Nodwell.   

Abstract

Tail-anchored membrane proteins (TAMPs), a class of proteins characterized by their lack of N-terminal signal sequence and Sec-independent membrane targeting, play critical roles in apoptosis, vesicle trafficking and other vital processes in eukaryotic organisms. Until recently, this class of membrane proteins has been unknown in bacteria. Here we present the results of bioinformatic analysis revealing proteins that are superficially similar to eukaryotic TAMPs in the bacterium Streptomyces coelicolor. We demonstrate that at least four of these proteins are bona fide membrane-spanning proteins capable of targeting to the membrane in the absence of their N-terminus and the C-terminal membrane-spanning domain is sufficient for membrane targeting. Several of these proteins, including a serine/threonine kinase and the SecE component of the Sec translocon, are widely conserved in bacteria.

Entities:  

Mesh:

Substances:

Year:  2011        PMID: 21573234      PMCID: PMC3087755          DOI: 10.1371/journal.pone.0019421

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Protein translocation into and across the lipid bilayer is an essential process in all kingdoms of life. Most proteins are inserted into the membrane by the well-conserved Sec pathway, consisting of a membrane-spanning translocase SecYEG in bacteria and Sec61 in eukaryotes. Many accessory proteins aid in protein targeting and insertion, including in particular the signal recognition particle (SRP), and its cognate membrane receptor [1], [2]. To be targeted to the membrane via the Sec system, a protein must have an N-terminal signal sequence for recognition by the SRP. Signal sequences are typically 20–30 amino acids long and consist of an N-terminal domain with one or more positively charged amino acids, followed by an H-domain of 8–12 hydrophobic residues and, for proteins that are secreted, a C-domain recognition site for peptide cleavage [3]. During co-translational targeting the signal sequence is recognized and bound by the SRP as the N-terminus of the nascent polypeptide emerges from the ribosome. The ribosome/nascent peptide are then brought to the membrane for insertion through an interaction with the SRP receptor FtsY [4] and transferred to the SecYEG translocon for insertion [5]. (For reviews of Sec translocation see [3], [6], [7], [8], [9], [10]. While the majority of membrane proteins are targeted to the membrane via Signal sequence/Sec translocon-dependent mechanisms, another system has been identified in eukaryotes for targeting tail anchor membrane proteins (TAMPs) [11], [12]. Eukaryote TAMPs carry out a wide range of biological functions, many of which involve membranes. Examples include the Bcl-2 protein, a major player in the apoptosis pathway, the SNARE proteins which are involved in vesicle targeting and fusion, and the Sec61β protein, which is a component of the eukaryotic Sec translocon [13], [14]. Bcl-2, the SNAREs and Sec61β all lack the N-terminal signal sequence required for SRP-targeting and are instead targeted to the membrane via a single C-terminal transmembrane domain, the tail anchor. All of the TAMPs that have been investigated biochemically to date are found in eukaryotes. Recently however, a bioinformatic approach was used to demonstrate the existence of TAMP-like proteins in the Gram-negative bacteria Escherichia coli and Rickettsia prowazekii as well as the archeon Methanococcus maripaludis [15]. This work suggests that in fact, tail-anchored membrane proteins are universal and that they make up similar proportions of all proteomes [15]. Our work adds to this, providing experimental evidence of these bacterial tail anchor membrane proteins. We have taken advantage of a newly developed algorithm, TAMP finder (Brito et al., Manuscript in Preparation) to identify membrane-proteins encoded in the Gram-positive bacterium Streptomyces coelicolor. Similarly, we find a large number of proteins that are superficially similar to the eukaryotic TAMPs in that they lack signal sequences and contain single C-terminally located transmembrane domains. We have used several biochemical approaches to test these predictions and find that indeed, many of these proteins are transmembrane proteins and that the tail sequences are sufficient for membrane targeting. These include important proteins including the SecE component of the translocon and members of the bacterial serine/threonine (ser/thr) protein kinase family.

Results

Putative membrane proteins lacking signal sequences and exhibiting broad conservation in prokaryotes

A genome-wide search using the “TAMP finder” program (Brito et al., Manuscript in Preparation) identified 73 putative tail-anchor membrane proteins (TAMPs) in Streptomyces coelicolor. This program was designed to identify TAMPs encoded in eukaryotic genomes by seeking polypeptide sequences having the known TAMP properties. These include a putative C-terminally located transmembrane domain, the tail anchor, and the absence of an obvious N-terminal signal sequence. To further test these candidates, we analyzed each of them individually using the transmembrane prediction program TMHMM [16]. We restricted subsequent analysis to those proteins having one or, in a few cases two, strongly-predicted transmembrane domains near the C-terminus. We then used SignalP, a program that predicts SRP signal sequences, and visual inspection to further confirm that these proteins lack candidate N-terminal signal sequences [17]. 20 of the 73 predicted polypeptides identified by TAMP finder met both criteria (Table 1 and Figure 1). During this analysis, careful consideration was taken in scanning the upstream regions of the predicted translational start site to ensure proteins were not mis-annotated. Those with mis-annotated start sites that contained N-terminal signal sequences were removed from the analysis.
Table 1

Highest Confidence S. coelicolor Tail Anchor Membrane Proteins.

ProteinSize(aa)Proposed FunctionN-terminusTail AnchorHomologues
SCO1166 110 hypothetical out AAGLILLIWLPWWAALLIVLGVPAAAYLTLDPSQRRRLRRVSRKEIGR streptomycete
SCO1431 80 hypothetical Out PKILEHVLGWTLVVVVAMLVVQLGLL streptomycete
SCO2124 * 205 hypothetical In WLTTLSIGGFLGGFATLVVRMRTGDEDDDDPGRGAVV actinomycete
SCO2199 89 hypothetical Out VGSRRRSSWVSTVVVLGCVAAVIVLLGYLNFRAPY streptomycete
SCO2900 110 hypothetical out TGAPRMERVVPVALVVAGVVGLLALGGTRRRKR actinomycete
SCO2973 417 Ser/Thr Kinase (PkaB) In RRRRIAVGAGAVALVAAIGVGTWLATGGDEDGGGPQDTRNSAPAAP actinomycete
SCO3544 * 132 hypothetical In PVALGVSPVASATVASVAAVVALGLGAWCLTQV actinomycete
SCO3860 576 Ser/Thr Kinase In RRRRRPGPPARVALPVLLLALACYAVGFWALTRI streptomycete
SCO4008 192 TetR-like In APDLLFLLVAMANWAVVVPQMKRILVGGGDAGTDGLRDSIKKAARRIVDR actinomycete
SCO4033 96 hypothetical In AASSGPRVGLIVGIVAAVIVVAAVAWLALG streptomycete
SCO4174 83 hypothetical In HKARSRRRAGLDGATVSGLLTVLCVATLLVTITFAV S. lividans
SCO4646 94 SecE In SRNQLTTYTTVVIIFVVIMIGLVTLIDYGFSHAAKYVFG Most bacteria
SCO4959 85 hypothetical In TAARRLMWLLLGAAAVAFTVWALTVQPWVEPPSETTPPVTGWEGWS streptomycete
SCO5157 * 317 CorA In DYMPETHWKFGYPLVLSVTVCICLGIHRTLKRNGWL Most bacteria
SCO5344 * 107 SpdD2 In GGGTAVVLVVGAVLVSMLLAVAITAASVAVCAVVLRSLLASDAKRR streptomycete
SCO6904 336 hypothetical Out GADATLWLIGGAAVLIAAGGGALAVARRSRTDSHTQDNTGS streptomycete
SCO7096 114 hypothetical In RRYARLRRMSRVALAVLAATVMVLLVALVLVAAG streptomycete
SCO7133 113 hypothetical In RGTMIAMTAIGLTIFVCTAVVVGSMT streptomycete
SCO7199 131 hypothetical In RRLGRILAGAAALAVLLGLFTCLPEEPPGLPTGPEDTSPPRTSSAVVES streptomycete
SCO7330 78 hypothetical Out GWAKGPMALILAVVVIFAVGLLGYALALIY actinomycete

*denotes 2 predicted transmembrane domains at the C-terminus.

Figure 1

Putative bacterial membrane proteins lacking N-terminal Signal Sequences.

(A) The N-terminal sequences of five strongly predicted S. coelicolor transmembrane proteins (FtsY, SCO0041, SCO1101, SCO1374 and SCO2176) are shown, illustrating their high hydrophobicity and correspondingly low hydrophilicity. Hydrophobic residues are shaded grey. Double arginine residues are bolded. (B) The N-terminal sequences of the S. coelicolor cytoplasmic protein (ActR) and (C) 20 predicted tail anchor membrane proteins lacking obvious signal sequences are shown to illustrate their highly hydrophilic N-terminus.

Putative bacterial membrane proteins lacking N-terminal Signal Sequences.

(A) The N-terminal sequences of five strongly predicted S. coelicolor transmembrane proteins (FtsY, SCO0041, SCO1101, SCO1374 and SCO2176) are shown, illustrating their high hydrophobicity and correspondingly low hydrophilicity. Hydrophobic residues are shaded grey. Double arginine residues are bolded. (B) The N-terminal sequences of the S. coelicolor cytoplasmic protein (ActR) and (C) 20 predicted tail anchor membrane proteins lacking obvious signal sequences are shown to illustrate their highly hydrophilic N-terminus. *denotes 2 predicted transmembrane domains at the C-terminus. Putative signal sequences at the N-termini of the S. coelicolor FtsY and four other proteins annotated as membrane proteins are shown in Figure 1. All have stretches of 8–10 hydrophobic residues: these are the predicted binding sites of the SRP [3]. In contrast, the known cytoplasmic protein ActR has a hydrophilic N-terminus. Similarly, the 20 candidates listed below ActR, with the exception of SCO6904, also have largely hydrophilic N-termini (Figure 1). These proteins therefore lack obvious N-terminal signal sequences. The ‘twin-arginine repeat’ or TAT pathway is involved in the secretion of folded proteins and has not been implicated in membrane insertion [18]. We note however that these candidates also lack the characteristic Z-R-R-ϕ-X-X (where Z is a polar residues, X-X are hydrophobic residues and ϕ is any residue) although SCO4033 has two arginines embedded in the N-terminal sequence APRTWAALA. It is unlikely that this could serve as a target for TAT-mediated secretion. The 20 candidates in Table 1 represent a wide range of important biological functions. These include a conspicuous number of hypothetical membrane proteins of less than 100 amino acids (SCO1431, SCO2199, SCO4033, SCO4174, SCO4959 and SCO7330), two serine/threonine protein kinases (SCO2973 and SCO3860), the SecE component of the Sec translocon (SCO4646) proposed to be a tail-anchored membrane protein in many organisms, including Archea [15], a CorA-like Mg2+ transporter (SCO5157) [19] and the SpdD2 protein believed to be involved in transfer of plasmid DNA in streptomycetes (SCO5344) [20], [21]. Many of these proteins are highly conserved in the actinomycetes and two are conserved generally in prokaryotes [15], [19] (Table 1). While, the majority of these proteins are predicted to have a topology with the N-terminus facing into the cell, several are predicted to have their N-termini projecting out of the cell (Table 1). While a large number of these proteins are small hypothetical proteins, we are confident that these represent expressed genes rather than artefacts of genome annotation. Only membrane proteins conserved in multiple streptomycetes and possible having orthologues in other actinomycetes were included in our analysis. For example, SCO2900 is predicted to encode a 110 residue polypeptide that is conserved within the Streptomycetes and related Actinomycetes (Figure 2a). Conserved features of this protein include 3 absolutely conserved residues (P29 R34 P37 with respect to the S. coelicolor protein sequence) and the C-terminal transmembrane domain followed by a small stretch of 4 positively charged residues, suggesting an N-terminus “out” orientation. Sequences from related Actinomycetes were found to contain an approximately 30 residue deletion upstream of the predicted tail anchor and there is a small C-terminal extension in Corynebacterium proteins. SCO7133-like proteins were found in some Streptomycetes, and in no other genera (Figure 2b). Although a C-terminal transmembrane domain is consistently predicted among SCO7133 paralogues, the amino acid identity in this domain is low. Four positively charged residues are located directly upstream of the transmembrane domain, suggesting the N-terminus of this protein is facing into the cell. This predicted topology was shared among the SCO7133-like paralogues. The large N-terminal extension predicted in S. lividans TK24 is most likely mis-identification of the start site; regardless, this extended region does not contain an N-terminal signal sequence.
Figure 2

Alignments of predicted tail-anchor membrane proteins.

(A) SCO2900 from S. coelicolor aligned with various orthologues from other streptomycetes and actinomycetes (B) SCO7133 from S. coelicolor aligned with various orthologues from other streptomycetes. The S. lividans extended leader sequence is MGRHRPREDRRPTGTAPTAAPRH. Absolutely conserved residues are shaded black and marked with *, similar residues are shaded grey. Possible topology predicting residues are marked with+and the C-terminal transmembrane domains are boxed and shaded grey.

Alignments of predicted tail-anchor membrane proteins.

(A) SCO2900 from S. coelicolor aligned with various orthologues from other streptomycetes and actinomycetes (B) SCO7133 from S. coelicolor aligned with various orthologues from other streptomycetes. The S. lividans extended leader sequence is MGRHRPREDRRPTGTAPTAAPRH. Absolutely conserved residues are shaded black and marked with *, similar residues are shaded grey. Possible topology predicting residues are marked with+and the C-terminal transmembrane domains are boxed and shaded grey.

Four integral membrane proteins

We chose 5 of the candidates in Table 1 to test the prediction that they are integral membrane proteins: two small hypothetical proteins (SCO2900 and SCO7133), the ser/thr kinase PkaB (SCO2973), SecE (SCO4646) and a predicted TetR-like transcription factor (SCO4008). The known cytoplasmic protein ActR served as a control. All six proteins were expressed in S. coelicolor under the thiostrepton-inducible promoter tipA such that they had an N-terminal FLAG-tag for visualization by Western analysis. Protoplasts of cells expressing these proteins were isolated from lysozyme-treated cells. The protoplasts were subsequently lysed, fractionated by ultracentrifugation and the pellets and supernatants analyzed by Western analysis with anti-FLAG antibodies. As expected, ActR was found exclusively in the supernatant (Figure 3a). Similarly, in spite of having a predicted transmembrane domain, SCO4008 was found exclusively in the supernatant, consistent with its probable role as a DNA binding transcription factor. The other four proteins were contained exclusively in the pellets.
Figure 3

Membrane-association of five candidates.

(A) Cells were fractionated into pellet (P) and supernatant (S) fractions and Western blot analysis directed against the FLAG epitope was used to determine the localization of the putative membrane proteins SCO2900, SCO2973, SCO4008, SCO4646 and SCO7133. ActR was used as a cytoplasmic control. (B) The pellets from (A) were subjected to sucrose gradient ultracentrifugation and 1 ml fractions were collected with fraction 1 corresponding to the highest density and fraction 10 the lowest. Fractions 2 to 4 (underlined) correspond to sedimentation profiles of known membrane proteins. (C) Carbonate extraction of TAMP proteins. Cell lysate was mixed with either sucrose (−) or carbonate (+) and separated into pellet (P) and supernatant (S) fractions. Fractions were subjected to Western blot analysis. The peripheral membrane protein RamC was used as a control.

Membrane-association of five candidates.

(A) Cells were fractionated into pellet (P) and supernatant (S) fractions and Western blot analysis directed against the FLAG epitope was used to determine the localization of the putative membrane proteins SCO2900, SCO2973, SCO4008, SCO4646 and SCO7133. ActR was used as a cytoplasmic control. (B) The pellets from (A) were subjected to sucrose gradient ultracentrifugation and 1 ml fractions were collected with fraction 1 corresponding to the highest density and fraction 10 the lowest. Fractions 2 to 4 (underlined) correspond to sedimentation profiles of known membrane proteins. (C) Carbonate extraction of TAMP proteins. Cell lysate was mixed with either sucrose (−) or carbonate (+) and separated into pellet (P) and supernatant (S) fractions. Fractions were subjected to Western blot analysis. The peripheral membrane protein RamC was used as a control. To determine whether the pellet-associated proteins SCO2900, PkaB, SecE or SCO7133 were membrane-associated, the pellets from this centrifugation step were subjected to sucrose gradient ultracentrifugation. To locate the membrane fractions we used antibodies against the known Sec-dependent transmembrane protein, SecG for Western analysis. Consistent with previous analysis of membrane-proteins using this procedure SecG was found primarily in the 2nd and 3rd fractions (Figure 3b) [22]. Consistent with membrane association, SCO2900, SCO2973 (PkaB), SCO4646 (SecE), and SCO7133 were also found predominantly in fraction 2 and 3. None were found in the pellet (Figure 3b) as would be the case if these proteins were simply insoluble hydrophobic inclusions. Extraction of the membranes at pH 11.4 using sodium carbonate was then used to distinguish between proteins that were peripherally or integrally associated with the membrane [23]. Cells expressing the four candidates demonstrated above to be membrane-associated (Figure 3a and b) were converted to protoplasts, lysed, subjected to carbonate extraction and then fractionated into membrane-containing (P) and cytosolic (S) fractions. As shown in Figure 2c, SCO2900, SCO2973 (PkaB) and SCO4646 (SecE) remained entirely in the membrane-containing fraction. Some SCO7133, possibly 30% of the total, was found in the supernatant fractions in this particular experiment. We suspect that this is a result of prolonged induction of the tipA promoter that drives expression of the fusion. Importantly, only a very modest amount of protein was moved from the pellet to the supernatant after carbonate extraction. In contrast, the protein RamC, which we have shown previously to be membrane-associated via interactions with other proteins [24], was almost completely separated from the membranes by treatment with sodium carbonate. This is striking because RamC is an extremely hydrophobic protein and yet could still be rendered soluble in this way. This strongly suggests that the other four proteins remained in the pellet fractions because they are integral membrane proteins.

Tail sequences are sufficient for membrane targeting

To investigate whether the tail sequences of these proteins are sufficient for membrane targeting, the C-terminal sequences of three candidates, SCO2973 (PkaB), SCO4646 (SecE) and SCO7133 (including 11 amino acid residues upstream of the putative transmembrane domain, see materials and methods) were fused to the cytoplasmic protein eGFP generating eGFP-2973, eGFP-4646 and eGFP-7133. SCO2900 was not included for analysis as its N-terminus is predicted to face out of the cell. Again, these fusions were expressed in S. coelicolor using thiostrepton; protoplasts prepared and lysed then fractionated using ultracentrifugation. Fractions containing the fusions were then identified using Western analysis with anti-GFP antibodies. Cross-reactive bands to the eGFP antibody are visible with the eGFP-7133 fusion protein, these bands are also present in the other samples; however, they are not contained in the field of the image. As expected, the unfused eGFP protein was contained entirely in the supernatant (Figure 4). In contrast, all fusions to eGFP were found completely in the pellet fractions (Figure 4).
Figure 4

Localization of eGFP tail anchor fusions.

Putative tail anchor transmembrane domains from SCO2973, SCO4646 and SCO7133 were fused to the C-terminus of the cytoplasmic protein eGFP and localization to the pellet (P) and supernatant (S) fractions was determined in the presence of either sucrose (−) or carbonate (+). Unfused eGFP is shown for comparison. Localization was detected by Western blot analysis against eGFP.

Localization of eGFP tail anchor fusions.

Putative tail anchor transmembrane domains from SCO2973, SCO4646 and SCO7133 were fused to the C-terminus of the cytoplasmic protein eGFP and localization to the pellet (P) and supernatant (S) fractions was determined in the presence of either sucrose (−) or carbonate (+). Unfused eGFP is shown for comparison. Localization was detected by Western blot analysis against eGFP. The three eGFP-tail sequence fusions were subjected to carbonate extraction to determine whether they behaved as integral membrane proteins. All three proteins remained in the pellet fraction regardless of the treatment with sodium carbonate, suggesting that they were integral membrane proteins (Figure 4). The ability of the transmembrane domain from the three tail-anchor proteins to relocate eGFP to the pellet and resist carbonate extraction strongly suggests that all information required for targeting to the membrane is found in the C-termini of these proteins.

Bacterial Tail Anchor Membrane Proteins are capable of facing into and out of the cell

During the topology prediction, we noted that while the majority of our putative TAMPs were predicted on the basis of the ‘positive charge in’ rule [25] to have their N-termini face into the cell, 6 of the 20 were predicted to have their N-termini exterior to the cell, in contrast to the eukaryote paradigm. In order to test this we subjected the 4 candidates (SCO2900, SCO2973, SCO4646 and SCO7133) to Proteinase K digestion with ActR, a cytoplasmic protein, serving as a control for cell lysis (Figure 5). We found that with high doses of proteinase, all of the fusions were rapidly degraded to the point where they were undetectable by anti-FLAG tag Western analysis (data not shown). At lower proteinase concentrations however, including those shown in Figure 5, SCO2900 was consistently more sensitive to proteinase digestion than SCO2973, SCO4646 or SCO7133, suggesting this proteins FLAG-tag is external to the cell, along with the bulk of the protein, and that it is therefore susceptible to proteolytic removal. We take this as evidence that while the N-termini of SCO2973, SCO4646 and SCO7133 are intracellular, SCO2900 may project it's N-terminus out of the cell, as predicted by the ‘positive charge in’ rule [25].
Figure 5

Protease protection assay to assess TAMP orientation at the membrane.

Protoplasts expressing ActR, SCO2900, SCO2973, SCO4646 and SCO7133 were subjected to increasing concentration of Proteinase K (PK). Exterior facing N-termini were expected to be susceptible to Proteinase K digestion; while inward facing N-termini were expected to be protected. Visualization of the extent of degradation was detected by Western blot analysis against the FLAG epitope.

Protease protection assay to assess TAMP orientation at the membrane.

Protoplasts expressing ActR, SCO2900, SCO2973, SCO4646 and SCO7133 were subjected to increasing concentration of Proteinase K (PK). Exterior facing N-termini were expected to be susceptible to Proteinase K digestion; while inward facing N-termini were expected to be protected. Visualization of the extent of degradation was detected by Western blot analysis against the FLAG epitope.

Discussion

We have identified a previously uncharacterized class of bacterial membrane proteins in S. coelicolor that lack the N-terminal signal sequences and, rather, depend on C-terminal transmembrane domains for membrane targeting. This is the first time such an observation has been biochemically demonstrated in a prokaryote. Aside from their C-terminal sequences, these proteins do not appear to contain any additional sequence motif for membrane targeting as the C-termini alone from three of these proteins can render eGFP entirely membrane-associated (Figure 4). Furthermore, the remarkable diversity of the N-terminal domains of these proteins, which exhibit no universally conserved sequence characteristics, strongly argues for a membrane targeting mechanism that depends primarily, if not entirely on, the C-terminal domains. Among the candidates that we have worked with here are at least two known proteins of considerable interest, PkaB (SCO2973), one of the so-called “eukaryotic” ser/thr protein kinases found in streptomycetes and other prokaryotes, and SecE from the Sec translocon. Orthologues of these proteins have been investigated in several bacteria previously; however, to our knowledge the possible tail-anchoring is a new observation [26], [27], [28]. While little is known about PkaB in S. coelicolor, it is closely related to the Mycobacterium tuberculosis protein kinase PknA. The pknA TB gene is adjacent to a second ser/thr kinase gene pknB TB, (unfortunately referred to as pkaA in S. coelicolor. These two Mycobacterial kinases have been implicated in cell division and the maintenance of cell shape and it has been suggested that they may phosphorylate components (FtsZ and FipA) of the division apparatus [29]. The single C-terminal transmembrane domain has been previously noted; however, the absence of N-terminal signal sequences was not. The importance of PknA in M. tuberculosis suggests, that understanding the mechanism with which this kinase targets to the membrane could lead to new drug targets for combating this pathogenic bacteria. SecE is similarly a highly studied and important protein. Its role in secretion is to aid in forming the protein conducting channel, the SecYEG translocase, by stabilizing SecY and by contributing residues to the active centre in the translocase [5], [30]. The E. coli SecE protein, arguably the best studied prokaryotic example, is a 127 amino acid, Sec-dependent polytopic transmembrane protein having three transmembrane sequences. In contrast, the S. coelicolor orthologue that we have investigated, SCO4646, is a 79 amino acid protein having a single transmembrane domain at its C-terminus: we confirmed that this characterization is not due to a mis-identification of the open reading frame's 5′ end. These results are also in agreement with recently published bioinformatic data from the SecE of M. maripaludis [15]. The eukaryotic orthologues of SecE, Sec61β, are also well-known tail-anchored transmembrane proteins [12]. Intriguingly, our sequence searches suggest that many other prokaryotic SecE orthologues are similar to that of S. coelicolor in that they appear to lack signal sequences and have a single, C-terminal transmembrane domain. For example, the SecE orthologues in all the sequences streptomycetes are all predicted to be shorter proteins, similar in length to that of SCO4646, and to have a single predicted transmembrane domain at their C-terminus. Remarkably, the SecE orthologue in the very well-studied model organism Bacillus subtilis (NCBI locus tag NP_387981) is also a shorter protein of 59 amino acid residues with a single, C-terminal transmembrane domain and no obvious N-terminal signal sequence. This appears also to be the case in the important pathogens Staphylococcus aureus (NCBI locus tag AAB54017) and Enterococcus faecalis (NCBI locus tag EEN75976), both of which are smaller proteins with one predicted C-terminal membrane spanning domain like that of S. coelicolor. The M. tuberculosis SecE protein is a longer protein of 161 amino acid residues however it too appears to lack a signal sequence and has a single, C-terminal transmembrane domain, unlike that of E. coli. While we have identified this class of bacterial membrane proteins, the targeting apparatus and mechanism remains unknown. We have demonstrated that the C-terminal transmembrane domain is sufficient for localization; suggesting a targeting pathway that is independent of the SRP. Recent bioinformatics suggests that Archea and eukaryote TAMPs target via a similar set of machinery, the archeon ArsA and eukaryote equivalent the Get3 complex; however, the bacterial equivalent lacks key residues for membrane protein targeting, suggesting bacterial ArsA is not the TAMP targeting machinery [15]. The eukaryotic TAMPs are all predicted to insert their transmembrane domains into the membrane and sit facing their N-termini to the cytosol from either the mitochondrial outer membrane or the endoplasmic reticulum (N-terminus “in”) [31]. An interesting development in our analysis is the variation in predicted topology of the TAMPs from S. coelicolor (Table 1) with some facing the cytosol (N-terminus “in”) and some exterior to the cell (N-terminus “out”). Preliminary biochemical evidence has confirmed these 2 bacterial orientations (Figure 5). This requirement to cross the lipid bilayer may be the reason for a differing targeting mechanism for bacterial TAMPs in contrast to archeon and eukaryotes as translocation machinery may be required for proper translocation across the membrane. Based on known membrane targeting machinery, bacterial possibilities could include YidC as YidC is capable of targeting membrane proteins independent of the Sec translocon [8]. It has been previously reported that YidC alone is capable of inserting E. coli SecE, a SecE with multiple TMs, into the membrane [32]. Despite this possibility, YidC targeting of bacterial TAMPs has yet to be explored. The identification of a new targeting pathway could pose as an important target for an antimicrobial agent, especially in light of a potentially differing targeting pathway from eukaryotes.

Materials and Methods

Bioinformatics

The TAMP finder program was used as previously reported (Brito et al, Manuscript in Preparation). Transmembrane domains were detected using the TMHMM software available at http://www.cbs.dtu.dk/services/TMHMM/ and signal sequences were assessed using the SignalP software available online at http://www.cbs.dtu.dk/services/SignalP/. Hydrophilicity and hydrophobicity of the N-terminal regions was calculated using the online program http://www.innovagen.se/custom-peptide-synthesis/peptide-property-calculator/peptide-property-calculator.asp.

Strains, plasmids and general growth conditions

E. coli strains were grown at 37°C in Luria broth medium. Plasmid construction was performed in E. coli strain XL1 blue (Stratagene); while E. coli strain ET12567 containing the pUZ8002 plasmid was used for conjugal transfer of plasmids into S. coelicolor [33]. S. coelicolor M145 was used to test the membrane protein predictions. Streptomyces strains were grown at 30°C on SFM agar for matings and R2YE for general restreaking. Liquid cultures of S. coelicolor were grown in R5 medium supplemented with 7% PEG-8000 [34]. Antibiotic concentrations were 50 µg/ml kanamycin, 50 µg/ml apramycin, 35 µg/ml chloramphenicol, 30 µg/ml thiostrepton and 25 µg/ml nalidixic acid.

Construction of TAMP overexpression vectors

Putative membrane proteins SCO2900, SCO2973, SCO4008, SCO4646 and SCO7133 were amplified from S. coelicolor chromosomal DNA via PCR introducing a FLAG epitope (DYKDDDDK) at their N-termini for Western blot analysis, see Table 2 for primers. NdeI and BamHI restriction sites were introduced upstream and downstream of the genes, respectively, to allow for introduction into the Streptomyces overexpression vectors pIJ6902 and pIJ8600 [35], [36]. The cytoplasmic protein ActR was amplified in the same manner and introduced into pIJ6902.
Table 2

Primers used in this work.

ConstructPrimer NameSequence 5′ to 3′
FLAG-tag over-expression in pIJ6902
ActRActR-For CATATGGACTACAAGGACGACGACGACAAGATGTCGCGAAGCGAGGAAGG
ActR-Rev GGCGTAGAGGATCCGAAGGC
SCO29002900-For CATATGGACTACAAGGACGACGACGACAAGGTGGCGGACACGTCGGACAT
2900-Rev ATCCGGATCCGCAGCTTG
SCO29732973-For CATATGGACTACAAGGACGACGACGACAAGTTGGCACGGAAGATCGGCAG
2973-Rev TCCAGCGTAACGGATCCGTC
SCO46464646-For CATATGGACTACAAGGACGACGACGACAAGGTGACGGACGCCGTG
4646-Rev CGGGATCCTCGGCGCCCTTCG
SCO71337133-For CATATGGACTACAAGGACGACGACGACAAGATGGACACGAGCAAGCAGGC
7133-Rev GCTACGGATCCCGCGGT
FLAG-tag over-expression in pIJ8660
SCO40084008-For CATATGGACTACAAGGACGACGACGACAAGATGGCAGCAAAGGACCCC
4008-Rev GGATCCTCACCGGTCGACGATGCG
eGFP fusion of TM in pIJ6902
eGFPeGFP-For CGGCGGACATATGGTGAGCA
eGFP-Rev TCTTCTAGAGGTACGGGCTG
eGFP*-Rev GGCGGCCTCTAGACTTGTAC
eGFP-2973eGFP2973-For CCCGGCTCTAGACGCAACCG
eGFP2973-Rev CCGGGGATCCGTCCAGCGGT
eGFP-4646eGFP4646-For AGGTCGTCTGGTCTAGACGC
eGFP4646-Rev CTCGGTACCCGGGGATCCCC
eGFP-7133eGFP7133-For GCCGAGTCTAGACACCGACT
eGFP7133-Rev CTCGGTACCCGGGGATCCCG

Construction of eGFP-tail anchor fusions

The eGFP gene was amplified from the plasmid pIJ8668, removing the stop codon and introducing an XbaI restriction site downstream for introduction into pIJ6902, see Table 2 for primers. The eGFP gene was also cloned in a similar manner but containing the stop codon for use as a cytoplasmic control (eGFP*-Rev primer). The putative tail anchor transmembrane domains from SCO2973, SCO4646 and SCO7133 were amplified including 11 residues upstream from the predicted transmembrane domain via PCR, introducing XbaI and BamHI for introduction downstream of the eGFP gene, primers are listed in Table 2.

Separation of membrane and cytoplasmic fractions

S. coelicolor strains containing the TAMP overexpression vectors and the eGFP-tail anchor fusions were grown in liquid culture for 16 hours prior to induction. Cultures were induced for 45 min with 30 µg/ml thiostrepton. Cells were washed once with 10.3% sucrose and resupended in P buffer containing 2 mg/ml lysozyme [34]. Protoplasts were created by incubation at 30°C for 1 hour and harvested by filtering through cotton and centrifugation at 7,000×g for 10 min [34]. The pellet was resuspended in lysis buffer (150 mM Hepes pH 7.3, 150 mM NaCl, 3 mM DTT, 30% glycerol) with protease inhibitor cocktail. Subsequent steps were all performed at 4°C. Protoplasts were sonicated for 2 min at 5 sec intervals following 10 sec rest. The lysate was centrifuged at 7,000×g for 10 min and the supernatant was centrifuged at 100,000×g for 1 hr.

Sucrose gradient ultracentrifugation

50 µg of total protein from the membrane fractions were loaded to the top of sucrose step gradients containing 60% sucrose (4 ml Tris pH 8), 40% sucrose (4 ml Tris pH 8) and 20% sucrose (3 ml Tris pH 8). Gradients were centrifuged at 100,000×g for 16 hr at 4°C and 1 ml fractions were collected by piercing a needle in the bottom of the centrifuge tube and collecting the flow through.

Sodium carbonate extraction

Cell lysate was prepared as described above. The lysate was mixed on ice with an equal volume of 0.2 M sodium carbonate (pH 11.4) or 0.2 M sucrose (pH 7.8) and centrifuged at 4°C for 1 hr. Following centrifugation at 100,000×g, the supernatant was neutralized with glacial acetic acid and the pellet was resuspended in lysis buffer. The peripheral membrane protein RamC was used as a control for extraction by sodium carbonate. Preparation of lysate for this analysis was performed as previously described [24].

Proteinase K Digestion

A concentration range of 0, 1, 10, 15, 20, 25, 50, 75, 100 µg/µl Proteinase K (Sigma) was added to protoplasts and incubated on ice for 10 minutes. Proteolysis was stopped by the addition protease inhibitors (Roche), followed by the addition of 3× SDS loading buffer and heated to 95°C for 10 minutes. The degree of Proteinase K digestion was visualized by Western blot analysis using the anti-FLAG antibody (Sigma).

Visualization of subcellular localization

Western blot analysis was used to determine the localization patterns of the TAMPs and eGFP-tail anchor fusions. For detection of the TAMPs anti-FLAG (Sigma) was used at a concentration of 1∶10,000 and anti-eGFP (Invitrogen) was used at a concentration of 1∶2,500 for eGFP fusion proteins. Antibodies against RamC were used at a concentration of 1∶1,000.
  35 in total

Review 1.  The protein-conducting channel SecYEG.

Authors:  Andreas K J Veenendaal; Chris van der Does; Arnold J M Driessen
Journal:  Biochim Biophys Acta       Date:  2004-11-11

Review 2.  Tail-anchored protein biosynthesis at the endoplasmic reticulum: the same but different.

Authors:  S High; B M Abell
Journal:  Biochem Soc Trans       Date:  2004-11       Impact factor: 5.407

3.  The carboxyl-terminal region of SecE interacts with SecY and is functional in the reconstitution of protein translocation activity in Escherichia coli.

Authors:  K Nishiyama; S Mizushima; H Tokuda
Journal:  J Biol Chem       Date:  1992-04-05       Impact factor: 5.157

4.  Membrane protein structure prediction. Hydrophobicity analysis and the positive-inside rule.

Authors:  G von Heijne
Journal:  J Mol Biol       Date:  1992-05-20       Impact factor: 5.469

Review 5.  Oligomeric states of the SecA and SecYEG core components of the bacterial Sec translocon.

Authors:  Sharyn L Rusch; Debra A Kendall
Journal:  Biochim Biophys Acta       Date:  2006-08-30

6.  High efficiency intergeneric conjugal transfer of plasmid DNA from Escherichia coli to methyl DNA-restricting streptomycetes.

Authors:  F Flett; V Mersinias; C P Smith
Journal:  FEMS Microbiol Lett       Date:  1997-10-15       Impact factor: 2.742

7.  Isolation and characterization of the secE homologue gene of Bacillus subtilis.

Authors:  S M Jeong; H Yoshikawa; H Takahashi
Journal:  Mol Microbiol       Date:  1993-10       Impact factor: 3.501

8.  Roles of the conserved cytoplasmic region and non-conserved carboxy-terminal region of SecE in Escherichia coli protein translocase.

Authors:  V P Kontinen; M Yamanaka; K Nishiyama; H Tokuda
Journal:  J Biochem       Date:  1996-06       Impact factor: 3.387

9.  Transfer functions of the conjugative integrating element pSAM2 from Streptomyces ambofaciens: characterization of a kil-kor system associated with transfer.

Authors:  J Hagège; J L Pernodet; G Sezonov; C Gerbaud; A Friedmann; M Guérineau
Journal:  J Bacteriol       Date:  1993-09       Impact factor: 3.490

10.  Cloning, nucleotide sequence, and transcriptional analysis of the nusG gene of Streptomyces coelicolor A3(2), which encodes a putative transcriptional antiterminator.

Authors:  C Puttikhunt; T Nihira; Y Yamada
Journal:  Mol Gen Genet       Date:  1995-04-10
View more
  9 in total

1.  Tail-Anchored Inner Membrane Protein ElaB Increases Resistance to Stress While Reducing Persistence in Escherichia coli.

Authors:  Yunxue Guo; Xiaoxiao Liu; Baiyuan Li; Jianyun Yao; Thomas K Wood; Xiaoxue Wang
Journal:  J Bacteriol       Date:  2017-04-11       Impact factor: 3.490

2.  Truncated hemoglobin, HbN, is post-translationally modified in Mycobacterium tuberculosis and modulates host-pathogen interactions during intracellular infection.

Authors:  Swati Arya; Deepti Sethi; Sandeep Singh; Mangesh Dattu Hade; Vijender Singh; Preeti Raju; Sathi Babu Chodisetti; Deepshikha Verma; Grish C Varshney; Javed N Agrewala; Kanak L Dikshit
Journal:  J Biol Chem       Date:  2013-08-27       Impact factor: 5.157

3.  New insights into the targeting of a subset of tail-anchored proteins to the outer mitochondrial membrane.

Authors:  Naomi J Marty; Howard J Teresinski; Yeen Ting Hwang; Eric A Clendening; Satinder K Gidda; Elwira Sliwinska; Daiyuan Zhang; Ján A Miernyk; Glauber C Brito; David W Andrews; John M Dyer; Robert T Mullen
Journal:  Front Plant Sci       Date:  2014-09-04       Impact factor: 5.753

4.  The Glutaminase-Dependent System Confers Extreme Acid Resistance to New Species and Atypical Strains of Brucella.

Authors:  Luca Freddi; Maria A Damiano; Laurent Chaloin; Eugenia Pennacchietti; Sascha Al Dahouk; Stephan Köhler; Daniela De Biase; Alessandra Occhialini
Journal:  Front Microbiol       Date:  2017-11-15       Impact factor: 5.640

5.  Cohesive Properties of the Caulobacter crescentus Holdfast Adhesin Are Regulated by a Novel c-di-GMP Effector Protein.

Authors:  Kathrin S Sprecher; Isabelle Hug; Jutta Nesper; Eva Potthoff; Mohamed-Ali Mahi; Matteo Sangermani; Volkhard Kaever; Torsten Schwede; Julia Vorholt; Urs Jenal
Journal:  MBio       Date:  2017-03-21       Impact factor: 7.867

6.  Neutralization of Junín virus by single domain antibodies targeted against the nucleoprotein.

Authors:  Florencia Linero; Claudia Sepúlveda; Ioanna Christopoulou; Paco Hulpiau; Luis Scolaro; Xavier Saelens
Journal:  Sci Rep       Date:  2018-07-30       Impact factor: 4.379

7.  Identification of new components of the RipC-FtsEX cell separation pathway of Corynebacterineae.

Authors:  Hoong Chuin Lim; Joel W Sher; Frances P Rodriguez-Rivera; Coralie Fumeaux; Carolyn R Bertozzi; Thomas G Bernhardt
Journal:  PLoS Genet       Date:  2019-08-22       Impact factor: 5.917

8.  A comparative genomics methodology reveals a widespread family of membrane-disrupting T6SS effectors.

Authors:  Chaya M Fridman; Kinga Keppel; Motti Gerlic; Eran Bosis; Dor Salomon
Journal:  Nat Commun       Date:  2020-02-27       Impact factor: 14.919

9.  Comprehensive subcellular topologies of polypeptides in Streptomyces.

Authors:  Konstantinos C Tsolis; Evridiki-Pandora Tsare; Georgia Orfanoudaki; Tobias Busche; Katerina Kanaki; Reshmi Ramakrishnan; Frederic Rousseau; Joost Schymkowitz; Christian Rückert; Jörn Kalinowski; Jozef Anné; Spyridoula Karamanou; Maria I Klapa; Anastassios Economou
Journal:  Microb Cell Fact       Date:  2018-03-15       Impact factor: 5.328

  9 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.