Literature DB >> 21527776

Overcoming redundancy: an RNAi enhancer screen for morphogenesis genes in Caenorhabditis elegans.

Jacob M Sawyer1, Stephanie Glass, Trudy Li, Gidi Shemer, Noor D White, Natalia G Starostina, Edward T Kipreos, Corbin D Jones, Bob Goldstein.   

Abstract

Morphogenesis is an important component of animal development. Genetic redundancy has been proposed to be common among morphogenesis genes, posing a challenge to the genetic dissection of morphogenesis mechanisms. Genetic redundancy is more generally a challenge in biology, as large proportions of the genes in diverse organisms have no apparent loss of function phenotypes. Here, we present a screen designed to uncover redundant and partially redundant genes that function in an example of morphogenesis, gastrulation in Caenorhabditis elegans. We performed an RNA interference (RNAi) enhancer screen in a gastrulation-sensitized double-mutant background, targeting genes likely to be expressed in gastrulating cells or their neighbors. Secondary screening identified 16 new genes whose functions contribute to normal gastrulation in a nonsensitized background. We observed that for most new genes found, the closest known homologs were multiple other C. elegans genes, suggesting that some may have derived from rounds of recent gene duplication events. We predict that such genes are more likely than single copy genes to comprise redundant or partially redundant gene families. We explored this prediction for one gene that we identified and confirmed that this gene and five close relatives, which encode predicted substrate recognition subunits (SRSs) for a CUL-2 ubiquitin ligase, do indeed function partially redundantly with each other in gastrulation. Our results implicate new genes in C. elegans gastrulation, and they show that an RNAi-based enhancer screen in C. elegans can be used as an efficient means to identify important but redundant or partially redundant developmental genes.

Entities:  

Mesh:

Substances:

Year:  2011        PMID: 21527776      PMCID: PMC3176534          DOI: 10.1534/genetics.111.129486

Source DB:  PubMed          Journal:  Genetics        ISSN: 0016-6731            Impact factor:   4.562


MORPHOGENESIS involves cell and tissue movements, including the movements of gastrulation and neurulation in animal embryos. Identifying the genes that control morphogenesis in animal systems has been a long-standing challenge (W). Genes involved in morphogenesis may evade genetic screens for at least two reasons. First, some genes controlling morphogenesis encode widely pleiotropic proteins such as actin and myosin (K). These genes may be missed in screens for morphogenesis genes because loss of function can result in arrested development before morphogenesis begins. Second, other genes may have functions that are too subtle to be identified in forward screens, for example, genes that function redundantly or partially redundantly. Redundancy among mechanisms that underlie morphogenesis has been called a “well-recognized aspect of development” (N). In his Nobel Lecture, Eric Wieschaus concluded that classic Drosophila screens failed to identify many morphogenesis genes and proposed as a result that the control of cell form that underlies morphogenesis may be unusually susceptible to genetic redundancy (W). Redundancy is a challenge that biologists face increasingly, as large proportions of genes in diverse systems have been found to perform important functions as members of redundant gene groups and, as a result, are often missed in genetic screens (J; R; G; F). We recognize that two distinct forms of genetic redundancy exist: homologous redundancy, in which homologous proteins can substitute for each other, and nonhomologous redundancy, in which proteins that do not resemble each other can substitute for each other, for example, by affecting distinct, contributing cellular mechanisms (J; G). Despite this challenge, some key genes that function in morphogenesis have been identified by standard forward screens and by a variety of elegant modifications of such screens (M; B; S; Z; M; E; R; S). C. elegans is a valuable model system for contributing to this effort, because genetics and RNA interference (RNAi) allow one to simultaneously disrupt the functions of multiple genes in modifier screens (L; O’R; D). Genetic modifier screens have identified genes with redundant roles in C. elegans vulval and pharyngeal morphogenesis (F). To our knowledge, RNAi modifier screens have not yet been used to find genes controlling morphogenesis or to specifically seek redundant and partially redundant groups of genes. The ability to observe directly the individual cells participating in morphogenesis in transparent C. elegans embryos in vivo (C; N) makes it possible to detect even subtle defects. Detecting subtle defects may be important for identifying partially redundant genes. Gastrulation is a key morphogenetic event, a cellular reorganization that occurs in diverse metazoans. Gastrulation involves the internalization of cells that give rise to mesoderm, endoderm, and germline, leaving these cells enclosed by ectoderm. In C. elegans, gastrulation begins with the internalization of two endodermal precursor cells, Ea and Ep, from the ventral face of the embryo. These two cells are the first cells of the embryo to introduce in their cell cycles a gap phase, during which they internalize (E). Six neighboring cells, including the germline precursor (P), three of the four granddaughters of the MS founder cell, and two great great granddaughters of the AB founder cell move into the space that the internalizing E cells leave behind, completing envelopment of the Ea and Ep cells (L). Sixty-four other cells internalize after the endoderm precursors, leading to roughly half of the embryonic cells ending up in the interior of the embryo (S; N; H). C. elegans gastrulation requires properly specified cell fates and involves cell polarization, control of motor activity, regulation of adhesion, and mechanistic links from cell fate specification to cell movements. One genetic requirement for C. elegans gastrulation is a class of genes controlling cell fate specification. The endodermal GATA factor END-3 and genes regulating its expression in the endodermal lineage are required for timely gastrulation (B; T; M; L). Gastrulation in C. elegans also depends on genes encoding PAR polarity proteins: loss of PAR-3 or PAR-6 in somatic cells results in Ea and Ep failing to internalize on schedule (N). These cells normally accumulate a nonmuscle myosin heavy chain protein in their apical cortex, and this accumulation requires apical PAR proteins, which localize to contact-free surfaces via a RhoGAP-mediated exclusion of PAR-6 from other surfaces (N; N; A). Basolaterally localized adhesion proteins also function in apical myosin localization (G). A WD repeat protein, GAD-1, (gastrulation defective), is required to delay entry into mitosis during a period of apical myosin accumulation and is required for cell internalization (K; N; L). Gastrulation additionally depends on a Wnt-Frizzled signaling pathway that activates the apical myosin in Ea and Ep (L). These results have led to a model in which myosin enriches at the apical, contact-free cell cortex of endodermal precursors, and activation of myosin results in an actomyosin-dependent constriction of the apical surface of these cells, driving movement of the cells to the embryo interior (see R; Sawyer et al. 2010 for review). Consistent with this model, F-actin and actin regulators also function in gastrulation (S; K; L; R). Several of the genes identified to date are thought to contribute partially redundantly, as strong loss of function of genes including , and genes of the Wnt pathway results in only a delay of E cell internalization (N; L). We hypothesized that many of the genes that play direct or indirect roles in normal gastrulation remain to be identified. A screen aimed specifically at identifying C. elegans gastrulation genes has not been reported previously. Here, we report a novel screening strategy for identifying genes with roles in C. elegans gastrulation. We have constructed a double mutant worm strain to serve as a sensitized background for an enhancer screen. We found that feeding these worms bacterially produced double-stranded RNAs (dsRNAs) targeting genes involved in gastrulation succeeded in producing synthetic lethality. We exploited this sensitized background together with two published microarray analyses (R; Baugh et al. 2005) to screen for enhancers of the sensitized background among genes likely to be expressed in gastrulating cells and/or their neighbors before or near the time that gastrulation occurs. In secondary screens, we determined which of the genes we identified as enhancers were required for normal gastrulation in a nonsensitized background. Our screens identified 16 new genes with nonredundant or partially redundant functions in C. elegans gastrulation, as well as some new genes for which we only found redundant roles in gastrulation. We validated our screening method, showing that most of the genes we identified would not have been found as efficiently by a traditional RNAi feeding screen. Our screens identified several genes whose closest relatives by sequence similarity were multiple other C. elegans genes. We predict that these genes are more likely to function redundantly or partially redundantly than single copy genes. We tested this hypothesis for one gene we identified, which encodes a predicted substrate recognition subunit (SRS) for an E3 ubiquitin ligase. We showed that this gene and several similar C. elegans genes do indeed comprise a redundant gene set required for normal gastrulation, and at least some of their protein products can bind the E3 ubiquitin complex subunits CUL-2 and elongin C. Our results identify a set of genes that will be valuable for further study of morphogenesis mechanisms in C. elegans gastrulation. Moreover, they suggest that a C. elegans modifier screen using RNAi in a sensitized background can effectively assign functions to redundant gene families that are traditionally difficult to identify genetically.

Materials and Methods

Strains and worm maintenance

Nematodes were cultured and handled as described (B). Experiments were performed using the following strains: wild-type N2 (Bristol), JJ1317 [end-1::GFP], EU452 , MT4434 ), MT4417 ), RB1331 ), GR1373 ), VC271 ) (backcrossed five times), RB2454 ), RB2550 ), GH403 ), GH383 ), FX03627 ) (backcrossed five times), FX00278 ), FX02295 ), FX01239 ), FX01226 ), FX01378 ), FX01169 ), FX04187 ), ET099 [Pcul-2::CUL-2::FLAG:: 3′UTR; pRF4], and LP77 ). LP77 was constructed by crossing ) males with ) hermaphrodites. ) is a deletion of ∼700 bp (WormBase Release WS215 at www.wormbase.org). All strains were maintained at 20°.

RNAi screening and quantification of embryonic lethality

RNAi by feeding was performed at 20° according to a standard protocol, starting with L4 larvae moved every 12 hr to fresh RNAi plates (Timmins and Fire 1998; K). Feeding strains were obtained from a dsRNA feeding library from Medical Research Council Geneservice (K). F1 embryos and larvae were counted at least 24 hr later. Plates from a 12-hr period were counted only if lethality for a positive control, RNAi, was >80% for all genetic backgrounds involved. A negative control, gfp RNAi, was used to determine the baseline worm strain lethality fraction (W). We accounted for background worm strain lethality, defining a worm strain adjusted lethality (L) by the equation L = (1 − W)*R, where R is the raw lethality resulting from a given dsRNA fed to that worm strain. Enhancement of lethality was calculated as the difference between the adjusted lethalities (for example, L for minus L for N2). Comparisons between worm strains were only done between corresponding 12-hr plates within the same experiment. For statistical analysis, experimental pairs were repeated in triplicate. A two-tailed Student’s t-test with two-sample unequal variance (heteroscedastic) could then be assessed between the enhancement of lethality for a given bacterial strain to the enhancement of lethality of the negative control vector, L4440 expressing dsGFP. Templates for in vitro transcription were generated by a two-step PCR from wild-type genomic DNA. Primers for the first step included 20 bases matching the target sequence and 15 bases of the T7 promoter sequence. The resulting PCR product was purified using a PCR purification kit (Qiagen) according to the manufacturer’s recommendations. This product was used as a template for a second PCR using primers containing the full-length T7 promoter sequence. One to two micrograms of the product was then gel purified and used as a template in an in vitro transcription reaction using the T7 RiboMAX Express RNAi System (Promega) according to the manufacturer’s recommendations. The integrity of the dsRNA was assessed by gel electrophoresis, and the concentration was determined by spectrophotometry. dsRNA was injected at a concentration of 100 ng/ml into hermaphrodites using a Narishige injection apparatus, a Parker Instruments Picospritzer II, and a Nikon Eclipse TE300 microscope. dsRNA was stored in two volumes of 100% ethanol at either −20° or −80°.

Microscopy and differential interference contrast imaging

For live imaging, C. elegans embryos were mounted on poly-L-lysine coated coverslips, supported by a 2–3% agarose pad. Four-dimensional (4D) differential interference contrast (DIC) microscopy was carried out using a Diagnostic Instruments SPOT2 camera mounted on a Nikon Eclipse 800 microscope. Images were acquired at 1- to 2-µm optical sections every 1 or 1.5 min during embryogenesis and analyzed with Metamorph v.6.3r5 (Molecular Devices). Imaging was performed at 20°–23° for all strains.

Sequence alignment and phylogenetic tree construction

Amino acid sequences for the genes identified in this screen and C. elegans , along with C. briggsae, human and mouse homologs were aligned using CLUSTALW and MUSCLE (C; E). While clear regions of conservation were identified among these sequences, both algorithms produced generally poor alignments among all sequences. The alignments were trimmed to the conserved regions and the C. briggsae sequences were excluded. To be included in the conserved sequence alignment, we required that at least two-thirds of taxa have an aligned base. We used ProTest to determine the best model for amino acid evolution, which was JTT+ G (A). We then constructed both maximum likelihood and maximum parsimony trees for the complete sequences and the trimmed conserved sequences (G; K). A total of 1000 and 500 bootstraps were performed for each algorithm, respectively. Generally, the trees were congruent regardless of algorithm or sequence used. The bootstrap support, however, was best with the trimmed conserved sequence.

Comparative BLAST+ analysis

We used BLAST+ to test the hypothesis that the genes identified by the screen were enriched for genes with paralogs (C). We wrote a computer program (supporting information, File S1) to automate BLAST+ of a gene set vs. the entire C. elegans genome, and National Center for Biotechnology Information (NCBI)’s nonredundant protein (nr) database. BLAST+ result files were then analyzed to determine how many times a gene in our query file hit a gene in the C. elegans genome or in a database of all nematode sequences. Results were then analyzed using JMP (ver. 8; SAS, Cary, NC) and Matlab (MathWorks, Natick, MA). We used a rank sum test to determine significance. We removed duplicates of Wormbase Gene IDs. The top hit (the self-hit) was removed from our count. This method does not exclude hits to multiple isoforms produced from the same gene, although we inspected BLAST results for our 29 genes and found that most hits were to products of distinct genes, which we consider to be potential paralogs.

Comparative sequence analysis

We compared the newly identified gene set to the Conserved Domains Database (CCD; M) and filtered our trimmed alignment by similarity. No one residue was conserved across all data, but several potential motifs became apparent between 50 and 90% stringency.

Immunostaining and confocal microscopy

F58D2.1 polyclonal antibodies were generated from rabbits expressing a 100-aa polypeptide from amino acids 198–297 RFIDCSRTMMSVELLEYLLKTHRNLQGVIATMTKSDSDIYDDARALNVATFDSTVRALTYFLKANKVFENGHTITKIDDFIAADSSRILNIRPCMEIIIK (Strategic Diagnostics). A total of 80 ml of rabbit antisera was affinity purified to an endpoint titer of 0.72 ng/ml. Embryos were immunostained for F58D2.1 (1:1000) as described (T) and imaged using a Zeiss LSM510 confocal microscope with Laser Scanning Microscopy software. Images were further processed with Metamorph and Adobe Photoshop.

Protein interaction experiments

Full-length cDNA clones of /, and / were cloned into pCMV-Tag2 vector (Stratagene) to produce FLAG-fusion constructs; -Myc was cloned into pEGFP-N1 vector (Clontech), from which the GFP sequence was removed; and the HA-ELC-1/pEGFP-N1 construct was previously described (S). Immunoprecipitation experiments from transient transfection of HEK293T cells were performed as described (S), using anti-FLAG (M2; Sigma) antibody for the immunoprecipitation and anti-FLAG (M2), anti-HA.11 (Covance), and anti–CUL-2 (Feng et al. 1999) for Western blots. Affinity purification coupled to LC-MS/MS to identify CUL-2::FLAG-associated proteins utilized strains ET099 (expressing Pcul-2::CUL-2::FLAG) and N2, and was performed as previously described (S).

Results

Identifying end-3(ok1448) as a sensitized background

To begin to identify a sensitized background for a gastrulation screen, we sought a mutant with a subtle gastrulation defect, which might be enhanced by feeding a dsRNA, targeting another gene with a role in gastrulation (Figure 1 and Figure S1). Loss of function of either a cell fate regulator (endodermal GATA factor) or a member of the Wnt signaling pathway (Frizzled) can result in a subtle gastrulation defect in which the Ea and Ep cells fail to internalize; however, one cell cycle later, their daughter cells internalize as four E cells (the 4E stage) (M; L). We quantified these subtle gastrulation defects in an allele with a large deletion in ). In 95% of these embryos, Ea and Ep divided on the surface and became internalized at the 4E stage (Figure 1). The strong ) (R) allele produced similar results, with cells internalizing late at the 4E stage in 72% of embryos (L and Figure 1). Injection of dsRNA into wild-type worms nearly phenocopied the ) allele, with cells internalizing late at the 4E stage in 61% of embryos (Figure 1). These results confirmed that the gastrulation defects in these backgrounds are subtle, but highly penetrant.
F

Enhancement of subtle gastrulation defects. (A) Gastrulation defects in various mutants and/or from injected dsRNAs. (B) Four-dimensional (4D) DIC microscopy of four backgrounds with time on the left from MSa/p cell division. E lineage cells are outlined and pseudocolored in green. Late internalization at the 4E stage (orange arrowheads) and internalization failure (blue arrowhead) are indicated. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. Scale: C. elegans embryos are ∼50 µm long.

Enhancement of subtle gastrulation defects. (A) Gastrulation defects in various mutants and/or from injected dsRNAs. (B) Four-dimensional (4D) DIC microscopy of four backgrounds with time on the left from MSa/p cell division. E lineage cells are outlined and pseudocolored in green. Late internalization at the 4E stage (orange arrowheads) and internalization failure (blue arrowhead) are indicated. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. Scale: C. elegans embryos are ∼50 µm long. We discovered that targeting and together by injecting dsRNA into ) worms resulted in a stronger and more penetrant defect than either single treatment: in all embryos, neither Ea/Ep nor their daughter cells internalized (Figure 1). This strongly synergistic effect suggests that these genes may contribute to gastrulation redundantly. The result also suggested that either of these genes might be exploited as a basis for a sensitized background to screen, ideally in a viable mutant background, for enhancement of embryonic lethality, a readily scorable phenotype. loss-of-function mutants generally produce viable embryos (M), with only 6% embryonic lethality in ) (Figure S2). Loss-of-function mutants of resulted in embryonic lethality (R), but feeding dsRNA to wild-type animals produced a much weaker defect, with only 4% of embryos failing to hatch (Figure S3), suggesting that RNAi by feeding for might be a means to generate partial loss of function. We fed dsRNA to ) worms and found that 24% of embryos failed to hatch, a mild but readily detectable and significant synergistic effect (P = 0.027, Student’s t-test). This result suggested that by feeding dsRNAs to ) and wild-type animals in parallel, followed by quantification of embryonic lethality, an RNAi feeding screen could be carried out.

Developing a doubly sensitized background

We next determined whether other mutants can produce enhanced gastrulation defects and possibly be used to generate a more sensitized background. , which encodes a DOCK180-like guanine exchange factor for Rac (W) and , which encodes a classical cadherin (C), function redundantly in C. elegans gastrulation (G. Shemer, unpublished data). also contributes redundantly with , which encodes an L1CAM (G). We confirmed that Ea/Ep internalize successfully in a likely null allele of (W) (Figure 1). However, gastrulation is often delayed, with the E cells internalizing as four cells, in double embryos (G. Shemer, unpublished data). RNAi to other putative adhesion genes (, and ) or other genes did not similarly enhance ) (Figure 1). This result suggests that ) sensitizes worms to depletion of specific genes, but does not overly sensitize them to depletion of all similar genes. We next examined whether the two useful backgrounds above might be combined to create a doubly sensitized strain. We constructed a ) double mutant, and found that it had only 6% embryonic lethality, similar to the lethality of the single alleles (Figure S2), consistent with and being in the same pathway and/or each being redundant with one or more other pathways. We reasoned that this low level of background lethality would facilitate detecting enhancement of lethality in an RNAi feeding screen, and that including both mutations in the screening background might enable more genes to be identified in the screen than including only one or the other, particularly if multiple, partially redundant mechanisms contribute to gastrulation, as has been predicted for morphogenesis more generally (N; W). We found that the double mutant could be maintained as homozygotes, and that it retained the ability to be enhanced by feeding dsRNA, as expected (Figure 2). Therefore, this strain was selected as our background to screen by RNAi for new genes with possible roles in gastrulation. After screening, we confirmed the value of the double mutant, which identified some enhancers that failed to significantly enhance single mutant backgrounds (see below).
F

Primary screen feeding dsRNAs targeting sdz genes into the gastrulation-sensitized background ced-5(n1812); end-3(ok1448). Percentage of enhancement of lethality (see Material and Methods for calculation) is shown for each dsRNA that was fed three times or more. Dashed line indicates threshold of 8% enhancement of lethality. Error bars indicate 1 SE.

Primary screen feeding dsRNAs targeting sdz genes into the gastrulation-sensitized background ced-5(n1812); end-3(ok1448). Percentage of enhancement of lethality (see Material and Methods for calculation) is shown for each dsRNA that was fed three times or more. Dashed line indicates threshold of 8% enhancement of lethality. Error bars indicate 1 SE.

Identification of enhancers of the sensitized background among genes likely to be expressed in or near gastrulating cells

Our results above suggested that we would need to carefully quantify the degree of embryonic lethality for each treatment to identify enhancers. Therefore, to focus our effort, we selected a set of genes to screen through, making use of two previously published data sets that are likely to be enriched for genes expressed in the endodermal lineage or in their close neighbors from the MS lineage before or during gastrulation. First, the results of a published microarray expression experiment using precisely timed embryos (Baugh et al. 2005) were reordered for us by L. R. Baugh (personal communication) to identify those genes whose mRNA abundances were higher in wild-type embryos than in ; ). Embryos of this background generally lack properly specified E and MS lineages at the time when Ea and Ep would normally internalize, and, as expected, early endodermally expressed mRNAs fail to accumulate (Baugh et al. 2005). We narrowed this list by the following criteria. First, we included only those genes for which mRNA abundance rose by the time that Ea/Ep cell internalization occurred, using the microarray expression profiles of known endodermal genes to choose the relevant timepoints, 23–101 min after the four-cell stage. Second, we required mRNA abundances to be higher in wild-type embryos than in ; ) at these time points. Third, we also required mRNA abundances to be lower at these time points in wild-type embryos than in ; ), a background where twice as many E and MS lineages form. The other list we used was a set of 50 genes identified in a microarray experiment designed to find early embryonic downstream targets of , called sdz (kn-1–dependent zygotic) genes, several of which are transcriptionally active in only MS and E descendents (R). For convenience, we refer to both sets together as sdz genes, although dependence has not been validated for all of the genes included. Among these two sets, 112 clones existed in an RNAi feeding library (K). To determine the ability of knockdown of these 112 genes to enhance the gastrulation-sensitized strain, we fed 112 corresponding bacterial RNAi feeding strains to the worm strain and to N2 wild-type worms in parallel for 48 hr. We assessed the resulting embryonic lethality by counting unhatched embryos and hatched worms at least 24 hr after removing adults (see Materials and Methods). After the first round of feeding, we repeated the 70 with the strongest apparent enhancement of lethality twice more (Figure 2). We found 22 genes that enhanced above a threshold that we chose, 8% enhancement of lethality. These 22 genes included , which is already known to function redundantly with in the E lineage as gastrulation begins (M), confirming the effectiveness of the screening method. Before secondary screening, we tested whether screening in the double mutant background had increased screening efficiency as predicted, by addressing whether synergy with , or both was responsible for the enhancements in lethality. We fed dsRNAs, targeting the 22 genes identified, as well as the positive control , into the and mutants separately (Figure 3 and Figure S4). We found that 15 genes enhanced significantly only in , and none enhanced only in the background. Three genes enhanced both and backgrounds, including and . There were three genes that enhanced the double mutant but did not significantly enhance either of the single mutants. These results suggest that the double mutant served as a more efficient sensitized background than either single mutant. Furthermore, these results begin to suggest a structure to the redundancy, which we plan to explore more fully in the future using null mutants.
F

Enhancement of embryonic lethality into separate components of the sensitized background. Enhancement of lethality in ced-5(n1812) over wild type (top) and in end-3(ok1448) over wild type (bottom). Error bars indicate 1 SE.

Enhancement of embryonic lethality into separate components of the sensitized background. Enhancement of lethality in ced-5(n1812) over wild type (top) and in end-3(ok1448) over wild type (bottom). Error bars indicate 1 SE.

Secondary screening implicates 16 new genes in gastrulation

To identify which of these 22 genes were required for the normal pattern of gastrulation, we conducted a series of secondary screens. First, we injected dsRNAs, targeting each gene into the endodermal GFP reporter strain JJ1317 [end-1::GFP] (we refer to this as P::GFP), and we filmed gastrulation in resulting embryos by 4D DIC microscopy (T). We also injected each dsRNA into ), to more fully determine the proportion of genes that affect gastrulation in this background. For many of the genes identified in our primary screen (20/22), including , injection of dsRNA into ) resulted in gastrulation defects (Figure 4). The number of enhancers of found by dsRNA injection here and by dsRNA feeding above might reflect an especially effective sensitization for gastrulation genes by ), or a role for in parallel to a large number of genes, or a combination of these possibilities. We also considered that ) might have overly sensitized the primary screen, revealing genes with only marginal roles in gastrulation, roles that could not be confirmed in a nonsensitized background. This appeared to not be the case: First, for 10 of these genes, we found that injection of dsRNA resulted in gastrulation defects in at least some embryos even in the nonsensitized strain P::GFP (Figure 4). Second, to examine possible stronger loss of function and to confirm our RNAi results with true mutants, we also filmed by 4D DIC microscopy mutants that were available for 12 of the 22 genes identified in the primary screen. For 10 of these 12 genes, we found that gastrulation defects occurred in some of the filmed mutant embryos (Figure 5). Most of these genes were named previously on the basis of their sequence or as sdz genes. One of the genes, , is a novel gene that is expressed specifically in endoderm progenitors as early as the 2E cell stage (R). Two of the genes were not previously named; we refer to C10A4.5 and B0222.9 as and , respectively, for their gastrulation defective phenotypes.
F

Genes from ced-5; end-3 gastrulation-sensitized screen tested for roles in gastrulation by dsRNA injection. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos.

F

Gastrulation defects in mutants. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. glo-3(zu446) is a nonnull allele (R).

Genes from ced-5; end-3 gastrulation-sensitized screen tested for roles in gastrulation by dsRNA injection. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. Gastrulation defects in mutants. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. glo-3(zu446) is a nonnull allele (R). Because our starting list of 112 genes might already be enriched for genes involved in gastrulation, we further tested the value of our enhancer screen strategy by comparing it to a more commonly used method, a screen for embryonic lethality in ), a background with increased effectiveness of RNAi (K). We fed bacterially expressed dsRNAs targeting the 70 candidate genes we had screened in triplicate in into ) and wild-type worms and quantified the degree of embryonic lethality (Figure 6). Among the 22 genes with the most penetrant embryonic lethality in the background, 6 had been identified using . For the remaining 16, we injected dsRNAs into P::GFP animals and filmed resulting embryos by 4D DIC microscopy, quantifying gastrulation defects in these as before. This identified just 2 more genes with a very low penetrance, nonredundant role in gastrulation, and 8 more genes with a redundant role in gastrulation (Figure 7).
F

Embryonic lethality in an RNAi-sensitized background, eri-1(mg366), and wild type. Error bars indicate 1 SE.

F

Genes from eri-1 RNAi-sensitized screen tested for roles in gastrulation by dsRNA injection. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. Results from six genes (alh-13, B0222.9, F36A2.3, F44A2.7, sdz-27, and sdz-28) from Figure 4 are shown again here, as these genes were identified in both the ced-5; end-3 gastrulation-sensitized screen and the eri-1 RNAi-sensitized screen.

Embryonic lethality in an RNAi-sensitized background, eri-1(mg366), and wild type. Error bars indicate 1 SE. Genes from eri-1 RNAi-sensitized screen tested for roles in gastrulation by dsRNA injection. “No phenotype” indicates that endodermal precursors became internalized at the 2E stage, as in wild-type embryos. Results from six genes (alh-13, B0222.9, F36A2.3, F44A2.7, sdz-27, and sdz-28) from Figure 4 are shown again here, as these genes were identified in both the ced-5; end-3 gastrulation-sensitized screen and the eri-1 RNAi-sensitized screen. In total, 10 out of the top 22 hits from our screen were new gastrulation genes with nonredundant phenotypes, and 14 out of 22 after examining mutants, whereas only 4 of the top 22 hits from our screen were new gastrulation genes with nonredundant phenotypes. We view the higher efficiency of the screen as well as the identification of unique genes in this screen as validating its value as a screening method. These methods implicated a total of 29 new genes in successful and timely gastrulation in C. elegans. Mutants or RNAi knockdown of 16 of these genes result in gastrulation defects in some embryos even in a nonsensitized background. Interestingly, was not implicated in gastrulation by RNAi of in wild-type embryos nor by an deletion allele, suggesting that an earlier report of a role for based on a larger deletion, wDf4, is likely explained by deletion of as well in wDf4 (M; L). Six of the 23 genes we identified had quite low penetrance effects on gastrulation, and higher penetrance in ), and 13 could only be implicated in combination with ), suggesting that many of these genes may act redundantly or partially redundantly in gastrulation, or in separate processes that make indirect contributions to normal gastrulation.

Several of the newly identified genes’ closest homologs are other C. elegans genes

We performed BLAST searches on each of the genes we identified and discovered that for many of these genes (20/29), the closest known sequence as judged by BLAST score in the NCBI nr database as of September 2010 was another gene in the C. elegans genome. For a large proportion of the genes (18/29), multiple other C. elegans genes had higher BLAST scores than did any nonnematode genes, suggesting to us that many may belong to related groups of genes that may have arisen from rounds of gene duplication events within the nematode lineage, or represent a large set of convergently evolved genes. Since C. elegans has a compact genome with mostly single copy genes (W), our screen appeared to have enriched for such genes. Consistent with this, determining the number of BLAST hits from C. elegans with greater similarity by BLAST score than any nonnematode gene resulted in a median of six hits for our group of 29 genes, and a median of one hit for all 20,331 C. elegans predicted protein-coding genes (Figure 8).
F

Number of C. elegans BLAST hits with greater similarity by BLAST score than the first nonnematode hit, for the 29 new genes identified here (left) and for all C. elegans predicted protein-coding genes. Histograms are shown along with box-and-whisker plots at top, with boxes representing the 25–75% quartile ranges (0–35.5 for the 29 genes identified and 0–13 for all genes). Medians are marked in blue.

C. elegans gene families deriving from recent gene duplications are more likely to function redundantly than are single copy genes (C), and we speculate that this might be true for sets of similar genes deriving from less recent duplications or from convergent evolution as well. Given this, the subtle defects and low penetrance of many of the genes we identified, and our finding of several genes that we could implicate only in sensitized backgrounds, we hypothesized that our screening method was successful in uncovering genes that function redundantly or partially redundantly in C. elegans gastrulation. We tested this hypothesis directly for one gene family below.

gadr-1 is a redundant gastrulation gene that is expressed as gastrulation begins

One of the most penetrant enhancers of our double mutant background that we found was F58D2.1 (Figure 2). F58D2.1 appeared to act synergistically with in gastrulation: targeting F58D2.1 and together, by injecting F58D2.1 dsRNA into ) worms, resulted in 25% of embryos failing in Ea/Ep internalization, whereas neither single treatment produced this result (Figures 1 and 4). On the basis of this result and others below, we name (gastrulation defective, redundant). Microarray experiments on staged embryos (Baugh et al. 2005) demonstrated that transcript abundance increased near the time that gastrulation begins—soon after transcripts, which are first detected in the E cell by in situ hybridization (Z), and before transcripts, which are first detected in Ea and Ep just after gastrulation begins (F). To determine when and where the GADR-1 protein accumulates, we generated an affinity-purified rabbit antibody to a 100-amino-acid part of the protein (see Materials and Methods) and used it to immunostain embryos. The timing of GADR-1 protein accumulation was consistent with the microarray results and with our proposed role in gastrulation: GADR-1 immunoreactivity became strong near the time of endodermal internalization. Staining was eliminated by RNAi or by a deletion allele, , which is a 17-kb deletion that removes all or parts of seven genes including most of (S) and the entire antigen sequence. GADR-1 localized to both nuclei and cytoplasm of all cells, with a small amount of enrichment near cell–cell boundaries (Figure 9). In support of our hypothesis from RNAi experiments that functions redundantly in gastrulation, the n2452 deletion allele produced gastrulation defects only in combination with ), and not alone (Figure 1). We conclude that functions redundantly in gastrulation and that it encodes a nuclear and cytoplasmic protein that is first expressed in all cells near the time that gastrulation begins.
F

GADR-1 protein localization. The wild-type embryos shown were imaged from the same slide under the same conditions, after staining with anti–GADR-1 (green) and DAPI to mark nuclei (blue). GADR-1 levels are low at the four-cell stage (A) and have risen by gastrulation (B and C). Staining is reduced by gadr-1 RNAi (D) and by n2452, an allele with a deletion of seven genes including part of gadr-1 (E). Scale: C. elegans embryos are ∼50 µm long.

Number of C. elegans BLAST hits with greater similarity by BLAST score than the first nonnematode hit, for the 29 new genes identified here (left) and for all C. elegans predicted protein-coding genes. Histograms are shown along with box-and-whisker plots at top, with boxes representing the 25–75% quartile ranges (0–35.5 for the 29 genes identified and 0–13 for all genes). Medians are marked in blue. GADR-1 protein localization. The wild-type embryos shown were imaged from the same slide under the same conditions, after staining with anti–GADR-1 (green) and DAPI to mark nuclei (blue). GADR-1 levels are low at the four-cell stage (A) and have risen by gastrulation (B and C). Staining is reduced by gadr-1 RNAi (D) and by n2452, an allele with a deletion of seven genes including part of gadr-1 (E). Scale: C. elegans embryos are ∼50 µm long.

GADR-1 and paralogs resemble substrate recognition subunits for a CUL-2 ubiquitin ligase complex

A search for similar genes by BLAST identified the predicted GADR-1 protein as belonging to a large and diverse group of C. elegans proteins that includes ZYG-11, an SRS for a CUL-2 ubiquitin ligase complex (V) and ZEEL-1, a related protein implicated in reproductive incompatibility between populations (S). By BLAST of the predicted GADR-1 protein sequence, 23 predicted C. elegans proteins had lower E values than any nonnematode sequence in the nr database, suggesting that these genes may have arisen from rounds of gene duplication within the nematodes or that they result from convergent sequence evolution. Sequence similarity among F58D2.1 and paralogs appears to be driven by a small set of residues corresponding to leucine-rich repeats (LRRs) and several uncharacterized motifs. We performed a comparative sequence analysis of the newly identified genes and family members. Using the Conserved Domains Database, we noticed that all genes analyzed including the mammalian zyg11 genes had at least one leucine-rich repeat-like motif (canonically, LxxLxLxxN/CxL). While most of these protein sequences are highly divergent, the strong similarity within these specific motifs in the newly identified genes suggests that these motifs are evolutionarily and functionally conserved. We used phylogenetic and comparative genomic analysis to reveal the evolutionary history of the newly identified genes relative to C. elegans and human and mouse ZYG-11 homologs. These highly diverged amino acid sequences resolved poorly, producing a star phylogeny with the exception of several sets of genes within C. elegans and the mammalian ZYG-11 gene family (Figure 10). Outside of the mammalian clade, which resolved as expected (V), only three clades formed monophyletic groups (Figure 10) with significant bootstrap support using both the maximum likelihood (ML) and maximum parsimony (MP) methods.
F

Phylogenetic relationship of the newly identified genes, related C. elegans genes, and mammalian ZYG11 genes. We used both maximum likelihood and maximum parsimony to produce phylogenies of the newly identified genes, C. elegans zyg-11, and human and mouse zyg-11 homologs.

Phylogenetic relationship of the newly identified genes, related C. elegans genes, and mammalian ZYG11 genes. We used both maximum likelihood and maximum parsimony to produce phylogenies of the newly identified genes, C. elegans zyg-11, and human and mouse zyg-11 homologs.

GADR-1 paralogs can bind ubiquitin ligase complex components CUL-2/cullin and ELC-1/Elongin C

The observation that the GADR-1 and paralogs have some sequence similarity to ZYG-11 suggested that these proteins may similarly function as SRSs in CUL-2 complexes. Affinity purifications coupled to liquid chromatography and tandem mass spectrometry (LC-MS/MS) were used to identify proteins that physically associate with CUL-2::FLAG in vivo. In two separate samples, GADR-6/F47G4.2 was identified in affinity purifications from lysates of animals expressing CUL-2::FLAG. The number of peptides of GADR-6 identified by LC-MS/MS in the two samples (9 and 11 peptides) was comparable to the number of peptides observed for known SRSs (V; S): FEM-1, 24 and 32 peptides; ZER-1, 19 and 29; ZYG-11, 9 and 11; LRR-1, 3 and 5; VHL-1, 0 and 0; and ZIF-1, 0 and 0. GADR-1 to -5 were not identified in the affinity purifications. However, in separate affinity purifications that only analyzed the 85–110 kDa region of CUL-2::FLAG-associated proteins resolved on SDS–PAGE gels, GADR-5/Y71A12B.17 was identified by a single peptide (while GADR-6 was identified with 4 peptides; ZYG-11, 8 peptides; and ZER-1, 12 peptides); none of these proteins were identified from the comparable region of the control affinity purification (from wild-type animals not expressing CUL-2::FLAG). To further probe whether GADR-5 and GADR-6 might function as SRSs, we asked whether they could interact with CUL-2 and the CUL-2 complex adaptor protein Elongin C/ELC-1 when ectopically expressed in HEK293T human cells. We observed that CUL-2 and ELC-1 co-immunoprecipitated with GADR-5 and GADR-6 at a level comparable to that observed with ZYG-11 immunoprecipitation (Figure 11). Therefore, GADR-5 and GADR-6 are likely candidates to be SRSs for CUL-2 ubiquitin ligase complexes. The failure to detect other GADR-1 paralogs in affinity purifications of CUL-2::FLAG may be due to the limitations of the analysis, as the affinity purification coupled to LC-MS/MS approach also failed to identify the previously identified SRSs VHL-1 and ZIF-1 (D; M). We conclude that at least some GADR-1 paralogs can bind ubiquitin ligase complex components CUL-2 and ELC-1. RNAi targeting or resulted in defects before gastrulation as expected (K), which precluded us from determining directly whether these complex members function in gastrulation (data not shown).
F

Two GADR proteins, GADR-5/Y71A12B.17 and GADR-6/F47G4.2, physically interact with both CUL-2 and ELC-1 when coexpressed in human cells. FLAG-tagged GADR-5, GADR-6, and ZYG-11 were coexpressed in HEK293T cells with CUL-2–Myc or HA–ELC-1 as noted by (+) symbols above the lanes. Anti-FLAG immunoprecipitations (IP) and lysates were analyzed by Western blot using anti-FLAG, anti-HA, or anti–CUL-2 antibodies. A cross-reacting band serves as a loading control. Note that both GADR-5 and GADR-6 bind CUL-2 and ELC-1 analogous to the known substrate recognition subunit ZYG-11. The smearing and additional lower bands for FLAG–GADR-5 presumably arise from partial degradation of the protein in HEK293T cells. * denotes the heavy chain of IgG used in the IP; ** marks nonspecific band (which comigrates with lower band of CUL-2 in the first four samples).

Two GADR proteins, GADR-5/Y71A12B.17 and GADR-6/F47G4.2, physically interact with both CUL-2 and ELC-1 when coexpressed in human cells. FLAG-tagged GADR-5, GADR-6, and ZYG-11 were coexpressed in HEK293T cells with CUL-2Myc or HA–ELC-1 as noted by (+) symbols above the lanes. Anti-FLAG immunoprecipitations (IP) and lysates were analyzed by Western blot using anti-FLAG, anti-HA, or anti–CUL-2 antibodies. A cross-reacting band serves as a loading control. Note that both GADR-5 and GADR-6 bind CUL-2 and ELC-1 analogous to the known substrate recognition subunit ZYG-11. The smearing and additional lower bands for FLAG–GADR-5 presumably arise from partial degradation of the protein in HEK293T cells. * denotes the heavy chain of IgG used in the IP; ** marks nonspecific band (which comigrates with lower band of CUL-2 in the first four samples).

gadr-1 and paralogs function redundantly with each other in gastrulation

We hypothesized that might function redundantly in gastrulation with one or more genes that had sequence similarity. To identify such genes, we injected dsRNA, targeting the nine closest relatives of by BLAST into both ) and P::GFP worms. We found that most of these could enhance ), but none produced gastrulation defects in the nonsensitized background, P::GFP, suggesting that all of these genes might act redundantly, as does (Table S1). Indeed, one of these genes, C48D1.1, is also deleted by the deletion allele described above. This result implies that if contributes redundantly to gastrulation with some of the related genes, deleting just this pair was not sufficient to reveal a gastrulation defect. We pursued our hypothesis of redundancy by pooled injection of dsRNAs with the other related genes. Both C48D1.1 and F53G2.1 had frequent cell division defects before gastrulation in ) and were not pursued further. Injection of pooled dsRNAs targeting six remaining genes (the six with the most penetrant effects on gastrulation in )) into N2 worms resulted in 49% penetrant gastrulation defects in Ea/Ep cell internalization (Table S2). This result confirms that some or all of these six related genes function redundantly with each other in one or more processes that directly or indirectly affect gastrulation. To elucidate whether some play more significant roles than others in gastrulation, we used a strategy of injecting all combinations of five of the six pooled dsRNAs, then omitting the one that gave the least penetrant gastrulation defects in a following round using pools of four dsRNAs, and reiterating this pattern until we had narrowed down to just a pair of genes with the most penetrant effects. We found that decreasing the number of genes decreased the penetrance of the phenotypes at nearly every step, without any genes emerging as especially major contributors (Table S2). This result suggests that these genes function partially redundantly in an additive manner with one another. We conclude that each of these genes [which we call (C33A12.12), (F47D12.5), (W06A11.2), (Y71A12B.17), and (F47G4.2)] acts redundantly with in gastrulation and that all or most of them act redundantly with each other in gastrulation. Our results indicate that our strategy for identifying new gastrulation genes can successfully identify redundant players, including sets of related genes that function redundantly with each other.

Discussion

Redundancy has been proposed to be a well-recognized aspect of morphogenesis, making gene discovery a challenge (N; W). We decided to address this challenge using classical genetics and RNAi while looking for new genes acting in C. elegans gastrulation. In this article, we have described an enhancer screen to find new C. elegans gastrulation genes, the first RNAi modifier screen for morphogenesis genes in C. elegans. We find that there is indeed developmental redundancy both between similar genes and between genes that are unrelated by sequence—homologous and nonhomologous redundancy (J). We also found that several genes that play a role in C. elegans gastrulation belong to groups of related genes, some of which may represent gene families deriving from gene duplication events in the nematodes. We predicted that such genes may be more likely than single copy genes to function redundantly or partially redundantly, and we confirmed this for one set of six related genes, to -6, which encode predicted substrate recognition subunits for a CUL-2 ubiquitin ligase. Our results demonstrate that screening by RNAi in a sensitized background is a viable method for tackling redundancy and that it can even identify redundant, closely related genes, traditionally thought of as difficult to identify genetically.

Using RNAi to screen for genes involved in morphogenetic processes

Many C. elegans biologists have taken advantage of the ease of RNAi to compile relatively quickly a list of genes involved in a process of interest (reviewed in J and B). With speed and ease of methodology comes the drawback of variable and sometimes ineffective RNAi, especially when using feeding RNAi as opposed to RNAi by injection. Even with these drawbacks, an RNAi screen can be valuable in tackling redundancy and studying somewhat genetically refractory developmental processes. Often, suppressor screens (L; O’R; D; reviewed in B) have been utilized to discover new genes that function in early developmental processes. The ability to screen for survivors starting from a conditional lethal strain is rapid and convenient. To screen for enhancers efficiently, one must be able to recognize quickly the enhanced phenotypes. In our case, we sensitized our worms using mutations known to affect gastrulation, and we used embryonic lethality as a first test for enhancement. We then used 4D microscopy to examine the initiation of gastrulation, internalization of the E cells, specifically. One goal of our screen was to identify new genes whose functions are required for normal gastrulation. Although this succeeded, limitations exist in the screen that we have carried out. Filming embryos revealed many low penetrance gastrulation genes, and it is possible that we may have missed other genes whose loss of function in wild-type embryos may produce similar defects, but that would have been missed if they did not significantly increase lethality of the sensitized background used in our primary screen. We also did not explore defects in developmental processes other than Ea/Ep internalization. Defects in later morphogenesis or other processes could be a separate cause of enhancement of lethality from our primary screen. We started with a candidate set of zygotic genes, introducing the possibility that we have missed some important maternal genes. We expect that the genes we have identified may include genes that affect gastrulation directly or indirectly. At least two are expressed in Ea and Ep, and one in the early E and MS lineages (Table 1), suggesting that these might have more spatially restricted roles than is likely for , which we have shown is expressed near the time of gastrulation, but in all cells. The sdz gene set is likely to be enriched for genes expressed specifically in the E and/or MS lineages (R). The genes we have identified probably represent only a proportion of all genes that function in gastrulation, although what proportion is difficult to estimate at this stage.
Table 1

Genes identified in this study and their predicted products

New gad genesPredicted products
acp-2Acid phosphatase
apy-1Apyrase
gad-2 (C10A4.5)Transmembrane protein
gad-3 (B0222.9)Xanthine dehydrogenase
glo-3Gut granule/lysosome formation, expressed in early E lineage
kin-33Kinase
sdz-6Unknown
sdz-19Unknown
sdz-22Transthyretin family
sdz-27Unknown
sdz-28BTB/POZ domain, MATH domain
sdz-31Unknown, expressed in early E and MS lineages
sdz-36Unknown
tbx-11T-box transcription factor
ugt-23UDP-glucuronosyl transferase
vet-6Very early transcript, contains a spectrin repeat
New gadr genes
alh-13Dehydrogenase/reductase
drr-1Dietary restriction response
F44A2.7Unknown
fbxb-19F-box protein
fbxb-35F-box protein
fbxb-38F-box protein
gadr-1 (F58D2.1)ZYG-11-like protein, possible SRS for a CUL-2 ubiquitin ligase
gadr-2 (C33A12.12)ZYG-11-like protein, possible SRS for a CUL-2 ubiquitin ligase
gadr-3 (F47D12.5)ZYG-11-like protein, possible SRS for a CUL-2 ubiquitin ligase
gadr-4 (W06A11.2)ZYG-11-like protein, possible SRS for a CUL-2 ubiquitin ligase
gadr-5 (Y71A12B.17)ZYG-11-like protein, possible SRS for a CUL-2 ubiquitin ligase
gadr-6 (F47G4.2)ZYG-11-like protein, possible SRS for a CUL-2 ubiquitin ligase
prx-5Peroxisome import
sdz-18BTB/POZ domain, MATH domain
sdz-21Unknown
sdz-23Transmembrane, EGF domain, expressed in early E lineage
sdz-32Unknown
sdz-34Predicted E3 ubiquitin ligase

Listed are 16 new gad genes (gastrulation-defective: genes whose loss of function results in gastrulation phenotypes) and 18 new gadr genes (gastrulation defective, redundant: genes whose loss of function only results in gastrulation phenotypes in combination with loss of function of other genes). P::GFP expression was examined for a small number of embryos after RNAi of all gad genes except gad-3, sdz-19, sdz-22, tbx-11, and was seen to be low or absent for 1/1 acp-2(RNAi) embryo, 1/1 ugt-23(RNAi) embryo, and 2/6 gad-2(RNAi) embryos, suggesting that these genes may affect endoderm specification as well. Genes given new names here are listed as gad- or gadr-, with the corresponding sequence name in parentheses. Expression data are from Rabbitts et al. 2008 for glo-3, and Robertson et al. 2004 for sdz genes.

Genes identified in this study and their predicted products Listed are 16 new gad genes (gastrulation-defective: genes whose loss of function results in gastrulation phenotypes) and 18 new gadr genes (gastrulation defective, redundant: genes whose loss of function only results in gastrulation phenotypes in combination with loss of function of other genes). P::GFP expression was examined for a small number of embryos after RNAi of all gad genes except gad-3, sdz-19, sdz-22, tbx-11, and was seen to be low or absent for 1/1 acp-2(RNAi) embryo, 1/1 ugt-23(RNAi) embryo, and 2/6 gad-2(RNAi) embryos, suggesting that these genes may affect endoderm specification as well. Genes given new names here are listed as gad- or gadr-, with the corresponding sequence name in parentheses. Expression data are from Rabbitts et al. 2008 for glo-3, and Robertson et al. 2004 for sdz genes. Nonhomologous genetic redundancies have been found in C. elegans before (C; J; F; D, for examples). One well characterized C. elegans nonhomologous redundancy is the synthetic multivulval (SynMuv) system (F; F; for review, see F; F). We identified several genes that could only be implicated in gastrulation in specific genetic backgrounds, and not in wild-type worms. We refer to such a synthetic gastrulation phenotype as SynGad, or Gadr. The nonredundant Gad and redundant Gadr phenotype categories are not definitive: Gad genes have detectable gastrulation defects when knocked down alone, but could also be partially redundant. For example, loss of function of these genes could produce more severe, synergistic gastrulation defects in combinations with each other or with loss of function of other genes. Nonredundant roles in gastrulation have not been found for Gadr genes, but it is possible that for some, null alleles will show some gastrulation defects in nonsensitized backgrounds.

Predicted roles for some of the new genes involved in C. elegans gastrulation

Many of the genes we have identified encode proteins of unknown function in C. elegans but have specific, predicted protein domains (Table 1). For example, encodes a predicted transmembrane protein with an EGF domain, expressed in the early E lineage (R), and kin-33 encodes a predicted kinase (M). encodes a putative T-box transcription factor the resembles proteins of the Tbx2 subfamily, and a function for had not been reported previously. T-box transcription factors play roles in cell fate specification and morphogenetic movements in diverse organisms including C. elegans, Xenopus, zebrafish, mouse, and human (L; C; N; A). In Xenopus, one of the T-box proteins, Xombi/VegT, was first identified on the basis of its ability to induce invagination in an overexpression screen, suggesting that this protein has a direct or indirect role in morphogenesis (L). How contributes to C. elegans gastrulation is not yet clear. , which is expressed specifically in endoderm progenitors as early as the 2E cell stage, has been proposed to function later in vesicle trafficking to the embryonic gut granules, which are lysosome-related organelles (R). GLO-3 protein is likely to play a direct role in regulating the formation, maturation, and/or stability of gut granules, since is required for gut granule formation, and a rescuing GLO-3::GFP fusion is localized to the gut granule membrane. encodes a predicted apyrase, a membrane-bound enzyme that catalyzes the hydrolysis of nucleoside triphosphates and diphosphates. mutant worms abnormally accumulate intestinal autofluorescence, which has been interpreted as a lysosomal traffic defect also associated with aging (U). Taken together, these results suggest the possibility that normal lysosomal trafficking in the early E lineage cells might play a specific role in successful gastrulation. Several of the proteins implicated in our screens are predicted to regulate proteolysis, and two of these were shown here to be able to interact with ubiquitin ligase complex members when expressed in human cells. An expression screen in Xenopus for proteins degraded near gastrulation revealed that regulated proteolysis plays a role in gastrulation in this system. Xom is a homeobox transcriptional repressor of dorsally expressed genes, and it is degraded early in gastrulation, allowing the dorsal side of the embryo to develop properly (Z). If the putative substrate recognition proteins we identified can be confirmed to function in regulated proteolysis in vivo, it will be of interest to identify potential targets whose degradation might contribute to normal gastrulation. Such targets might include the other gene products we identified here, as well as previously identified proteins that function in gastrulation, for example PAR proteins (N).
  81 in total

1.  Mechanisms of cell positioning during C. elegans gastrulation.

Authors:  Jen-Yi Lee; Bob Goldstein
Journal:  Development       Date:  2003-01       Impact factor: 6.868

2.  Multiple sequence alignment with the Clustal series of programs.

Authors:  Ramu Chenna; Hideaki Sugawara; Tadashi Koike; Rodrigo Lopez; Toby J Gibson; Desmond G Higgins; Julie D Thompson
Journal:  Nucleic Acids Res       Date:  2003-07-01       Impact factor: 16.971

3.  Evolution of duplicate genes versus genetic robustness against null mutations.

Authors:  Xun Gu
Journal:  Trends Genet       Date:  2003-07       Impact factor: 11.639

4.  Asymmetric sequence divergence of duplicate genes.

Authors:  Gavin C Conant; Andreas Wagner
Journal:  Genome Res       Date:  2003-09       Impact factor: 9.043

5.  A simple, fast, and accurate algorithm to estimate large phylogenies by maximum likelihood.

Authors:  Stéphane Guindon; Olivier Gascuel
Journal:  Syst Biol       Date:  2003-10       Impact factor: 15.683

6.  C. elegans PAR-3 and PAR-6 are required for apicobasal asymmetries associated with cell adhesion and gastrulation.

Authors:  Jeremy Nance; Edwin M Munro; James R Priess
Journal:  Development       Date:  2003-09-16       Impact factor: 6.868

7.  Exclusion of germ plasm proteins from somatic lineages by cullin-dependent degradation.

Authors:  Cynthia DeRenzo; Kimberly J Reese; Geraldine Seydoux
Journal:  Nature       Date:  2003-07-23       Impact factor: 49.962

8.  A Formin Homology protein and a profilin are required for cytokinesis and Arp2/3-independent assembly of cortical microfilaments in C. elegans.

Authors:  Aaron F Severson; David L Baillie; Bruce Bowerman
Journal:  Curr Biol       Date:  2002-12-23       Impact factor: 10.834

9.  Role of duplicate genes in genetic robustness against null mutations.

Authors:  Zhenglong Gu; Lars M Steinmetz; Xun Gu; Curt Scharfe; Ronald W Davis; Wen-Hsiung Li
Journal:  Nature       Date:  2003-01-02       Impact factor: 49.962

10.  Genome-wide RNAi screening in Caenorhabditis elegans.

Authors:  Ravi S Kamath; Julie Ahringer
Journal:  Methods       Date:  2003-08       Impact factor: 3.608

View more
  15 in total

Review 1.  RNAi screening: new approaches, understandings, and organisms.

Authors:  Stephanie E Mohr; Norbert Perrimon
Journal:  Wiley Interdiscip Rev RNA       Date:  2011-09-22       Impact factor: 9.957

2.  Dynamic localization of C. elegans TPR-GoLoco proteins mediates mitotic spindle orientation by extrinsic signaling.

Authors:  Adam D Werts; Minna Roh-Johnson; Bob Goldstein
Journal:  Development       Date:  2011-09-08       Impact factor: 6.868

Review 3.  Caenorhabditis elegans Gastrulation: A Model for Understanding How Cells Polarize, Change Shape, and Journey Toward the Center of an Embryo.

Authors:  Bob Goldstein; Jeremy Nance
Journal:  Genetics       Date:  2020-02       Impact factor: 4.562

4.  Identifying Regulators of Morphogenesis Common to Vertebrate Neural Tube Closure and Caenorhabditis elegans Gastrulation.

Authors:  Jessica L Sullivan-Brown; Panna Tandon; Kim E Bird; Daniel J Dickinson; Sophia C Tintori; Jennifer K Heppert; Joy H Meserve; Kathryn P Trogden; Sara K Orlowski; Frank L Conlon; Bob Goldstein
Journal:  Genetics       Date:  2015-10-04       Impact factor: 4.562

5.  Role of sirtuins in lifespan regulation is linked to methylation of nicotinamide.

Authors:  Kathrin Schmeisser; Johannes Mansfeld; Doreen Kuhlow; Sandra Weimer; Steffen Priebe; Ines Heiland; Marc Birringer; Marco Groth; Alexandra Segref; Yariv Kanfi; Nathan L Price; Sebastian Schmeisser; Stefan Schuster; Andreas F H Pfeiffer; Reinhard Guthke; Matthias Platzer; Thorsten Hoppe; Haim Y Cohen; Kim Zarse; David A Sinclair; Michael Ristow
Journal:  Nat Chem Biol       Date:  2013-09-29       Impact factor: 15.040

6.  A Transcriptional Lineage of the Early C. elegans Embryo.

Authors:  Sophia C Tintori; Erin Osborne Nishimura; Patrick Golden; Jason D Lieb; Bob Goldstein
Journal:  Dev Cell       Date:  2016-08-22       Impact factor: 12.270

Review 7.  Cadherins and their partners in the nematode worm Caenorhabditis elegans.

Authors:  Jeff Hardin; Allison Lynch; Timothy Loveless; Jonathan Pettitt
Journal:  Prog Mol Biol Transl Sci       Date:  2013       Impact factor: 3.622

8.  A genome-wide RNAi screen for enhancers of par mutants reveals new contributors to early embryonic polarity in Caenorhabditis elegans.

Authors:  Diane G Morton; Wendy A Hoose; Kenneth J Kemphues
Journal:  Genetics       Date:  2012-08-10       Impact factor: 4.562

9.  Asymmetric transcript discovery by RNA-seq in C. elegans blastomeres identifies neg-1, a gene important for anterior morphogenesis.

Authors:  Erin Osborne Nishimura; Jay C Zhang; Adam D Werts; Bob Goldstein; Jason D Lieb
Journal:  PLoS Genet       Date:  2015-04-13       Impact factor: 5.917

10.  Challenging muscle homeostasis uncovers novel chaperone interactions in Caenorhabditis elegans.

Authors:  Anna Frumkin; Shiran Dror; Wojciech Pokrzywa; Yael Bar-Lavan; Ido Karady; Thorsten Hoppe; Anat Ben-Zvi
Journal:  Front Mol Biosci       Date:  2014-11-06
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.